TADS2 bin v2.2.0'Wed May 8 09:32:52 2002 XSI:?@OBJ0C MO drN|NNN N   is closed. NJ!N^NduMOlocactorvobjN D  NN}D ~yND ! NqN%You% can't reach   from  . N*NNajjMO listOcnttotiobjjNNN%@N=N+O scN6N 8NM @N 1N N N!N$!N>!NH!NN!N^!xxMOobj1obj2N66 E E%E E  N\MO cntN"N" onetwothreefourfivesixseveneightnineteneleventwelve thirteen fourteen fifteen sixteen seventeen eighteen nineteentwenty@N#N#MO obj O<icounttotlistcurdisptot prefix_countNT&Nn&N&N&N&N&@N&NQ'Na(+Obefore after j scN(6 N)   zNl) @PN) 'N +N0+4NS+N+ N+N+ N$- ND- N-uN-N- pN-N ., =N'. NK. and N}., and N.N. N/,1NY/ N/N/N0N$0 (being worn)NE0E  No0 (providing light)N0N0N0,N0a MO objOlistitotN/9NI9Nb9Nn99N9@N9N9N9 bbMO parmN<N<>N=>>NO= MOlOtotic totweightN>N>N>N>N?@N?ND?Nd? N?N?wN?N? MO listO$itottotbulkremcurN+BNDBNPBNbBdN|B@NBNBNBNBNBN C8 MO amountNw.\b[Omedeto gozaimas!! Your score just went !  up down NN points!]\nNŋN>>NDVVMN<:You stumble around in the dark, and don't get anywhere. N'=88MOsN>NIn a total of >N' turns, you have achieved a score of NF>- points out of a possible 140, and visited N>N locationN> NsN out of 81N. This means N  #you're just getting startedsN:1+you're starting to figure some things out/N|(%you have started your journeyN< you are well on your wayNP'!you are proving yourself worthyN dKaneiji would be proudYNK x%the gods are smiling upon you!N you are a true heroN .B \n\b\tDomo arigato gozaimas! Thank you for playing \(KATANA!\)N MN.hhMN=7***\bYou wake up some time later, feeling refreshed. N=N>T\\MOoNH N.H! NIH(NbHqNH(NH8NH%NIN_I!NI/NI NI &NIŔ!NJMO objOretilstlenNqK NK"D"E |~NKNLN8LNLL!NrL@NLNLNLP..MO parmN"{NFFMOxNQNuh h hd5)+LVWVX^^MO objNNNoZN:NOn !  you see !. NaNE CN&\^ !  seems to contain !. NqNwE NNN3N3MO objOlistitotthisobjN96NS6Nl6Nx6qN6@N6E E N7N57NI7NO7<<MOpointsturnsN~;N;r  PMN<|MN"<|MNx < N<|0N is open. NӁ)NCN  is closed. NuQ"N)NN˂|f_MO actorN <|3N # <  is already open! N [N ehMO actorNo<>No Opening <  reveals . NoNo Opened. No+"|NoHibMO actorNl<|5N <  is already closed! N̈́NׄjAMO actorNn Closed. Nn !|Nn(ZMO actorNL<|-Ns <  is closed. NNTMO actorN<|E Q"N`It's closed. N|&MO actorNo< MOobjactorOretilstlenNpM NM! NMNdO"D"E |D NONONPN-PDNP@ NP@ NPNQC EC  NQC N2RN=RNMR!**MO objNS[NS"MO fnameNU7N VRestore failed. N)V!N=V`NwV>>NV Restored.\bNW"C NLW"NaWNgW4,T>A,A ,A(@ ,@Cx#8888/ MOnNZMN[["MO avNW6[0MOavnO objN[! N[<N[<N\!N&\ZN?\NW\#!N\N\MOnND\"#MOavipNh\<! ZNh ];You'll have to be more specific about which one you mean.NhT]*Nhf]Nhp]"7MOavdpNv]<#$**** \( \)%$ in out ofBMNlb< Nb< Nb!NbCMNb!< , !< !< N)caMO verbosityNQc<Nnc<Nc<Nc< NcYMO objN)c< ! D<N),d)N)Td< N)}d&ffffJMO actorN%You% can't throw !< . N'0MN w<>NNwOn <  %you% see%s% . Nw4NwThere's nothing on < . NwNwMO actorNwO:MOactordobjN;xN^xMO actorNdx%MO actorN@x< =N@xOn !<  %you% see%s% !. /N@yThere's nothing on !< . N@Ly(h7 7 7&%'MNg  out ofMO#actorvdobjprepioNMzh! E ) NMhNMh! E * E + NMiNM2i)NMKiMO actorNQitMNi1%You're% not going anywhere until %you% get%s% !< !< . Ni!Ni&MO actorNi<&MO actorN*j<fMO actorNvj  5Nj%You're% already on < ! NjNjdMO actorNfk Okay, %you're% now sitting on < . NfDkNfbk/MO actorNk<Nk/MO actorNk<Nk)\*qqqX%UMO prepN9U7You can't use multiple direct objects with this verb.+qqqW%UMO prepNT7You can't use multiple direct objects with this verb.,( bed on out ofeMO actorNH+mOkay, %you're% now lying on !< .NHdmNHm-  MO actorN#MO actorN=<gMNI\^!<  !< do does(n't smell like anything in particular.MO actor#MO actorNb<SMN!< It feels They feel just like !<,. You don't hear anything.MO actorN#MO actorN-<.||||VMO actorN##.That wouldn't be very polite, now, would it?N##0****-10MO actorO %waslitN5 N5"N5 "N5<You switch on !< N5 EHN5, lighting the area.\bN5 N5FN5].N5n20tMO actorNL%You%'ll have to be more specific about how %you% want%s% to search that. N MOactorlistOfounddestitotN7<!:N` NN)NN!NN< N[@NN N$<"NC N%You% find%s% NNNN@,N3NN, nNd E  N and 9N E  N, and N@&NN5Nh<"(N, which %you% take%s%. N! N! E N!NN*!"32MO actorN!#MO actorNE<! :NE=There's nothing else under !< . NE<< NE42MO actorN!1$MO actorNEq<! ;NEThere's nothing else behind !< . NE<< NE&5ffff2MO actorN!%~MO actorNE<! 7NEThere's nothing else in !< . NE)<< NEp<MO actorN<! N)N&XMO actorN <! N )&N C<< N 6gMO actorNV<  7NoBut %you% %are%n't holding !< . N70/MO actorNz<N(hMO actorNNThat was delicious! NN>)<*)NN !<&NN<*MNB>+8  &,- .MN; < Nu+ can be turned to settings numbered from !<, to !<-. It's currently set to !<.. NMO actorN/*MO actorN*-9NA#MOactorioN,G0MOactorioNU NU><,D ><- 3NUThere's no such setting! NUGNUU><. UNU>.NUOkay, it's now turned to <.. NU 9NU7It's already set to <.! NUxNUKNUI don't know how to turn < NU to that. NUNU9`    to:&1MO actorN2MO actorN=<N=Okay, <  is now switched N=2<N=MonN=loffN=. N=MO actorNk E }"NIt's pitch black.6N<&NIt's already turned on! NSMO actorNy;"NyZOkay, it's now turned on. NyTMO actorN<'NIt's already turned off! N3TMO actorN,!N,/Okay, it's now turned off. N,V;JIII$MOremcurtotiN<KN"N>LN(NDNTcNw@N~E N"NNN!NMO#actorvdobjprepioN"J<E M=N"%You% can't see a thing. N"*N"N")N"HMN<N))NSIn the dark.No_MO verbosityN<N) NIt's pitch black. NTMN<N,)&N\Nv!NNyMOvN<D MN"7NIt's pitch black.\nN2!NJNT<iiiMMOactordobjNOK. N &N=bbbbFMNqI don't think !<  would appreciate that. >P?  =MN;<YZ6MN/< <Y  is no longer here. ,MOvdpiN{u<<*>MN<YQMO actorN<[7MO actorN+=<Y NZ=#}MOavipN+=@ FN+=\^!<Y  is no longer here.N+=*N+=N+>"aMOavdpN(>\^!<Y  is no longer here.Nc>*Nq>@|;;;Y follow.Q[ Addd=(MOvNB<  you  yourself,  yourself %%You look about the same as always.   QVMO actorNC )NDYou can't follow yourself! N;D2MO verbdobjprepiobjNrDMO roomNGDNGD\#NGD]<NGENGE< D NGiENGEQNGE< NGE< NG F NG1FNGWFNGeFNGoF&.MO roomN>F N>FVvMOactordobjNrF You accept !  from ! .NrGC&Nr#NA#C'MO actorN.(MO actorN=.  )N=/You don't have a camera!3N=3/You take a snapshot of !< . E::::&MO actorNMOF^+++0^bMNQ<CNR(Taking off <  first)\nNGR!NgRNqR8MO actorNR<^NR)NR=MOactorioNR<^NR)NS=MOactorioN6S<^NNS)NdS=MOactorioNES<^NES)NES=MOactorioNS<^NS)NT=MOactorioN7T<^NOT)NgT8MO actorNT<^NT)NT&7MO objNLU!NLU)&NLUMO actorN!V<=NDV%You're% already wearing < ! NVINV}4NV%You% %do%n't have < . NVNW_^MO actorN?#WOkay, %you're% now wearing < . N?^W"N?{WcMO actorNW<6NW%You're% not wearing < . NXN XNMO actorN -X<N FX<N xX)N XNMO actorN`X<N`X<`N`X)N`Y`dMO actorN7Y#Okay, %you're% no longer wearing < . NxY!NY`G\H& &Ga]MN`<|N`<bN`<cE<dsN.a"|NOa<eNoa"<e|Na (Opening !< )\nNa<bNa]Nb%You%'ll have to open !<  first. NObNhb!NbNbfyMO actorN@b<|$N@bIt's already open. +N@b<cN@ cIt's locked. N@&cgUMOsettingNKc|Nkc<eNc<e|NchAMO actorNc Opened. Nc"<gNdiPMO actorNa+d<|#NaHdIt's already closed. NamdjAMO actorNd Closed. Nd!<gNdkMO actorNd<c&NdIt's already locked! sN"e<l%NHeIt can't be locked. ?Nle<|/Ne#%You%'ll have to close it first. NemMO actorNe<n! SNf Locked. Nf"cN>f<eN^f"<ecNfNf-INfoLMO actorNZf<cNZgIt's not locked! NZ(gpMO actorNJg<n! UNrg Unlocked. Ng!cNg<eNg!<ecNgNh-IN2hqMOactorioNA]h<c&NAxhIt's already locked. NAh<l%NAhIt can't be locked. NAh<n! 9NA i*%You% %do%n't need anything to lock it. ?NABi<|/NA`i#%You%'ll have to close it first. NAirMOactorioNXi<n SNXi Locked. NXi"cNXj<eNX;j"<ecNXlj'NXjIt doesn't fit the lock. NXjsMOactorioN j<c"N jIt's not locked! JN k<n! 8N NDIn <  %you% see%s% . N4NThere's nothing in < . NNlMO objN<E<|:N?%You% will have to open !<  first. NhAMO actorNL"|NL Opened. NLҗMO actorNؗ&&MO actorN<%MO actorN$%MO actorN\<E< =NIn !<  %you% see%s% !. /NThere's nothing in !< . N%R""""f_MO actorN<c'NAIt's locked. N^Nu)fNkXMO actorN~<c,N~ىIt's already locked! N~N~mMO actorN(<|ANK%You%'ll have to close <  first. N.N Locked. NŊ"cNNoLMO actorN{<cN{6It's not locked! N{WpCMO actorNy Unlocked. N!cNqTMOactorioN؋<c#NIt's already locked. NsMOactorioNpE<c,Npd\^!< not locked! SNp<n! ANp(%You% %do%n't need anything to unlock !<.NpSRnm*MO actorN-INp*MO actorNOÎ-INO܎rMOactorioN<|HN'%You% can't lock !<  when it's open. NkjNu<n 1N Locked. N"cN܏'NIt doesn't fit the lock. NtMOactorioNfF<n 3Nfm Unlocked. Nf!cNf'NfIt doesn't fit the lock. NfU0yMO actorNz:MOactordobjN=tN={MO actorN}$|:MOactordobjNfrNVdccc0MO actorN}#MO actorN=-<WMO actorNcMO actorN=C<D <> N= N=TFootnotes aren't assigned until they are encountered in the game. Repeatedly guessing footnotes will accomplish nothing. Stinkin' cheater...N=No such footnote.N=FN=! [ Footnote !<:\ !><@ ]N=oN=}X"MN"!<","MN"!<" "MN-"!<"MOactorio~>MOactorioNM"Tap, tap, tap, tap..." ~~~MO actorN+ÝMO actorNO<4NO!Save failed. NO>!NOV+NOw Saved. NO"NONO9MO actorNў<N+NMO actorN!2MO actorNE@<"NEh9MO actorN}<N}+N}MO actorNQMO actorN<NWriting script file. N=9MO actorN7_<N7+N7MO actorNv?MO actorNʠ Okay, "<".NYjjjj NMOactorprepioN G N2 ZYM[d### about\CCCY dig inI.I ]GMO actorNP> H You leap from the top of the tree. Contrary to popular belief, you don't black out or expire from a heart attack; instead, you're awake and screaming the whole fifty-foot drop to your death.> I You jump, from thirty feet off the ground. You barely have time to think what a stupid idea that was before you hit the dirt.> J qYou jump out of the tree and land, somewhat painfully, on the ground. You're lucky you didn't sprain an ankle.K>&v> L You leap from the footbridge into the pond. The water is fairly shallow, but as you never even learned how to dogpaddle, it's deep enough to drown in.> M rgIf you insist... Fifteen feet isn't really that high, but you manage to land in just the wrong way.J> N rgIf you insist... Fifteen feet isn't really that high, but you manage to land in just the wrong way.> O RGOkay. You hurl yourself from the scaffold and plummet to your death.p> " 2,Such behavior is unbecoming for a samurai.52You jump, for no apparent reason. That was fun.^fffT%JMO prepNS(You can only push one thing at a time."_%YMO prepN$7You can't use multiple direct objects with this verb.".`fff%JMO prepNo (You can only wear one thing at a time."ajjj NMOactorprepioN1G Nb`    onc MOactorprepioN(/ A PN)%You can't use "all" with this verb. Ne) Nu)Nx)) N)db""" fromev555%I.I789:fgggR%KMO prepNR)You can only close one thing at a time."g`hjjj NMOactorprepioNRG Nib!!! offjb!!! outkiii%MMO prepN+You can only plug in one thing at a time."l\muuu9%YMO prepNC7You can't use multiple direct objects with this verb."nuuu:%YMO prepN[D7You can't use multiple direct objects with this verb."oyyy %]MO prepN&)You can only turn one thing at a time. N*'"N?'p|;;;Y switch.12 qz999Y flip. r~>>>YZ  turn on. s~===Y  turn off.3 t\u|;;;Y sit on. v|;;;Y lie on. w|;;;Y get on. xVZyVVVZ:MO actorNTime passes...\nNzYMO actorN#ENQ%You% %have% . N N)N%You% %are% empty-handed.\nN{|uuu%YMO prepN%7You can't use multiple direct objects with this verb."}~~~%KMO prepN)The game's not THAT frustrating, is it?".  &~ggg]%KMO prepNX)You can only climb one thing at a time."eee%IMO prepN'You can only eat one thing at a time."gggV%KMO prepNiT)You can only drink one thing at a time."jjj NMOactorprepioNG N9fffU%JMO prepNT(You can only pull one thing at a time."\%^MO prepNm*You can only throw one thing at a time. N"N.A&bOgP`    at~===Y  stand on.n---Y standMO actorN0M ! D  ! ,N0%You're% already standing! N0g"(N0 N0<(&N0 N0#N0- N0^N0lN0v666 Konichiwa! Genki deska?jjj NMOactorprepioNtG Nxxx#I%=MO prepN!6A little anal, aren't we?".I x888Y say.yyy[MO actorNW> \ You scream at the top of your lungs, and notice a faint rumbling sound in the distance, which soon fades. If your voice was a lot louder, you could probably start an avalanche.AAAAAAARGH!!!!%MMO prepNX+You can only yell at one thing at a time.".mn*555'I.I |;;;Y fasten.~===Y  unfasten.KKKY unplug.!d DJ\\AAAY typeb.b~QQQY lockI.!I{|qrkm DJSSSY unlockI.!Iyzstop DJuuu%YMO prepNn%7You can't use multiple direct objects with this verb."ZMO actorNlV>l" TNYou might as well stay awake now. You only have an hour or so left to live.You're not very sleepy.z999Y poke.V???Y  move north.???Y  move south.~>>>Y  move east.~>>>Y  move west.CCCY move northeast.CCCY move northwest.CCCY move southeast.CCCY move southwest.|;;;Y center. %eMO prepN(You can only !< one thing at a time. NB("NW(YZ{{{-MO actorN)<,MO actorNL A{{{-MO actorN<,MO actorNL4 @{{{-MO actorN<,MO actorNL ?{{{-MO actorN-<,MO actorNL B{{{-MO actorN<,MO actorNLJ E{{{-MO actorN<,MO actorNL F{{{-MO actorNP<,MO actorNL G{{{-MO actorN <,MO actorNL~ Hggg^%KMO prepNY)You can only enter one thing at a time."{{{-MO actorN<,MO actorNL' D{{{-MO actorNr<,MO actorNL CYZV nMO actorNOkay, now in VERBOSE mode.\nN"5N"C N9MO actorN;<N\+NkUMO actorNOkay, now in TERSE mode.\nN!5N9MO actorNt#<NtB+NtQ,MO actorNN9MO actorNK<NK+NK save MO actorO%savefileN5File to save game inN5! D  /N5 Failed. N5!N56qN5@5N5kSaved failed. N5!N5+N5 Saved. N5"N5N59MO actorN8<N8:+N8I.@@@  restoreMO actorO(savefileN8File to restore game fromN8$! D  /N8[ Failed. N8s!N8N8"N8N89MO actorN<N!+N0.MO actorO scriptfileN)File to write transcript toN)! D  N)- Failed. N)\N)dAll text will now be saved to the script file. Type UNSCRIPT at any time to discontinue scripting.N)N)9MO actorN8%<N8I+N8X.IMO actorN!NScript closed.\nN9MO actorNh<Nh"+Nh1=MO actorO yesnoN)"N)5Are you sure you want to start over? (YES or NO) > N)N) WN)?\nN)UN)x>##N)YN)AN) ,N)  \nOkay.\nN)'N)>N)LN)V9MO actorN\v<N\+N\MO actorNt\(Katana\)\nVersion 2.0\nA TADS Adventure\nDeveloped with TADS, the Text Adventure Development System.\b\bNotes:\bVersion 1.0 - Original release\bVersion 2.0 - Fixed lots of code where the parser required the player to type a command in a specific way; most of these actions are now handled automatically. Also repaired a few glaring bugs and added a few more synonyms here and there.mmm SSA TADS Adventure \n Developed with TADS, the Text Adventure Development System.\n oMO actorN$CN7You can't think this game has any bugs left in it... N 9MO actorN,<NO+N^d###MO actorN%E%bN(Undoing one command)\bNC"C Nx>>N5N)No more undo information is available. N9MO actorN<N=+NL`    off%%%  betweenb""" overd$$$ aroundf%%%  throughd### northd### underd$$$ behindTDDMN\b*** You have died ***\bNNMNN)>Nr>%NCompiled in WIZARD modeNKR\bPlease type \(INFO\) for credits and general release information.\bFootnotes 3Footnotes are numbers encased in square brackets.Y can be read by typing "NOTE" followed by the footnote number; e.g., type "NOTE 1".\b\bN!# NN NR"> N"> 4NN00MNkNani?ur pardon? N ZZMO parmO asN7#>Ne#>N#>N# D  D ^N$O\bYou're feeling a bit drowsy; you should find a comfortable place to sleep. `N($ D pN$a\bYou really should find someplace to sleep soon, or you'll probably pass out from exhaustion. N$#N$N%C DC N%L\bYou find yourself unable to stay awake any longer. Fortunately, you are !C  !C ,m, so you gently slip off into unconsciousness. \b* * * * * \bYou awake some time later, feeling refreshed. N&uOitemRemthisItemN'\bYou find yourself unable to stay awake any longer. You pass out, falling to the ground. \b* * * * * \bYou awaken, feeling somewhat the worse for wear. You get up and dust yourself off. N'CN(cNN(Nx(N(C &N(N )N)N!)N')MO parmO elN*>))N*>+N*>)N + D D  kNw+\\bYou're feeling a bit peckish. Perhaps it would be a good time to find something to eat. N+ D D {N,l\bYou're feeling really hungry. You should find some food soon or you'll pass out from lack of nutrition. NT, D# :N{,+\bYou can't go much longer without food. N,(zN-W\bYou simply can't go on any longer without food. You perish from lack of nutrition. N9-NH-NN-MN.jjMO fnameNN:#\b[Restoring saved position...]\bN"NJ   $ Shinobu Park entrance vv\b\tYou are at the entrance to the park grounds. Shinobu Palace looms majestically to the north, past a large pond. East and west, raked gravel paths wind into the trees, and a dirt road south heads back to the village. Looking around, you notice that the park seems strangely deserted, even though this is supposedly a busy tourist season.\b\tThere's a trash can here.?DAEBF@MN H" ON @There's still a lot you want to see here before you head back!fN ZAre you kidding? There's some very strange stuff going on here. You need some answers. ,,The trees are too thick in that direction.C You can't go that way.D You can't go that way.MOoN LN N! ONN2>LLNf!NNN MN >  N You are a powerful-looking man with wild black hair and a shaggy beard, dressed in lavish blue and green robes. For some reason, you feel very angry.>  PN@ AYou are a beautiful young woman dressed in a snow-white kimono.>  pN aYou are a beautiful woman dressed in a fiery red kimono. For some reason, you feel very upset.2N >8" SN DYou're bleeding from several wounds, but you think you'll survive.>  gN XYou look the same as always- a proud young samurai in the prime of his fighting years.[> \ xNA iYou're bleeding from scores of small wounds. Enemy blades have pierced your armor in dozens of places.> j xN iYou're bleeding from scores of small wounds. Enemy blades have pierced your armor in dozens of places.U> ^ xNc iYou're bleeding from scores of small wounds. Enemy blades have pierced your armor in dozens of places.> " hN YYou look the same as always - a proud young samurai in the prime of his fighting years.a>l" NThree days of no food and little sleep have taken their toll on your body; your skin is pale, your hair is filthy, and your muscles tremble from hunger and exhaustion.>" =N.Your body is covered with faint white scars.Z> " NYou are a beautiful young woman wearing a blue silk kimono. You're shivering, as much from the cold as from the fear of what you are about to do.> " LN=You are a beautiful young woman wearing a blue silk kimono.YN*MYou're a little worn out from all this travel, but otherwise you look fine. !MO actorN> " EN6There would be no honor in committing Hara-kiri now.> " E >x  Ny"Hara-kiri. Noun. Ritual suicide by disembowelment with a sword." Doesn't sound like a whole lot of fun, now, does it?>l" E >I > GN8A tempting thought, but perhaps there is still hope...>l" E >H > ?N0Honor would be better served by killing Ryuko.g>l" E >I > E >H > NIt is done.\b\tYou calmly raise your katana and plunge it into your own stomach. As pain floods your mind, you hear the cries of shock from the surrounding soldiers. You force yourself to stare straight ahead, surrendering to the pain while simultaneously detaching yourself from it. You sink to your knees in a growing pool of blood as you feel your spirit drifting... drifting... Vision fading, you surrender to that final darkness...\b\t"No!!"\b\tA female scream snaps you back to awareness. A small, slender figure bursts forth from the crowd of soldiers surrounding you and collapses at your side, sobbing hysterically. The pain engulfs you in a white-hot rush and you awaken to find yourself in Gio's lap, her cold hands stroking your face, your blood staining her blue kimono.\n\tYou force yourself to look at her tear-filled eyes, her trembling lips. \n\t"Why, my love?" the words echo in your ears, but you are not sure if you or Gio spoke them. "Why?" \b\tWithout warning, the world swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\tNCIC9H>" NWell... Ok. After all, you suppose it couldn't really hurt in this place...\b\b\b***You have died***\b\b\b\t...etc., etc., \b\t>  N>*>  >NBbNsVThere are lots of ways to get yourself killed in this game, if you really want to...MOactorioNx NX{"Hara-kiri. Noun. Ritual suicide by disembowelment with a sword." Doesn't sound like a whole lot of fun, now, does it?How? By swallowing it?+MO actorN> " SNDIf you knew how to do that, you wouldn't need to take a vacation!!:N3.Such behavior is unbecoming for a samurai...yMO actorNV> " You could use a shower.5N)You could use a trip to the bath house.[MO actorN> " JN,;You give yourself a big kiss. Don't you feel better now?:Nu.Such behavior is unbecoming for a samurai...:MO actorN> " 0N!You'd break your neck trying...1.Such behavior is unbecoming for a samurai...MO actorNV> " 5NVe&Auto-cannibalism isn't the answer...1.Such behavior is unbecoming for a samurai...MO actorN> " 7N(You kick yourself. It hurts a little./,Such behavior is unbecoming for a samurai.MO actorNxF> " JNx;You should have taken a bath BEFORE you left the hotel...3Nx'You can visit the bath house later...MO actorN > " jN 7VYou plunge a straw into your chest and suck the blood out of your heart. Happy now?8N ,Such behavior is unbecoming for a samurai.HMO actorN)How about typing "INVENTORY" instead...f\MO actorN;O =Try as you might, you just can't figure out a way to do it! ?MO actorN^  Just pick a direction, stupid!'MO actorN > " >  )N You don't have a camera!zN7!nYou hold the camera at arm's length and, grinning stupidly at the lens, you snap a picture of your own face.2N!&What are you talking about, Kaneiji?;MN!> " gN!P\b\tYour wounds feel better now, surprisingly. They're almost totally healed.!8 NK"!8MN"\b\tThe sun sinks lower into the sky, painting your surroundings in vibrant reddish hues. You guess that you probably only have an hour or so of daylight left.9\MN#(>&!l6>&&Nc#(>L&AN#!>K&ZZMN ?\(Katana\) by Matt Rohde (rohdemusic@yahoo.com)\b \tFrom this distance, at least, Shinobu Palace looks like you'd always imagined it would - an imposing structure of walls and turrets seated regally atop a tall hill, floating above the surrounding gardens like a cloud. You'd saved this visit to your ancestral home for the end of your trip, figuring it would be a relaxing way to spend your last day in Japan, but now you wish you hadn't - it took most of the day to get here, and now you'll have to rush through the sights in order to make it back to the train station before nightfall.\b \tIt's too bad, really. You've always been intrigued by the story of the infamous samurai who had onced lived here so long ago; your venerable ancestor Matsuo Kaneiji. According to legend, Kaneiji was one of the most feared and respected young warriors of the early Ashikaga period. His notoriety, tragically, stemmed not from his heroic accomplishments in life, but rather from his death; he was executed dishonorably for treason before his thirtieth birthday. You were hoping that, through a little research, you'd be able to shed some light on this dark chapter in your family's history; now it looks like you'll have to settle for a few snapshots of Kaneiji's tomb, if you can even find it... \b\(Katana\)\nVersion 2.0\nN `    inx888Y eat.(.Y xyzzyMO actorN&uSigh... I know it's convention to have some inane cute response to magic words from classic adventure games, but ya know what? Screw it. It's been done.N&gggYKMO actorN#Nice weather we've been having.\nNY frotz1MO actorN&T>N&u%ZMO prepN]8You can't use multiple direct objects with this verb..".&Y lagach1MO actorN'O >N'p %YMO prepN^ 7You can't use multiple direct objects with this verb.".&h.g.|g.|g. onMO objNC4wMO objNeJw,$MNowa <Nw=MN x<N x<N=xsNNx &MNhxthe <NxBMNGy<N`ytheyNyitNyBMN*z<NCzthemNdzitNvzGMNz<Nz they'reN{it'sN({BMN{<N{doN{doesN{AMN4|<NM|areNm|isN|GMN|<N|aren'tN}isn'tN1}-MN7}<?MNX}It looks like an ordinary < to %me%./MN}%You% can't read <,. UMOvdpiNo}You have lost your mind. No"~*No0~MN6~"MN]~"~MO objO mylocN~< N~TN~ N "N)NP~NxN!N&MO objO locNj< N4NN€ NN< N< < NV NtNNMO actorN [Please specify the name of the game to save in double quotes, for example, SAVE "GAME1". NHMO actorNaPlease specify the name of the game to restore in double quotes, for example, RESTORE "GAME1". NMO actorNOgYou should type the name of a file to write the transcript to in quotes, for example, SCRIPT "LOG1". NzMO actorN>RYou should say what you want to say in double quotes, for example, SAY "HELLO". N> PMO actorN. Pushing <  doesn't do anything. NjEMO actorN%You% can't wear < . NzMO actorN_<  9N_%You% already %have% < ! N_GN_^<N_MO actorO locNQ< NoGN NNΆ NNMOvantageO s locN 2< N P! N g!N   E<N 6"N  N "N HE N "N  ! E  E  <N %"N q!N MO actorN QN ы\^!  ! not respond.N N (N 2."RN j!There's no point in talking to !.N N N Ќ< ! N   BN $%You% can't reach that from !  . %N %You% can't reach that.N N N ̍< D < |N < <N G%You%'ll have to open !<   first. N DMO actorO locN   ! D ! N O!N   ! N "N < N Ő  ! N "N ! N .!N F D  N w"N N N ޑ!N \MO actorO totbulk totweightN 5 <N m N } N Œ<< N  +N <%Your% load is too heavy. }N f 9N *%You've% already got %your% hands full. /N ߓ<&N  Taken. N N "|MO actorNAE}:NAw%You're% not carrying < ! NANA<NA4MO actorN N)IMO actorNN%You're% not wearing < ! NRMO actorNL %You% can't put anything into < . NLMO ioOcontprepNq  oninNӖ%You% can't put !<  ! !  , because !  ! !   already ! !  N  ~N , which ! !   already ! !  N ~N. NMOactorioNUј! NUNU<  @NU& <  is already in  ! NUmNUw >NU%You% can't put <  in itself! NUۙ;NU~NU<NU8<NU^FMOactorioNs<&NsDone. NsOMO actorNԚThere's no good surface on < . NMOactorioN7! NMNb<  @N <  is already on  ! NӛNݛ >N%You% can't put <  on itself! NA;NK~Nk<N<NĜFMOactorioN2<&N2Done. N2MO actorN~:MOactordobjN\NMOactorioN! E <~GN <  <N in  . N>NU<N4MOactorioN}˞<N}MO actorN:MOactordobjN-NRMOactorioN|! E <~DN <  <N on  ! NN<Nh4MOactorioN<NSMO actorNР!%You% can't plug anything into < . NXMOactorioNF8%You% can't plug <  into anything. NFwJMO actorNIt's not plugged into < . N֡cMOactorioN! 1NIt's not plugged into  . NVGMO actorN]{There's nothing in < . N]@MN%You% can't see much through !< .\nUMO actorN#%You% can't see anything through < . NZJMO actorNKThere's nothing under < . NKMO actorN,MO actorN<N MMO actorN/I don't know how to read < . NhKMO actorNDThere's nothing behind < . NDȤTMO actorN Turning <  doesn't have any effect. N+YMOactorioNV Turning <  doesn't have any effect. NYMOactorioNN Turning <  doesn't have any effect. NNGMO actorN$I don't know how to do that. NMPMO actorNrI don't know how to turn <  on. NQMO actorNPԦI don't know how to turn <  off. NPMO actorN:MOactordobjNYNtMOactorioN Surely, %you% can't think < N  knows anything about it! N MO actorN :MOactordobjNNNuaMOactorioNIt doesn't look as though <  is interested. NMO actorNP  BNP=%You're% not !< !< ! NPINP< ! 7NP%You% can't leave !< ! NPNPMO actorN <SN B%You%'ll have to unfasten !   first. N qN ǪOkay, %you're% no longer !< !< . N <N 9< &N dN n]MOactorioN! Attacking <  doesn't appear productive. N!߫[MO actorNg!)It's not very effective to attack with < . Ng!OPMO actorN!q <  doesn't appear appetizing. N!PMO actorN"Ӭ <  doesn't appear appetizing. N"MOactorioNt":}:Nt"l%You're% not carrying < . Nt"Nt"<Nt"׭FMOactorioN"<&N"Done. N"*TMO actorNG#M Pulling <  doesn't have any effect. NG#MOactorioN#}:N#%You're% not carrying < . N##N#-<N#TTMOactorioN(${%You% miss%es%. N($ <&N($qMO actorN$}AN$%You% could at least drop <  first. N$VN$`:MOactordobjN$N$MOactorioN9%ذ}:N9% %You're% not carrying < . N9%DN9%[<N9%TMOactorioN%%You% miss%es%. N%ı <&N%|MO actorN&}:N&A%You're% not carrying < . N&{N&<N&GMO actorN&ٲ Thrown. N& <&N&#MOactorioN&=nMOactorioN'c! <N'    impressed. N'ƳN'гIMO actorN' <  < impressed. N'7NMO actorN'[ <  looks a bit cleaner now. N'#MOactorioN)( SMOactorioNR( <  looks a bit cleaner now. NR( SMO actorN(B Moving <  doesn't reveal anything. N( XMOactorioN) Moving <  doesn't reveal anything. N) HMO actorNb) That doesn't get us anywhere. Nb)8 XMOactorioN)c Moving <  doesn't reveal anything. N)KMO actorN*ɶ <  doesn't seem to help. N*MOactorioN_*o`You should say what you want to type in double quotes, for example, TYPE "HELLO" ON KEYBOARD. N_*]MO actorN*÷ Touching < $ doesn't seem to have any effect. N* [MO actorNU+/ Poking < $ doesn't seem to have any effect. NU+vMO actorN+|PMO actorN+(You'll have to tell me how to do that.N+1MN%You% can't seem to do that. #MO actorNg, <#MO actorN,M<#MO actorN,z<#MO actorN,<#MO actorN -Թ<#MO actorN4-<#MO actorN]-0<#MO actorN-^<MMO actorN-%%You% find%s% nothing of interest. N-ں'#MN5< <&NV( MN!<&Nʻ)MNC<pcMO actorNc> " 2,A samurai needs no one's help but his own.  You can ask the vendor about some things, or show her objects that you're not sure what to do with. Once you get the textbook, looking up things will provide lots of clues. If you're really stuck, the complete walkthrough is also available by typing "WALKTHRU". \b\tAUTHOR'S NOTE:\tI hope you enjoy Katana. I've been a huge fan of interactive fiction since the ZORK days, and I've always wanted to try my hand at the genre. As you've no doubt noticed by the file size, this is a pretty huge game. Don't expect to finish it in one sitting. Since I'm partial to classic IF, this game definitely has an "old school" feel; there are lots of puzzles to solve, and lots of places to explore, but I've tried to make the story the main focus, and the puzzles themselves were not designed to be terribly difficult (just in case, I've incorporated a few hints and the walkthrough into the game; you can type HINT if you get stuck). There are no time limits in Katana, and the main character doesn't need to eat or sleep (or use the bathroom!). It is possible to put the game in an unwinnable state; however, it should be pretty obvious when you do. Save often, and don't be afraid to use the undo command.\n\t I'd like to say thanks to Magnus Olsson, David M. Baggett, Stephen Granade, Michael Roberts, and countless others whom I've shamelessly stolen source code from; this game couldn't exist without their (unwitting) contributions. Also big, big thanks to my beta-testers Gregg V. Carroll, Cedric Knight, Steven Kollmansberger, and Eytan Zweig. If you like this game, hate it, have suggestions, criticisms, bug reports, etc., feel free to drop me a line at rohdemusic@yahoo.com. The game is free, but if you feel an undeniable desire to send money, I won't stop you... Send me an email and I'll give you the address. Have fun playing the game, and good luck!!\b\tP.S. If this is your first time playing an interactive fiction game, type INSTRUCTIONS.``` info8MO actorN%J >N%a +N%i .Y take ^MOactorprepio O9%retremcurrem2cur2totitot2 jNA] NAhj D i D g D b D d E! NANANA2NARcNA}@NAE<NANANANA$NA<NA NAENAaNAqNA@NA NAE |D E NAeNANA NA tNA @NA:E NANANA  NANANA.3NA<NArNANANAwNANA.ai jd gb CCCMO actorO yesnoN)N).\bDo you really want to quit? (YES or NO) > N),N)E\bN)S *N)tN)N)N)Okay. N)N)9MO actorN$<NB+NQ,Y sneezeMO actorN'[ >  & "Bless you!" the vendor says.6N' *This being Japan, no one says anything. N' c c c$ Peaceful meadow \b\tThis beautifully manicured lawn, surrounded by pines, is painted with hundreds of species of flowers, tastefully arranged in colorful formations all around the meadow's borders. Paths lead north, south, east and west. 44The sweet smell of flowers is almost overpowering.AF?dB[@K6MN HW\b\tThe vendor's eyes light up as she sees you. "Irashyaimasse!!" she shouts happily.CN H ,,The pines are too thick in that direction.C You can't go that way.D You can't go that way.uuu_%YMO prepNY7You can't use multiple direct objects with this verb."NMMM1MO actorN# >ND Y empty%KMO prepN&z)You can only empty one thing at a time.".&Y flip through%RMO prepN-a0You can only flip through one thing at a time.".&RRRY throw.!9 DJzzzzMO actorN :MOactordobjN= N=  -EMO actorN9%You% can't have < . N94MOactorioN<N=EMO actorN`%You% can't drop < . N4MOactorioN <N RMOactorioNC%You% can't put <  anywhere. NC;RMOactorioNc%You% can't put <  anywhere. N EMO actorN%You% can't move < . NPMOactoriobjN>%You% can't throw !< .N>K0RMO actorN6\^!<  is too fragile to throw. Np4MOactorioNq<NqCCCY attackI.IyyyMO actorNMO actorN=1\^!< : flies through the air, landing a short distance away. N= <&N=7MOactorioN<N7MOactorioN*<NP4MOactorioNBv<NB) Outside the cave \b\tYou are standing at the entrance to a large cave. All of the other gods and goddesses are here, congregating around a sakaki tree. It's very dark out, although your body clock tells you that it should be the middle of the day.6qMN O=U\b\tYou feel different, somehow.\b\tYou also have a beautiful mirror in your hands.>2& MN (>As you move away from the cave, a strange sensation overtakes you, as if a part of you is being transported to another time and place. As if emerging from a dream, you suddenly awaken to find yourself...\b\tN q>?>>2 6 N >!>2&@A___) Inside the caveMN Y\b\tYou are sitting in a tiny room inside a cave. You've blocked the entrance with a huge boulder. Tiny passages snake off in every direction.N Y>>e HN Z<\b\tYou hear the faint strains of joyous laughter outside.6 ""\b\tYou feel different, somehow.MN 0[As you move further into the cave, a strange sensation overtakes you, as if a part of you is being transported to another time and place. As if emerging from a dream, you suddenly awaken to find yourself...\b\t?>@A.) Outside the cavejMN \b\tYou are at the top of the mountain, standing at the entrance to a small cave. All of the other gods and goddesses are here, congregating around a sakaki tree. It's very dark out, although your body clock tells you that it should be the middle of the day.>= ! E >(  <N 0\b\tYou have a beautiful mirror in your hands.6 ""\b\tYou feel different, somehow."MN As you move away from the cave, a strange sensation overtakes you, as if a part of you is being transported to another time and place. As if emerging from a dream, you suddenly awaken to find yourself...\b\tN V?>>( *  >(&N @AY accept%LMO prepN'*You can only accept one thing at a time.".!&dY fillI%JMO prepN-(You can only fill one thing at a time.".!&I  0 |xMNC|<E< >N|In <  %you% see%s% . N|4N|There's nothing in < . N0}N:}MO actorN^}PMOactordobjN}< < <N}%You% can't fit that in < . N ~ N+~NR~N\~MO actorNb~&/MO actorN~<%N~MO actorN~%MO actorN~<E< =N8In !<  %you% see%s% !. /NThere's nothing in !< . NY kick%JMO prepN%(You can only kick one thing at a time.".& MO actorN;>  %You're not a violent goddess!>  60Your brother is the violent one in the family.A>  5/You've caused enough destruction for one day.> " 71A samurai must learn to control his emotions...> " >8You've never been a particularly violence-prone woman.z> " >8You've never been a particularly violence-prone woman.30Why are you so violent? You're on vacation!! N`   $  Throne roomMN wCN x\b\tYou burst into the smoke-filled room with a cruel smile twisting your features, delighting in the knowledge that your moment of vengeance has finally arrived. Shinobu sits calmly on his throne, staring at you, his face betraying no emotion. You were hoping for tears, or at the very least a plea for mercy, but for now he seems to be impassively resigned to his fate. No matter. Your revenge will be sweet, nonetheless.CCN y\b\tDaimyo Shinobu's throne room is in flames, which strangely adds to the splendor of the chamber. The dancing fires reflect off the gold furniture like glowing phantoms."x HHYou're not going anywhere until you finish what you came here to do...Y  untwist%MMO prepN(+You can only untwist one thing at a time.".&PY insertg MMOactorprepioN/>h N/%sMO prepN ?You can't use multiple direct objects with the verb 'insert' NW"Nl.gP&Y putg NMOactorprepioN,Xh N,.!gP bO|<<<Y  look in.& @@@Y  look behind.$???Y  look under.#AAAY plugg.g z999Y wear._ MMMY  take off.!` d6Y  undressUMO actorN(!-You're far too modest. Somebody might see!N(!%YMO prepN]"7You can't use multiple direct objects with this verb.".>Y dress^MO actorN&"6%You% will have to tell me what %you% want to wear. N&"%YMO prepNs#7You can't use multiple direct objects with this verb.".Y unwrap%YMO prepN':$7You can't use multiple direct objects with this verb.".CCCY attach9.9 SSSYd detach.!d DJz:::Y break.&iii%MMO prepN+You can only look in one thing at a time." Y  inspectBMOactorobjseqnoN({N(.  YYYY turn.190 I/  z999Y open.fh  |;;;Y search.% YYYY move.1I 9   DJ hhh%LMO prepN *You can only remove one thing at a time."MOstrnumN)> ! JOrN+)> N+ *! N+(*N+3*NB*!NV*Y  knock on%NMO prepN)*,You can only knock on one thing at a time.".!"xwww[MO actorN>  2,You've already caused enough damage today.>  %You're not a violent goddess.>  5/Your brother's the violent one in the family.>   You've got a job to do!!^NRKicking things won't help you in this game. Or in real life, for that matter...N0po%o%o>  2QMOvNU,< NU -< NUH-"NUa-bMOvdpiN- <  doesn't appear interested. N-*N-}'MO objN-~>1MN$. <, is here. NN.sMO itemNxn. <  is carrying  Nx.! and won't let %youm% have it. Nx.QFMO actorN.But <  is right here! N-/&NMO objN=M/<RN=j/< <R&N=/)&N=/p heq hisr he'ss himt he'su sv esw hasx doesy iszMN0< S'MOwordlstN0!%MOactoriobjNF0PMOactoriobjOqlstitotNa1/N1N1 E,@ itthemhimher ! D  @N,2"Could you be more specific?"N[2No2N28N2@<SN 3N%3Nf3<TN|3T !!"I don't know much about that."`MO actorN3If you want to give that to !< , just say so.N4U]MO actorNT:4 0NTT4$That wouldn't accomplish anything!NT4VRMOactordobjN4\^!<  rejects the offer.N4MO roomNo5! N5N5< C E < N=6<WN6<&N6< C E < N07<XNN7WNMN7< :N8\^!<  leaves the area.N48XNMNR8< :Nw8\^!<  enters the area.N8*Y swim ''Unfortunately, you never learned how.%YMO prepNR,7You can't use multiple direct objects with this verb.".#$Y chew%JMO prepN%5-(You can only chew one thing at a time.".%&zzzz!MO actorNG+":MO actorN=f+Nobody answers. N=+Y take a picture of%LMO prepN2_.*You can only take one picture at a time.".'(&#~MOavipN.M* E + E ) 3NyMIt's too far away.NM*NMNM"7MOavdpNM<#Z0 cameraMN It's one of the new digital ones with nearly unlimited memory. You spent a fortune for it.\b[To use the camera, type PHOTOGRAPH.]'MO actorN ('MO actorN How?!!  & That's not important.#~MOavipN6XJ) GN6J\^!<  !< important.N6J*N6JN6J"bMOavdpNK\^!<  !< important.N+DN )8\n\tThere's a wad of gum stuck to the end of the pole. K#MOactorioN )EMO actorN )FMOactordobjN ;*SYou stick the wad of gum to the end of the walking stick, where it clings firmly."+!>+&N *>&EF3MO actorN *7MO actorN *;MO actorN +<:MOactordobjN= S+>N= z+MO actorN} +OMOactordobjN ++ N +SYou stick the wad of gum to the end of the walking stick, where it clings firmly."+N 5,!>+&>&;N ,/There's no good surface on the walking stick.'MO actorN(0(MO actorN=B0>  )N=t0You don't have a camera!2N=0You take a snapshot of !< .N=0RY !!explore intimate relations withvMO actorN@3>  *$The vendor blushes and looks away.%"Your ancestors would be ashamed.%;MO prepN3A little horny, are we?".+,Y shake%KMO prepN&T4)You can only shake one thing at a time.".-. )MO actorN2*MO actorN=+2>  'N=\2You don't have a pole.NN=}2BWho do you think you are, Bruce Jenner? You'll break your neck!N=2!Y launch%YMO prepN'57You can't use multiple direct objects with this verb."./0"Y land%YMO prepN%67You can't use multiple direct objects with this verb.".12#JJJY clean.!I  DJ$V% %eMO prepNv'You can only !< one thing at a time. N'"N'&z999Y push. 'fff %JMO prepNo((You can only move one thing at a time."(Y  extinguishI%YMO prepN3`97You can't use multiple direct objects with this verb.".I?@AB)Y stick9%YMO prepN.A:7You can't use multiple direct objects with this verb.".!CD9EFGH* -MO actorN4.SMO actorN=4 Shaking !<  doesn't do anything.N=5+  0 wad of chewed gum %%It's a chewed up wad of sticky gum. %MO actorNc &hMO actorN H@You have no desire to put that nasty thing back in your mouth.N G#MOactorioN #MOactorioN MO actorNG aMO actorNk 9It smells like a mixture of bad breath and rotten fish.Nk =,Y lightI%KMO prepN.;)You can only light one thing at a time.".IIJKL-Y  sharpenI%MMO prepN0<+You can only sharpen one thing at a time.".!IMNOPgQRST.Y  blow out%YMO prepN)>7You can't use multiple direct objects with this verb.".UV/Y  blow on%YMO prepN(>7You can't use multiple direct objects with this verb.".WX0Y fly%YMO prepN$m?7You can't use multiple direct objects with this verb.".YZ1Y kiss%CMO prepN%?!Feeling a little amorous today?".[\2    *EMO actorNR:FMOactordobjN=n:+  '!You don't have anything sticky.zN=.;You stick the gum to !< ?. After a few seconds, it falls off and lands on the ground. >+&EF32[MO actorN@\TMO actorN=)@ Sadly, !< " doesn't return your affections.4^0SMN Y<  handful of water#N ?Zsmall amount of water It's just water.MO actorN fZMO actorN Z>  E >7  E >  FN [7You don't have anything suitable to put the water in.%"You'll have to be more specific.N J[>4  BN [6You can't really carry it around in your bare hands.< 7 BN [6You can't really carry it around in your bare hands.<  BN 6\6You can't really carry it around in your bare hands.?MO actorNL X\#MOactorioNp |\MO actorN \DMO actorN \%You have to pour it ON something...MO actorN \MO actorN+ S]cYou let the water run out of the nest and onto the ground, where it slowly dissipates. What fun!!>4&N+ ]MO actorN ]MO actorN V^You throw the water up in the air, where a sudden gust blows it back in your face. Sheepishly, you look around to make sure no one saw that slick move.!>4&MO actorN ^MO actorN ^|You drink the swampy pond water in one big gulp. Unfortunately, it didn't taste anywhere near as refreshing as it looked.N C_!>4&EMO actorN b_FmMOactordobjN _GIt's waterproof gum, but that doesn't mean you can stick it to water! 5$0@MN 3`<  handful of sandpile of sand  It's just normal-looking sand.?MO actorN `#MOactorioN `MO actorN `DMO actorN a%You have to pour it ON something...MO actorN@ HaMO actorNd aYou let the sand run out of your cupped palm, but it scatters in the breeze before it hits the ground. You could sit here and do this all day!!>5&MO actorN" (bMO actorNF bYou throw the sand up into the air, where a sudden gust blows it back in your face. Spitting sand out of your mouth, you sheepishly glance around to ensure that no one saw that swift maneuver.NF c!>5&EMO actorN? =cF@MOactordobjNc ZcIt won't stick to SAND!! 60 can of kerosene ;;It's a can of Quik-Lite(tm) kerosene. It's nearly empty.#MOactorioNq MO actorN DMO actorN %You have to pour it ON something... MO actorN YPMO actorN2 t1Somehow, you don't think that's a great idea...MO actorN MO actorN $jYou take a whiff of the fumes, and start to feel a little lightheaded. This reminds you of high school!MO actorN; _PMOactordobjN_ zKN_ You're not holding the ring.N_ N_ It would fit, but why bother?N_ [N_ It would fit, but why bother?N_ ;&N_ CIt would fit, but why bother?N_ rN_ zIt would fit, but why bother?N_ N_ It would fit, but why bother?N_ N_ It would fit, but why bother?N_ RN_ That won't fit in the can.)i+ru(qX{N_ C3MO actorN[ F#MOactorioN dK#MOactorioN 7\ \ \0 can of kerosene (empty)MN (It's a can of Quik-Lite(tm) kerosene. >4  =N (.There is a small amount of water in the can.#N yIt's currently empty.MO actorN PMOactordobjN KN You're not holding the ring.N (N 0It would fit, but why bother?N \[N dIt would fit, but why bother?N &N It would fit, but why bother?N N It would fit, but why bother?N N It would fit, but why bother?N 1N 9It would fit, but why bother?N fRN nThat won't fit in the can.)i+ru(qX{N 3MO actorN #MOactorioN# MO actorNL }MO actorNp F^For simplicity's sake, refer to the object you're actually pouring (Ex: POUR WATER ON FIRE).`MO actorN 8%You% must tell me what %you% want to put in the can. N  8Y hangb%YMO prepN-kC7You can't use multiple direct objects with this verb.".!]^b_`ab DJ9JJJY screw.!I :LLLY  unscrew.!I ;3MO actorN@xMOactordobjN=B4 `You pour the water on !< 0. After a few minutes, it dries off. How fun!!>4&5 vYou pour the sand on !< G. After a few moments, the light breeze scatters the sand. How fun!!>5&o6 eYou pour the kerosene on !< *, where it quickly evaporates. How fun!!>6&7&< Y danceMO actorN&%E>  "There's no music playing! N&E=  QKFor some reason, you can't get in the mood with Susanowa hovering around.p>e! N&HfYou launch into a hypnotic, whirling dance. The other gods stop talking for a moment to watch you. >e>>e r`The gods and goddesses, entranced by your joyous dancing, begin to laugh and clap their hands.>ef>>e W3Unable to restrain themselves any longer, the rest of the gods and goddesses join your dance, singing and laughing joyously.\b\tA strange sensation overtakes your body, as if a part of you were traveling to another place and time. Suddenly, as if emerging from a dream, you awaken to find yourself...\b\t>e?>@A%YMO prepNK9I7You can't use multiple direct objects with this verb.".cd=b! ! !=  Susanowa ZZHe's a burly, fierce-looking man with shaggy black hair. You're a little scared of him.> AASusanowa, the god of storms, is standing a short distance away.#MOactorioN dF[MOactorioN F7He doesn't look like he's interested in conversation.#MOactorioNZ F[MOactorioN IG7He doesn't look like he's interested in conversation.MO actorN \GMOactordobjN xG2 dN GUHe seems quite interested in the mirror, but the other gods won't let him near you.*N HHe's not interested in that.UMO actorN 2HV+MOactordobjN NH2 -N HHe's not interested in that.N 9ITo the astonishment of the other gods, you generously give your beautiful mirror to the god of storms. He thanks you with a deep bow and vanishes into the crowd.6>2&N yI6>(&!<& >\& ?www$  Antechamber MN %N \b\tYou have entered the dimly lit antechamber of the tomb. At the back of the room, a long flight of stairs leads down into the darkness. ?  O\n\tA thick, grey layer of centuries-old dust coats the walls of the chamber.N You are standing in the antechamber of the tomb. The room is filled with a warm amber glow which emanates from the stairway at the back.> ? MN :A\b\tThe walls of the room are covered with beautiful paintings.6`MN DIn the center of the room, lying in the dust, is a big bronze key.?>&BoJoDMN >;N *LYou head down the stairs, and are immediately plunged into total darkness.>u  E >u" KN ?\b\tStrangely, even the burning check provides no light here.N k\b\tFearful of stumbling and breaking your neck, you wisely head back up the stairs to the antechamber.\b?>pN ZYou descend the well-lit stairway for what seems an eternity, finally emerging in...\b\t >@Q Q Q$  CourtyardMN \b\tThis is a vast, octagonal courtyard, which is dominated by a giant reflecting pool in its center. The palace proper looms far to the north, while long brick paths lead off in all directions to smaller buildings on the perimeter." `N T The full moon floats lazily overhead, bathing the courtyard in misty blue light.N P\b\tThere is a huge wooden model of a ship floating in the middle of the pool.6 \b\tIt looks like the palace is indeed undergoing some renovations - A tall plywood wall has been erected to the north, which stretches from one end of the palace perimeter to the other.@MN >" >N The heavy brass gate has been blown shut by the wind. You try for several minutes to open it, but it seems to be locked. Looks like you'll be missing that train...? The entire northern section of the palace appears to be under construction - A tall plywood wall prevents travel in that direction.ABF The entire northern section of the palace appears to be under construction - A tall plywood wall prevents travel in that direction.HGE The entire northern section of the palace appears to be under construction - A tall plywood wall prevents travel in that direction.AMOsrcdestOcontilenN N N 9N 3@N Q@&N uBY scare%YMO prepN&I7You can't use multiple direct objects with this verb.".fgC;_MO actorNlD`PMOactordobjN=DYou can't hang anything on !< .DY  look up%YMO prepN(1K7You can't use multiple direct objects with this verb.".hiECfMO actorN Jg^MO actorN=#J "Boo!" you shout. However, !<  doesn't even flinch.F0  textbook It's a two-year-old edition of "The Dillard Index of Japanese Mythology." It's in terrible shape, especially since it's been chewed on.MO actorN 'pMO actorN QTo look up a specific topic, just type LOOK UP, and the topic you want to find. K#MOactorioNY <GgggY jump(MO actorN%L Wheeee!. H:$ Top of the tree \b\tYou are perched precariously on a thin branch fifty feet above the ground. The view from here is amazing- a spectacular overview of the palace and surrounding gardens.C'MN DYou'd probably die.D[MN e-Prudently, you descend to a safer height.\bN I>N 6hMN ?\b\tA kite is stuck in the branches about ten feet above you.> &N / You'd probably fall.Ip---$ Fork in the tree \b\tYou make your way to a huge fork in the branches, thirty feet above the earth. The view would probably be magnificent here if it weren't for all the leaves and branches in the way.\b\tThere seems to be something carved in the tree trunk here.DaMN 3You carefully climb back down to a lower level.\bN J>N ,CwMN u\You're pushing your luck, but I guess you could climb higher if you were careful about it.N  You'd probably fall.Jb$ Thick branch cc\b\tYou've arrived at a thick branch about twelve feet off the ground. It's cool and shady here.6kMN L\b\tIn front of you, a little further out on the branch, is a bird's nest.> >&DMN 1NYou scramble back down the big oak, nearly skinning a knee in the process.\bN LN PK>N iC`MN lEI suppose you could climb a little higher, if you really wanted to.N  You'd probably fall.K$  Oak grove \b\tA massive oak dominates this neatly ordered grove of trees, spreading its thick, leafy branches into the sky. A gap in the surrounding forest to the north leads back to the meadow.?CLMN 1You could probably climb it, if you so desired.N  ,,The trees are too thick in that direction.D You can't go that way.Ln---$  Footbridge \b\tYou are standing on an ancient wooden footbridge which spans the pond. To the north, a long flight of stone steps leads up a steep hill to the palace gate. The park entrance is far to the south.@D?`D No. You can't swim, remember?M $ Top of west wall HH\b\tYou are at the top of the west wall, fifteen feet high, in a tiny pathway between the battlements. To the north, a watchtower marks the spot where the west wall and northwest wall meet. A similar tower to the south stands at the junction of the western and southwestern walls. A tiny, weed-choked garden lies below you.DWMN O32You climb back down the vines to the garden.\b\t>N 3? Unfortunately, it appears that the tower to the north is under construction. It's completely boarded up and there's no way to get inside.@C You can't go that way. 22Not unless you're planning to jump off the wall.N $ Top of east wall OO\b\tYou are at the top of the east wall, fifteen feet high, in a tiny pathway between the battlements. To the north, a watchtower marks the spot where the east wall and northeast wall meet. A similar tower to the south stands at the junction of the eastern and southeastern walls. The samurai barracks and east lawn are below you.? Unfortunately, it appears that the tower to the north is under construction. It's completely boarded up and there's no way to get inside.6 RR\b\tSomething seems a little different here, but you're not exactly sure what...@ 22Not unless you're planning to jump off the wall.C You can't go that way.Ozzz$ Platform (on the scaffolding) \b\tYou're standing uneasily on a narrow plank of wood high above the throne room floor. Workmen have obviously been up here recently, as this particular section of the wall is almost completely repaired.6\MNx@A large metal bucket is here, on the far side of the platform.O>&D5PY laugh{MO actorN&Q> " 2,Such behavior is unbecoming for a samurai.$!But there's nothing funny here!QY pick%\MO prepN%}R(You can only pick one thing at a time.N%R"N%R.jkxRz:::Y close.ij Sz:::Y touch.Tz555&I.I;<=>U|999Y pull.V~:::Y drink.W4Y tell[8MOactorobjseqnoN- ! iMOactorprepNq[ Nq !Nqǵ Nq.[ XY ask[8MOactorobjseqnoN, !.[ Y~999Y read.'Z.ZMO actorNskN\%You% %are% much too anxious worrying about %your% continued survival to fall asleep now. 9N>>%N>%You're% not tired. Nb D  N"qI don't know about you, but I can never sleep standing up. %You% should find a nice comfortable bed somewhere. SNW0%You% quickly drift%s% off into dreamland...\bNNN[gggYKMO actorN#%Your% throat is a bit sore now. N\T T T$ Battleground (Buke Pass)MN \b\tIt's a massacre!!, you realize helplessly. You and your men don't stand a chance in this place; a narrow, rocky valley between the mountain peaks. The deep snow all around you is red with the blood of your fallen comrades, though you've managed to take a large number of your attackers out as well. Still, it's clear that your time is running out. You need to find a way out of here, quickly.Z! N U\b\tThe severed head of the soldier you just killed rolls to a stop at your feet.\b\>Z&"[N C[\" ZN:!N\b\tA massive avalanche is thundering down the mountains towards the valley.N!DMN!>\" =N!.You'd be right in the path of the avalanche!ZN"NA large force of Matzumu footsoldiers blocks your retreat down the mountain.@MN8">\" =N".You'd be right in the path of the avalanche!ZN"NA large force of Matzumu footsoldiers blocks your retreat down the mountain.CMN">\" HN3#9Tons of snow are hurtling downward from that direction.MNz#AThe peaks are too steep, and are already occupied by the enemy.?MN#>\" HN#9Tons of snow are hurtling downward from that direction.~N1$rThe path to the north is barred by a large troop of enemy soldiers, who are steadily advancing on your position.A.MNv$]! PN$AThe steep mountains appear to block progress in that direction.>\" @N%'You duck into the shadowy crevasse.\b^>sN9&8As the avalanche rushes into the valley from all sides, you rush towards the dark opening, yelling for your platoon to follow. Your men quickly disengage from the bewildered enemy and make their way single-file into the opening. Meigi and his few remaining soldiers take up the rear, covering your retreat.\bN&^>!>\&\_&N&N& 77The steep mountains block progress in that direction.]:::Y climb.^-MO actorN< enter,MO actorNYd I.Avwb DJgI _YYYY pour.1&bgPaOOOY listen%MO actorN']>  E>>e >8You hear joyous laughter and singing outside the cave.> b vpThe beautiful melody of the biwa, being played by the performer at the side of the stage, touches your spirit.0> c XRThe plaintive melodies pouring forth from the biwa fill your heart with longing.> d B<The air is full of croaking, chirping, and buzzing noises.> e {uYou hear the faint strains of a lovely melody being played on a biwa. It's coming from somewhere to the northwest.> f {uYou hear the faint strains of a lovely melody being played on a biwa. It's coming from somewhere to the northwest.t> g D>Gio is playing a beautiful melody that stirs your very soul.%"You don't hear anything unusual.bB$  West lawn (at the puppet show)MN \b\tThis is by far the funniest puppet show you have seen in years! The Bunraku artists have really outdone themselves this time. The entire west lawn is filled with rowdy, noisy spectators, who are laughing hysterically at the performance." ++The crowd is too thick in that direction.D You can't go that way.C You can't go that way.B=MN4 v ! hN YIt would be far too much trouble. You have a fine view of the stage where you are now.NInspired by the beautiful vision before you, you fight your way through the crowd, and after several grueling minutes, eventually make it to the stage.\b\tN_c>c$ Stage \b\tYou have arrived at the front of the stage. You've got the best seat on the lawn, but at this point you could care less about the puppet show. A path leads from behind the stage to a clearing by the palace wall.BA 33You don't want to fight through that crowd again. ++The crowd is too thick in that direction.C You can't go that way.D You can't go that way.dL   $ Koi pond, western shoreMN 4N L\b\tYou are at the west shore of the large pond. Thickets of tall reeds wave lazily in the breeze, and the quiet chirping of unseen birds and frogs fill the air. You can return to the meadow south.N >  N \b\tYou are at the west shore of the large pond. Thickets of tall reeds wave lazily in the breeze, and the quiet chirping of unseen birds and frogs fill the air. You can return to the meadow south. The koi pond stretches to the east.N \b\tYou are at the west shore of the large pond. Thickets of tall reeds wave lazily in the breeze, and the quiet chirping of unseen birds and frogs fill the air. You can return to the meadow south.\b\tThere is a small raft on the shore of the pond.N  It smells a bit swampy here.A The pond is that way.@R ,,The trees are too thick in that direction.C You can't go that way.D You can't go that way.e`$ Quiet temple \b\tThis tiny, simple one-room wooden temple in the southeast corner of the palace is a perfect spot for quiet meditation... Which is exactly what you had been doing until the sound outside awakened you from your trance.FfJffT$ Outside temple \b\tYou are standing outside a temple which sits beside the southeast wall of the palace. The tiny structure is made of wood and resembles a miniature pagoda. The courtyard is back to the northwest.GeIeFg$  Tree top NN\b\tYou are at the top of the small tree, nestled in a fork of the branches.C @@You can't climb any higher, and besides, you wouldn't want to.D **You don't want to leave here just yet...6`MN{6;\tThere is a short carving knife stuck in the trunk here.N6g>k& CCYou'd probably fall, and besides, you don't really want to leave.hpppY  meditate DDYou close your eyes and contemplate the mysteries of the universe.iEhMO actorNBKi~MO actorN=KF  $You don't have the textbook!2/There's no entry for that topic in the index.jzzziMO actorN^(:MO actorN=^You're not THAT hungry...kvvv0 carving knife ??It's a short, straight-edged knife, perfect for carving wood. lY play%\MO prepN%_(You can only play one thing at a time.N%(`"N%5`.qr*mY carve%YMO prepN&`7You can't use multiple direct objects with this verb."I.!op*Istuv%pnaaaY pray 99You close your eyes and bow your head in silent prayer.oY shitvMO actorN%/b>  *$The vendor blushes and looks away.%"Your ancestors would be ashamed.paaa help9MO actorN% N% +N% qY farttMO actorN%vd>  >8The vendor blushes a deep shade of red and looks away. How rude!!r&Y singMO actorN%e>  D>The vendor looks at you and smiles. "Nice voice!" she says.S> " -'You hum a traditional warrior's song.You hum a little melody.sY ride%YMO prepN%Rf7You can't use multiple direct objects with this verb.".wx*tY  dismount%YMO prepN) g7You can't use multiple direct objects with this verb.".yz*uY ""perform a soaring lark stroke on%YMO prepNAg7You can't use multiple direct objects with this verb.".{|*vjoMO actorN_piMO actorN=_k  '!You don't have a carving knife!You can't carve that.w___&  diagramMN\EIt's a detailed diagram, consisting of about ten panels, which shows a samurai warrior performing a complex sword cut called a "soaring lark stroke" (at least you THINK that's what it's called - your knowledge of Kanji is pretty rudimentary). It involves leaping towards the target while simultaneousy slashing downwards. "}Nx\b[To practice the "soaring lark stroke", type LARK, followed by the thing you want to practice on. Ex: "LARK TREE."] UMO actorNB'#MO actorN9\<x K  K K 0  katanaMN 9m>  sN mdIt's an expertly crafted katana with a long, straight blade. Your name is inscribed on the steel.N nIt's an expertly crafted samurai sword with a long, straight blade. The name of your ancestor, Kaneiji, is inscribed on the steel. Amazingly, even after all these centuries it seems to be in perfect condition.<" N Bo.. Well, maybe not perfect. You notice that the edge seems a bit dull (maybe it has something to do with that little fight you had recently).MO actorNE Zo<  E<" NE oTaken.<NE qQ\b\tAs you reach down to take the sword, a powerful sense of deja vu overwhelms you. You feel as if you've seen this weapon before, have even held it in your hands thousands of times. As if in a trance, you touch the flat of the blade with your fingertips. The world slowly swirls and fades before your eyes, and you feel as if your very soul is being pulled through your fingers into the cold steel. You drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\tNE +r>&"NE ZrAA<&" NE r)NE rOSMOactorioNJ r <NJ r-You need to be a little more specific here. <NJ Ls-You need to be a little more specific here. ENJ s6Close... You need to be a little more specific here.T NJ stYou lay the blade in one of the grooves and carefully hone the edge with the abrasive stone. After several minutes of painstaking effort, you somehow manage to produce a razor-sharp edge without totally ruining the sword.!xNJ tLNJ t@This particular type of stone is not very good for sharpening.NJ uSOTP1MOactorioN 8u N vYou lay the blade in one of the grooves and carefully hone the edge with the abrasive stone. After several minutes of painstaking effort, you somehow manage to produce a razor-sharp edge without totally ruining the sword.!xN cvN fvMO actorN iv:MOactordobjN vN vyY fix%YMO prepN$`i7You can't use multiple direct objects with this verb.".~*zv{MO actorNg|MO actorN=Zhw}" '!You've played this game before.Mx  82You can't do that without a sword in your hands. Why?{Y cut%YMO prepN$oj7You can't use multiple direct objects with this verb.".*|z~MO actorNqi@MO actorN=iBut !<  isn't broken!!}Y untie%YMO prepN&k7You can't use multiple direct objects with this verb.".*~Y tie9%YMO prepN,l7You can't use multiple direct objects with this verb.".!*9%p|MO actorNjFMO actorN=j What did !<  ever do to you?Y pluck%YMO prepN&m7You can't use multiple direct objects with this verb.".*Y aftMO actorN$n>  <,You move towards the back of the ship.\b\t>G>  You're all out of aft.That makes no sense here.xxx$ Ghost ship, on the bowMMNG \b\tYou stand on the bow of the huge seagoing vessel. The deck here is crowded; the seven gods of fortune are gathered near the prow, talking animatedly amongst themselves. Behind you, aft, is the main deckN \  PN A, where you can just make out the ship's wheel through the fog..6YMN!.\b\tThe samurai heads aft, to the main deck.CLNN! --"AFT" is the only way you can go from here.DYMN!]  NY$You move towards the rope ladder. Before you can climb down, however, the goddess Benten stops you. "Dozo," she says, placing a tiny object in your palm. Suddenly, you feel a great weight lift from you as most of your worldly possessions vanish. You start to protest, but realize there is no point. Wherever you're going, your material things will undoubtedly serve no purpose...\n\t The other gods gather around you, bowing and smiling. "Sayonara!" they shout, ushering you towards the ladder. Somewhat bewildered, you climb down towards the waiting skiff, while the gods of luck cheer and wave from the deck above. The samurai climbs down after you.\b\t!AN$^&_`&a>&N$a>L&CbN%7NC%+The rope ladder appears to have vanished.($ Ghost ship, main deckzMN'\b\tAn enormous ship's wheel is the only feature on the deck; you are at a loss to explain how the ship moves, for there are no sails or oars in sight. Ahead of you, fore, the seven gods of luck are gathered on the bow.N(>\  vNc(j\b\tThick, pea-soup fog obscures your vision, making everything appear even less substantial than it is. .."FORE" is the only way you can go from here.Y foreMO actorN%o>  )#You can't go any further forward.f>  =-You move towards the front of the ship.\b\t>That makes no sense here.Y waveAMO actorN%p"You wave, feeling a bit foolish..!* %poMO actorNlphMO actorN=m>k  '!You don't have a carving knife!You can't carve that.Y buy%YMO prepN$xr7You can't use multiple direct objects with this verb.".* /MO actorNN9MO actorNN.<NNO+NN^P P P, ground It lies beneath you. ,  the ground on off of NMNs C  N <NN C N yMO actorNf! Okay, %you're% now sitting on < . N! NN!&N!/MO actorNI "<NI'"O9MOactordobjN~N"N~j"P9MOactordobjN"N"QMOactordobjN" Thrown. N" &N#eMO actorNy/%You% must tell me what %you% want to put in !< . N0MO actorN|',MO actorN=<N=MN<Ndccc$IGMN But %you're% already inside! N; !NH ""-7MO actorN!I don't see that here.MOvN^"4MO actorNr<4D>5<N<9N<4N<6N"4N4N>[MOavdpiNj< #N< NCMO objNv Dropped. Nv&Nv782MO objN<77N MO actorO"tmplistthisobjitotNt<7NNNdN@N 9N5<77NqNN: \n\t  ;MNr <:< jMO verbosityO2lcuritotNF NF <;NF4 <NFL <<NFl <NF NF NF \NF @NF NF' =NFI NFe NFs NF~ <:NF </NF  You see  here. NF NF  \nNF( <NFD NF^ NFn NF @NF GNF C *NF<:NF9>NF\NFnNF|NFjNF\nNF-MN<N<:NMNO<Nc]MO verbosityN<N<N<N<N ?MN<@MN"<AMNF<BMNj<CMN<DMN<EMN<FMN<GMN<HMNB<IMNf<JMN<1MNA%You% can't go that way. !MOverbprepiolistOlilenN% N% N%2 =N%R @N%~ @N% N% N< NCM6555BMOactorobjseqnoNN MOactorprepiobjO_retlocN} N}. N}K N}l  >N}կN}BMOactorobjseqnoNN=!9OactorprepdobjMN^<  IMOactorprepioN N DMOactorprepN NPYZ drop =MOactorprepioN'PN'o.!bO %MO prepNg N!N/You can only do that to one thing at a time. N("N=z555$I.I3456Y give9 =MOactorprepioN- N-).9UVY show9 =MOactorprepioN-N-.9MO actorNpIMO actorN=p Waving !<  doesn't do anything.MO actorNp8MOactordobjNqNothing happens.#MOactorioNBqmMO actorNaqnPMO actorN;|qNot surprisingly, !<  doesn't respond.BBMNmNR\bYou may restore a saved game, start over, quit, or undo the current command.\nNO respN3\nPlease enter RESTORE, RESTART, QUIT, or UNDO: >N; N[ RESTORE N~File to restoreN! Restore failed. mNRestore failed. DN"> N@>>Nx+NNrN RESTART 4NN#N&NQUIT BN \bNN,N@+NLNVUNDO Nr%jN(Undoing one command)\bN"> N>>N+N7N+Sorry, no undo information is available. NFNIENOMOnoteTextOfoundNumN>/N>@ N  N>1NNJťN6 Nq [ ! ]N N[ RESTORE N<[[[MOactorioN!! E <~;NP <  isn't in  . NN<N/MO actorN <N%%/MO actorNC<NbFMO actorNBreaking things won't help. NPPPP4MOactorioN<&NPPPP4MOactorioN <&N zyyy& MMNG!> < Nf!> N!!N!'MO actorN|/(MO actorN=/>  )N=/You don't have a camera!3N=/You take a snapshot of !< . xxx!\MO actorN+I don't think !<  would appreciate that. N+Y smell)MO actorN&S> %KMO prepNU)You can only smell one thing at a time.".&SSSY listen)MO actorN'6> Y  listen to%OMO prepN*-You can only listen to one thing at a time.".&gggS%KMO prepN2S)You can only touch one thing at a time."PPPP4MOactorioN@ <&NS rqqqUMO actorNz <4E  N N )N >&.  & That can't be taken. 5MO actorN5 That can't be moved.7MO actorNp? That can't be touched. That's not visible. That's not visible. 8MO actorN That can't be attacked.8MO actorN! That can't be attacked.@MO actorN_. !You can't put anything on that.||| %`MO prepNu&,You can only look at one thing at a time. N&"N&mmm%QMO prepN/You can only look behind one thing at a time."VAAAY look through.} lll%PMO prepNp.You can only look under one thing at a time."\\\Y look4MO actorN%" N%fffY%JMO prepNU(You can only read one thing at a time."p000kkkY  footnote ((You need to include a footnote number..&D; ; ;MN!<,  a number (MNњ the number !<MOactorio~>MOactorioN"Tap, tap, tap, tap..." MO actorN-1MOactordobjNI0pppp&hMO actorN 00To look up a particular topic, type "LOOK UP".( entry for fudo FiMO actorN7_FUDO: The Shinto god of fire and wisdom. Generally depicted as an ugly old man, surrounded by flames, carrying a sword and a length of rope. entry for ryujin FiLMO actorN9-RYUJIN: The Japanese dragon god of the sea. entry for onamuji FiOMO actorN:0ONAMUJI: A Shinto earth god. Son of Susanowa.||| entry for amaterasu Fi=MO actorN<_That page has been torn out., entry for fujin FiMO actorN8FUJIN: The Shinto god of wind. Generally depicted as a dark-skinned demon wearing leopard skins and carrying a bag of winds over his shoulder. entry for takara-bune FiMO actorN>mTAKARA-BUNE: The legendary treasure ship with the Shijiki-Fujukin on board. The treasures it contains are: \n\tThe Inexhaustible Purse\n\tThe Invisible Hat\n\tThe Lucky Coat\n\tThe Wealth Mallet\n\tThe Ghost-Chasing Rat\n\tThe Full Bag of Rice, and\n\tThe Magic Key.\b\tPictures of this ship are laid under children's pillows, so that they may have happy dreams. entry for Shijiki-Fujukin Fi~MO actorNB_SHIJIKI-FUJUKIN: A group of seven Japanese Shinto gods of luck. They are often portrayed in a ship of treasures called Takara-Bune. The Shijiki-Fujukin( "seven happiness beings") are: Benten, Bishamon, Daikoku, Ebisu, Fukurokuju, Hotei, and Jurojin. At Sanganichi, the Japanese New Year, people pray to them after cleaning their houses thoroughly.l+++ entry for Benten FiMO actorN9 BENTEN: The Japanese goddess of love, the arts, and music. She is the patroness of geishas, dancers, and musicians. Benten is portrayed as a beautiful woman playing on a stringed instrument called a Biwa.^ entry for Bishamon FiMO actorN;{ BISHAMON: The Japanese god to whom many functions are attributed, but he is mostly known as a god of war and distributor of wealth. He is usually portrayed in full armor, standing on a pair of demons (called ONI) and holding a spear in his hand, and sometimes wearing a wheel of fire like a halo.\b\tThe previous owner of the textbook has scrawled a note in the margin here: "The barracks are wonderful! Makes you wonder about the men who once lived here... If I close my eyes I can almost see them, practicing combat on the parade ground, sharpening their weapons on the battlements, marching out through the palace gate on their way to a glorious battle... If only I could have lived back then!"  entry for Daikoku FiMO actorN:2`DAIKOKU: The Japanese god of wealth and patron of farmers. He is portrayed as a fat and prosperous man, standing or seated on two large bags of rice. In his hand he holds a magic mallet which fulfills all wishes.\b\tThe previous owner of the textbook has scrawled a note in the margin here: "Apparently, there used to be a secret passage which led from the granary to the palace, to be used as an emergency escape route in case of attack. There doesn't seem to be any evidence of it today... Some of the kanji on the shrine reads "FOUR HANDFULS OF RICE SHALL BE THE OFFERING", whatever that means... " ( entry for Ebisu FiMO actorN8MEBISU: The Japanese god who represents the wealth of the sea. Patron of fishermen.\b\tThe previous owner of the textbook has scrawled a note in the margin here: "The statue here has an interesting legend... The hook on the fisherman's line is always kept baited by the groundskeepers. If Ebisu ever actually catches a fish, it's supposed to bring good fortune to everyone in the palace... " sss entry for Fukurokuju Fi3MO actorN= FUKUROKUJU: Shinto god of wisdom. He is depicted with a very high forehead, accompanied by a turtle and crow.\b\tThe previous owner of the textbook has scrawled a note in the margin here: "Johnathan Coleridge (1553 - 1627), a Jesuit missionary, visited the palace in 1618 when it was the property of Hiroshi Meigi, who rebuilt the library in 1615 after it had been destroyed in a devastating fire. Coleridge translated a number of the library's poems into English, and these writings are still on display to this day." N=0& entry for Hotei FiMO actorN8/HOTEI: Japanese god of happiness and laughter. He is depicted as a very fat man with a big belly, carrying a huge linen bag on his back.B entry for Jurojin FiMO actorN:aJUROJIN: Shinto god of longevity and happy old age. He is usually depicted with a long, flowing beard, riding a white stag, accompanied by a tortoise and crane.\b\tThe previous owner of the textbook has scrawled a note in the margin here: "The statue in the temple didn't show the tortoise or crane... It's been said that the samurai who lived in the palace used to go to Jurojin's temple frequently to meditate..."  entry for Susanowa FiNMO actorN;/SUSANOWA: Violent-tempered Shinto god of storms and the ocean. His sister is the sun goddess Amaterasu. Susanowa is the personification of evil, but also a brave, if lawless and impetuous, god. His outrages are not limited to the ocean; he also ravages the land with his storms and darkens the sky.  entry for Uzume FiMO actorN8oUZUME: Shinto goddess of joy and happiness, often called the Daughter of Heaven. Her name means "whirling". hhh entry for Oni Fi/MO actorN6ONI: Japanese demons that somewhat resemble humans, although they have three eyes, horns, sharp talons and big mouths. \b\tThe previous owner of the textbook has scrawled a note in the margin here: "Some legends say that the Oni hide treasures under their tongues..." CCC entry for Chowa FiMO actorN8CHOWA: Mythical fish that only appear beneath a full moon. They typically appear three at a time. The word 'chowa' translates literally to 'harmony' in Japanese; legend holds that a school of chowa fish must always swim together.}}} entry for Yomi FiCMO actorN7$YOMI: The Japanese underworld. A land of pestilence, darkness and death.\b\tThe previous owner of the textbook has scrawled a note in the margin here: "Legend has it that certain altars have magical powers that allow one to send offerings directly to one's ancestors in the underworld..."MO obO locN N  ;N N 6 N RN XN hMOoblocOcur_locN  N  BN   N 7 "N P  N t N z !N VVMO objsOilencontcontN  N .   N K  ZN ]  N N N N N N  1N - @@N p N MO objsO'contents viscontentsilenN $ N C N Y N u =N @N @N N N lHppLLrCCC ''%You% %do%n't smell anything unusual.r r r& shipMN nIt looks somewhat familiar... For a second you're reminded of a computer game you played once, but then it comes to you - The model is a Takara-Bune, or treasure ship, that symbolizes good fortune. Many Japanese families have them in their homes to bring good luck. Your grandmother had one, in fact. This particular model looks a lot different from others you have seen, however. It seems empty, or something... @ ON C\n\tThere's an image of a gold-filled purse burned into the hull. @ DN H8\n\tThere's an image of a mallet burned into the hull. @ AN 5\n\tThere's an image of a hat burned into the hull. @ NN B\n\tThere's an image of a full bag of rice burned into the hull. @MO actorN? vnMO actorNc ONot likely. The model is about ten feet long and probably weighs half a ton.vMO actorN wMO actorN You splash through the muck-filled pond and pull yourself over the side of the hull...\b\t...but strangely enough, an invisible force pushes you back before you can enter.MO actorN MO actorN You splash through the muck-filled pond and pull yourself over the side of the hull...\b\t...but strangely enough, an invisible force pushes you back before you can enter.MO actorN P MOactordobjN  N You carefully put the purse inside the ship. As you do so, a sudden bright flash of light blinds you momentarily. When your vision clears, you find that the purse has vanished.  >&@>&N  N You carefully put the mallet inside the ship. As you do so, a sudden bright flash of light blinds you momentarily. When your vision clears, you find that the mallet has vanished.  >&@>&N % N You carefully put the hat inside the ship. As you do so, a sudden bright flash of light blinds you momentarily. When your vision clears, you find that the hat has vanished.  >&@>&N : N You carefully put the bag of rice inside the ship. As you do so, a sudden bright flash of light blinds you momentarily. When your vision clears, you find that the bag has vanished.  >&@>&N ` x N pThat's strange... there seems to be some sort of invisible force preventing you from putting it into the ship.N |N VpThat's strange... there seems to be some sort of invisible force preventing you from putting it into the ship.>  E >  E >  E >  ]N a#\b\tThe air around you suddenly grows cold, and the katana at your side begins to glow with an unearthly pale light. You hear a faint clamor of discordant noises; laughter, ghostly birdcalls, clashing swords, rushing wind- as if a chorus of distant gods were calling for your attention. The noises gradually grow louder, and coalesce into a single word that echoes in the darkening sky like a summons: \n\t"Kaneiji... Kaneiji..." \n\tAs the last scarlet threads of sunlight steal away, you feel a sudden intense pressure in the atmosphere, as if the very air is being torn asunder. The summoning voices build to a deafening crescendo, and you shiver from cold and fright as a freezing wind begins to blow. You hear the massive bronze gate slam shut in the distance with a sound like a giant gong being struck, as the wind roars around you like a pack of ravenous wolves. You clap your trembling hands over your ears in a useless attempt to block out the din, which builds and builds and builds until you cry out in pain and terror...\b\tAnd then it stops.\b\tFor a moment, all is still. The pale moon stares down impassively, painting the courtyard in spectral shades of blue. As your ears grow accustomed to the deafening silence, your other senses are taken by surprise: A bizzare fragrance of coppery blood and fresh rain suddenly fills the air, and before your bewildered eyes, a ghostly apparition slowly takes form...N #@&"@&N #&&N -$&&&N r$!&!&!&N $!&!&!&nnn$ Shinobu Palace gateMN \b\tYou are at the entrance to the palace, which is guarded by a massive bronze gate that towers over you. A pair of watchtowers stand protectively east and west of the gate  RN F, and a gigantic statue of an armored warrior stands off to one sideN . To the south, a steep flight of stone steps leads down to a footbridge.\b\tThere is a small wooden sign posted in front of the entrance.6^MN 6\b\tIt looks like someone left a walking stick here.N > >&D`@`?MN S ! 6N 'The living statue won't let you pass." :N +There's a massive bronze gate in the way.sN 9]You pass beneath the shadow of the palace's southern wall and make your way to a large...\b@>v555$  East lawnMN\b\tThis open dirt lawn probably once served as a parade ground and exercise area for the samurai who lived in the palace. It is enclosed on three sides by the long, low buildings which had served as the samurai barracks. You can return west to the courtyard.>" yNm The full moon floats lazily overhead, bathing the east lawn and surrounding barracks in misty blue light.N\b\tIn the center of the lawn, a lone bamboo practice dummy sits like a scarecrow. Next to it is a tall shrine, which houses a lacquered wood statue.> 6 AN5\b\tThere's a faint glow emanating from the shrine.B@C You can't go that way.D You can't go that way. 66The buildings block your progress in that direction.SSS$  West lawnMNOA\b\tA small wooden stage sits quietly in the center of this open, grassy lawn at the western end of the palace. To the left of the stage is a tall shrine, which houses a lacquered wood statue. A narrow dirt path winds off behind the stage to the west towards the palace wall, and you can return to the courtyard east.>" nNb The full moon floats lazily overhead, bathing the west lawn and the stage in misty blue light.> 6 AN5\b\tThere's a faint glow emanating from the shrine.A@BS S S$ Outside granaryMNF\b\tYou've arrived in front of a cluster of stone buildings, whose simple appearance indicates that they were probably used for storage. Unfortunately, there's not much of interest here; all of the structures are boarded up save for the small circular building to the southwest. >" `NT The full moon floats lazily overhead, bathing the courtyard in misty blue light. 11The buildings block progress in that direction.C You can't go that way.D You can't go that way.E@H!I!$ Outside templeBMN\b\tYou are standing outside a temple which sits beside the southeast wall of the palace. The tiny structure is made of wood and resembles a miniature pagoda. The courtyard is back to the northwest.>" ]NSQ The full moon floats lazily overhead, bathing the temple in misty blue light.GIF@nnnB path 88They're long and winding paths made of deep red brick. @& wall The wall is about thirty feet to the north, and it stretches from one end of the palace perimeter to the other. It's as tall as the palace walls, fifteen feet high, and made of sturdy plywood.MO actorN RFMO actorN m'Who do you think you are, Spider Man? MO actorN^  KMO actorN ,You pound uselessly at the sturdy plywood. @C palace ssIt's hard to make out any details of the palace from here- A large plywood wall to the north obstructs your view. @  & reflecting pool It's a circular, shallow reflecting pool, filled with stagnant water. There's a huge, ten-foot-long model of a ship in the center of it.vMO actorN wMO actorN If you insist... You take off your shoes and socks and wade into the shallow pool. The thrill wears off quickly, however, and you get back out. Hopefully, you didn't contract any fatal diseases...MO actorN %bMO actorN W CYou poke around in the muck for a while, but don't find anything. @MMO actorNf R&   pool water mmPerhaps "relecting pool" is the wrong term- The pool's shallow water is covered with a thick skin of algae.MO actorN MO actorN   FN  3You don't have anything suitable to put water in.!>4  FN U 7You really don't want this water. It's pretty gross.=N 1You've already got all the water you can carry.MO actorN AMO actorN "It would probably make you sick.MO actorN7 %PMOactordobjN[ @ ON[ 8You dunk the kite in the pool, getting it soaking wet."0N[ $You wouldn't want that to get wet.MO actorN  BMOactordobjN/ You'd just get it all wet.MO actorNw MOIMOactordobjN h#The water isn't frozen, you know.vMO actorN wMO actorN aIf you insist... You take off your shoes and socks and wade into the shallow pool. The thrill wears off quickly, however, and you get back out. Hopefully, you didn't contract any fatal diseases...EMO actorN FdMOactordobjN >It's waterproof, but that doesn't mean it'll stick to water!MO actorN (%bMO actorN CYou poke around in the muck for a while, but don't find anything.   0P nest RRIt's made of twigs and such. It seems very well constructed, like a little cup. kMO actorN <:N ?.If you want to search the nest, just say so.!N |%MO actorN <_N *You find a ring buried within the nest!!N  >&N ")%N 0MO actorN 3PMOactordobjN NKN {You're not holding the ring.N N It would fit, but why bother?N \N It would fit, but why bother?N 'N It would fit, but why bother?N FN NIt would fit, but why bother?N |N It would fit, but why bother?N N It would fit, but why bother?N SN That won't fit in the nest.)h+ru'qW{N K#MOactorioN 3MO actorN >#MOactorioN \MO actorN" ~}MO actorNF ^For simplicity's sake, refer to the object you're actually pouring (Ex: POUR WATER ON FIRE).t  0 kiteMN \It's a huge orange and white cloth kite, shaped like a carp. It's ripped up pretty badly.<" ! Also, it's soaking wet.DN  ? -* It's also damp, and completely filthy.N 9YMO actorN  <ZDMO actorN0 U%The kite is far too damaged to fly.K#MOactorioNz <MO actorN It looks a bit cleaner now.MO actorN MOactordobjN  4 QN  \7You pour the water onto the kite, getting it all wet."!>4&N  ~MO actorN @MO actorN !The poor kite is beyond repair. & image of a gold-filled purse IIIt's an image of a gold-filled purse, burned into the hull of the ship. yyy& image of a mallet >>It's an image of a mallet, burned into the hull of the ship. sss& image of a hat ;;It's an image of a hat, burned into the hull of the ship. & image of a bag of rice HHIt's an image of a full bag of rice, burned into the hull of the ship. hhh0   model purse 33It's a small wooden model of a gold-filled purse.V$^^^0 model mallet ((It's a small wooden model of a mallet. ^^^0  model hat ++It's a tiny wooden model of a peaked cap. ```0  model bag --It's a small wooden model of a bag of rice.  = ghost The apparition is insubstantial, and barely visible to the naked eye. It appears to be roughly man-sized, though its shape isn't clearly defined. The air surrounding it is cold and damp.> dd\b\tThere is a strange apparition here, floating a few feet away, glowing with a faint pale light.MO actorNT c{MO actorNx d\Your hand passes right through it; it feels a bit like putting your hand inside a freezer. % 33You catch a faint scent of frost and rose petals.'MO actorNb d>  )Nb dYou don't have a camera!uNb ;eiYou take a snapshot of the ghost, knowing full well that these types of things NEVER show up on film... MO actorN- qe MO actorNQ etYou don't think weapons will have any effect on it. Besides, you don't feel that the spirit means you any harm...NQ f MOvdpiN f@ N ftYou motion for the apparition to follow you. To your astonishment, the ghost appears to understand what you mean.CN f*EN f/It doesn't show any sign of having heard you.N )g*U GGAnything you try to give the ghost will likely pass right through it. --The apparition doesn't appear to notice it.#MOactorioN gAMOactorioN hThe spirit doesn't respond.#MOactorioN IhAMOactorioN khThe spirit doesn't respond.T The ghost doesn't respond.MN h<E < > N i N &i<E > ( WN Jj\b\tAs you enter the shrine, the apparition leaves your side and slowly floats towards the large statue. It moves with a purpose, growing somehow more substantial with each step. When it reaches the foot of the statue it stops, looking up at the statue's face with an air of longing."N j!<&N j()&cN j<NN j> <&N k"\b\tThe apparition follows you. N Lk N ^k \* \* \* \* \* $A GardenMN *,,\b\tThis little circular clearing, in the shadow of the massive west wall, probably used to be a beautiful garden, but it's presently choked with weeds. Why the groundskeepers have ignored this area is beyond you. In any case, there's really nothing to see here. You can return east to the lawn.>" `N ,T The full moon floats lazily overhead, bathing the courtyard in misty blue light.\* ^I @^I ^I ^I ^I ^I VVV&  algae VVIt's a thick layer of foul-smelling green algae. You'd just as soon leave it alone.MO actorN ( EEPhew!! The groundskeepers need to dump some chlorine in this mess.MO actorN R)( Not for a million bucks...MO actorN? ) Nope.MO actorNp )3MO actorN )What on earth for?MO actorN *%bMO actorN *CYou poke around in the muck for a while, but don't find anything.x777$ Meditation templeF@TTT& garden ""How about just typing "LOOK"...? ~~~& weeds They're just weeds, of just about every variety you can name. The clearing is covered with them. Even the wall is festooned with ugly thick creepers. CCYou poke around in the weeds for a while but don't find anything.  99You move the weeds around some but don't find anything. &&Planning a new career as a gardener? FFF& wall llThe palace wall is fifteen feet tall, made of solid weathered stone. It's covered with ugly, thick vines.MO actorN /MO actorN 30WUsing the thick creepers for support, you struggle to the top of the palace wall.\b\tM> J   & vines ..The vines cover the wall from top to bottom. MO actorNb *1MO actorN 1WUsing the thick creepers for support, you struggle to the top of the palace wall.\b\tM>n...$ Watchtower (southwest) \b\tThis is the southwest watchtower, which looks over the granary inside the walls and the nature preserve outside. You can follow the wall southeast to another watchtower on the south wall, or return north to the west wall.?MG>>>>& wall zzIt's fifteen feet tall, made of smooth, white weathered stone. It's in amazingly good shape, considering how old it is.MO actorN u5*MO actorN 5 Hopeless.MMO actorN 5QMO actorN 5^ ^ M^ ^ n...$ !!Watchtower South (west of gate) \b\tThis is the southern watchtower, which is on the west side of the palace gate. From here you can see the pond and most of the gardens. You can cross east over the gate to another watchtower, or return northwest.FA^ v666$ !!Watchtower South (east of gate) \b\tThis is yet another watchtower, identical to the others you have seen. You have a nice view of the rock garden from here. You can cross back west over the gate or continue northeast along the wall to another watchtower.EB^ N   $ Watchtower (southeast) \b\tThis is the southeast watchtower, which looks over the nature preserve outside and the meditation temple inside. You can exit north to the east wall or return southwest to the palace gate.H?N^ ^ & stone ZZIt's a very smooth-textured, dull white stone. You're not sure exactly what kind it is.MMO actorN 7QMO actorN 7^  ^ M ^  ^  ^  ^ ^ H222& tower It's circular, and made of the same smooth white stone as the palace walls. It's also completely empty. There are windows all around the circumference which provide excellent views of the palace and the surrounding gardens.MO actorN 9:%ZMO actorN3 :;You search the barren room for a while, but find nothing.#>MOavipN :)  Pointless.*"4MOavdpN : Pointless.*MMO actorN $;B viewfMO actorN% ;h]MO actorNI <>The windows don't have any glass, so they're already 'open'.MO actorN <EMO actorN 6<&You'd just fall and break your neck.MO actorN v<?MO actorN? < "EXAMINE VIEW" will suffice...}&j*** MN =>" N (>The preserve is a vast expanse of green that stretches as far as the eye can see. The granary is an unimpressive cluster of buildings below you.LN w>@Even with the full moon, it's too dark to really see anything.F MN >>" }N "?nThe view is very impressive here. The gardens and pond look almost surreal in the light of the setting sun.LN m?@Even with the full moon, it's too dark to really see anything.T MN @>" N @}The view is very nice from up here. The rock garden dominates this part of the landscape with its large colorful displays.LN @@Even with the full moon, it's too dark to really see anything.T MN A>" N A}The preserve is a vast expanse of green that stretches as far as the eye can see. The temple reposes peacefully below you.LN A@Even with the full moon, it's too dark to really see anything.l,,,MN NB>" N BThe preserve is a vast expanse of green that stretches as far as the eye can see. Below you, the barracks cast long, dark shadows on the east lawn.LN /C@Even with the full moon, it's too dark to really see anything. N^ ^ ^ ^ B  battlements hhThey're just small spaces carved into the top of the wall every few feet to provide cover for archers.MMO actorN LQMO actorN M^ M~>>> N On closer inspection, the stone that makes up this wall looks somewhat different than the stone used in the rest of the palace. Also, one of the battlements has tiny, thin grooves etched along the top of it.MMO actorN BNQMO actorN cNPPP& wall It's fifteen feet tall, and in very good condition, considering its age. This particular section of the wall, from the ground to the battlements, is made from a different type of stone than the rest of the palace. NMMO actorN  OQMO actorN/ OR&  grooves There are about a dozen of them, spaced a few inches apart. The grooves are about a half an inch deep, and about as wide as the edge of your sword. NMMO actorN PQMO actorN Qp///& N The stone here is a different type than that used in the rest of the palace. It's somewhat sandy-colored, and it has a mildly abrasive texture. stoneMMO actorN DRQMO actorN eRMO actorN R .$  Underground \b\tYou are in a narrow, subterranean passage which is only barely illuminated from the room above. The tunnel continues north on a gradual descending slope into darkness.C!?"!ttt$  Granary %%It smells like earth and old grain.1MN\b\tIt's cool and dry inside this dark stone building, which likely used to be a storage area for grains and other perishables.>I ! Nd| There's a strange altar of some sort at the back of the room, next to a tall shrine which houses a laquered wood statue.  ! NV There's a tall shrine at the back of the room which houses a lacquered wood statue.> 6 ANW5\b\tThere's a faint glow emanating from the shrine.NG\b\tThe altar has disappeared, revealing a dark passage leading down.EMN  E   NN\b\tFor reasons you can't explain, you feel it would be wrong to take the large jar from the granary, so you put it back on the altar before you leave.\b\tNI>&N>>  E >  NS \b\tYou feel somehow that it would be wrong to take the small jar from the granary, so you place it back on the altar before leaving.\b\tI>&N >>  E >  N9 \b\tYou get the feeling that it would be wrong to take the jars from here, so you put them both back on the altar before you leave.\b\tN I>&I>&>N >JMN >  E >  N \b\tFor reasons you can't explain, you feel it would be wrong to take the large jar from the granary, so you put it back on the altar before you leave.\b\tI>&N >>  E >  N \b\tYou feel somehow that it would be wrong to take the small jar from the granary, so you place it back on the altar before leaving.\b\tI>&N >>  E >  Nm \b\tYou get the feeling that it would be wrong to take the jars from here, so you put them both back on the altar before you leave.\b\tN I>&I>&>N >DKMN>I" You can't go that way.Ne >6)MN"$  Dark tunnel \b\tA sense of uneasiness gradually creeps over you as you continue deeper into the dark passage. Behind you to the south, a thin shaft of pale light marks the tunnel's entrance. The passage continues north, although you can't see anything in that direction.6lMN UF\b\tThere is a large boulder resting at the side of the tunnel here.N 3U"#&@ ?$#BBB('  boulder FFIt's a large, almost perfectly round boulder, about three feet tall. on off ofMO actorN =VDMO actorN WV%It's far too heavy for you to lift.TMO actorN V  ,N V You're already on the boulder!RMO actorNV V"You stand on top of the boulder.>NV BW&MO actorN HW<&MO actorN W<MO actorN WMO actorN* W>  6You get off the boulder.\bN* X< >&(N* UXYou're not on the boulder! MO actorN cXMO actorN }X<! LN X3You give the boulder a shove. It rocks slightly.[< N iYYou shove the boulder again, harder this time. It flips over, and slowly rolls into the darkness down the sloped passageway.N Y$<&< N 4ZtYou give the boulder a good hard shove, sending it rolling and crashing down the sloped dark passage to the north.!<&N hZ%&& >MN Z(You need to get off the boulder first.!MN [< MN 4[<  $$HMN ^> $  DarknessN f^Semi-dark tunnelAMN t^> $ ~N _o\b\tIt's nearly pitch black. If there were such a thing as a grue, you'd be in danger of being eaten by one.N _\b\tThe apparition behind you provides barely enough light to see by, not that there's much to see; a featureless tunnel wends off north into the darkness.@"?MN _> $ N `Hands extended protectively in front of you, you take a few tentative steps north, and promptly stumble on an uneven patch of rock. You wisely decide that it's just too dangerous to continue without any light.N aWith the apparition providing a faint pale light behind you, you manage to navigate the treacherous passage. The tunnel snakes north for a long while, rising and dipping occasionally, until its eventual termination in a...\b%>N a%$VMN m>'" Small cavern*N nSmall cavern, on the boulderMN n\b\tWater plips softly in the darkness at the edges of this small cave, which tapers upwards twelve feet to a recessed trapdoor in the ceiling.4 % eN nY\b\tThe trapdoor has been opened, and a rusty chain ladder hangs down from the opening.@cMN zoGYou make your way back south through the twisting, winding passage.\b$>CMN o>4 % %The trapdoor is out of reach.^N .pHPutting fears of tetanus aside, you climb up the rusty metal ladder.\b5>&&  boulder FFIt's a large, almost perfectly round boulder, about three feet tall. MO actorNt [ZMO actorN N\;You don't have the strength to move the boulder any more.MO actorN Y\DMO actorN s\%It's far too heavy for you to lift.MO actorNf \IMO actorN \"You stand on top of the boulder."'MO actorN =]DMO actorN  Z]You get off of the boulder.!'  'C  trapdoor 33It's a wooden trapdoor set high into the ceiling.fMO actorNb phMO actorN q>& % E >'" kN kq\Even standing on top of the boulder, you're still about five feet away from the trap door. N qIt's too far away.fh fhfhf%hfh9MOactorioN r >'" WN SrHEven with the stick, you're still several feet away from the trapdoor.$N sStanding atop the boulder, you push the trapdoor open with the sturdy bamboo stick. You hear a 'thud' as the heavy door lands on the floor of the room above, and then an abrupt jangling of metal as a rusty chain ladder drops down from the open passage.%>4&N s!<&N sHow?!=9>: 9: %(N$ ShrineMN\b\tMade of unpainted, fragrant cypress wood, this simple structure stands in dramatic contrast to the grandeur of the palace. Beneath its closely shaven thatch roof, a wooden statue of a woman rests on a tatami mat in the middle of the room. A yellowed length of parchment is on display in a glass case next to the statue. Brick paths exit the shrine to the east and west, and a path north leads back to the palace.N% ! nNJb A path to the south terminates at the makeshift plywood wall which bisects the castle grounds.>% ( O The plywood wall to the south appears to have been knocked over by the wind.& 6 AN5\b\tThere's a faint glow emanating from the statue.?cMN7>L ( GN8The warrior steps in front of you, blocking your path.>L ' NoYou step out of the shrine and find yourself in a dense, bluish fog. You stumble about blindly for a while, completely disoriented, until you somehow manage to end up in the courtyard once more.\b\t'>N/>AcMN>L ( GN8The warrior steps in front of you, blocking your path.>L ' N You step out of the shrine and find yourself in a dense, bluish fog. You stumble about blindly for a while, completely disoriented, until you somehow manage to end up in the courtyard once more.\b\t'>NO1>BcMNm>L ( GN8The warrior steps in front of you, blocking your path.>L ' NYou step out of the shrine and find yourself in a dense, bluish fog. You stumble about blindly for a while, completely disoriented, until you somehow manage to end up in the courtyard once more.\b\t'>N,>@MN>L" \NKCYou head south, walking over the remains of the plywood wall.\b\t'>DN8A tall plywood wall prevents travel in that direction.)= ghost 00The apparition is insubstantial, though it's easier to see now than it was earlier. You can almost make out some features now; It appears to be a samurai warrior dressed in a full suit of armor. The air surrounding it is cold and damp. It's looking at the statue of the woman with an air of longing.> ee\b\tThere is a strange apparition here, floating a few feet away, glowing with a faint amber light.MO actorN;MO actorN:<You meet some resistance when you touch the apparition, though you can still put your hand through it if you wished. It's cold, but not nearly as freezing as it seemed earlier. % //You catch a faint scent of sea salt and iron.'MO actorN(<>  )N(4=You don't have a camera!uN(=iYou take a snapshot of the ghost, knowing full well that these types of things NEVER show up on film... MO actorN= MO actorN!>tYou don't think weapons will have any effect on it. Besides, you don't feel that the spirit means you any harm...Nb>{MOvdpiN>JIt's entranced by the statue; it doesn't even seem to know you are here.N>*U GGAnything you try to give the ghost will likely pass right through it. --The apparition doesn't appear to notice it.#MOactorioN?AMOactorioN?The spirit doesn't respond.#MOactorioN*?AMOactorioNS@The spirit doesn't respond.T The ghost doesn't respond. *vuuuB moon MMIt's a beautiful full moon, shining in the evening sky like a bright jewel.+^* ,,$ Reflecting poolsMN\b\tThis small clearing, surrounded by maple trees, is filled by two shallow, irregular-shaped reflecting pools which shimmer softly in the moonlight. You see the dark shapes of several fish swimming in the smaller pool, while a tall shrine sits at the edge of the larger pool. The two pools are separated from each other by a narrow strip of lawn about three feet wide, upon which stands a wooden sign. The cypress shrine is back to the east.>< 6 AN5\b\tThere's a faint glow emanating from the shrine.AuMNV><" E >=" E >>43N\b\tAs you step into the shrine, you notice that the light here has changed subtly. The apparition in front of the statue has changed in color from amber to bright red, and is shimmering brightly. It also appears more substantial, somehow.\b\t!>)&(>>&N(>">4N(>-^* (.^* //F$  North lawn \b\tThe north lawn of the palace is an unremarkable expanse of short grass. To the south, the path winds through a series of tall arches to a simple wooden shrine. The palace proper is back north.@(?50^* 11[[[$ Outside library \b\tYou're standing outside a tall, octagonal wooden building with a traditional slate peaked roof. To the west, a brick path leads back to the shrine.A;BxMN #}<" E =" E >43N O~\b\tAs you step into the shrine, you notice that the light here has changed subtly. The apparition in front of the statue has changed in color from amber to bright red, and is shimmering brightly. It also appears more substantial, somehow.\b\t!>)&(>>&N ~(>">4N ~(>I;2^* 33D$ Reflecting pools \b\tThis small clearing, surrounded by maple trees, is filled by two shallow, irregular-shaped reflecting pools which shimmer softly in the moonlight. 22This is the only place you want to be right now.4H& ladder <<It's a rusty chain ladder that leads up to the room above.MO actorNi tqMO actorN >uHPutting fears of tetanus aside, you climb up the rusty metal ladder.\b5> 5kkk$  Throne room \b\tSoft moonlight seeps in from hundreds of tiny cracks in the walls, barely illuminating this cavernous space. This area of the palace appears to be undergoing extensive renovations; what little furniture remains here is draped with plastic sheeting, and iron scaffolding covers much of the wall space. A trapdoor leads down from here into a dark passage, and a wide archway to the south appears to lead outside.D8MN>4NuAs you put your foot on the rusty chain it suddenly snaps beneath your weight and tumbles into the cavern below. You manage to grab the floor just in time to avoid falling down with it.N"4FN :With the ladder broken, there's no way to get back down.@VMN1You follow a brick path south to a wide lawn.\b/>Ni6nnnB path 88They're long and winding paths made of deep red brick. /7& torii The tall arches, known as torii, are a common sight in Japan. They consist of two thick, twelve-foot-tall support posts topped by a long crosspiece. They typically surround Shinto shrines and are said to purify the souls of those who pass beneath them.MO actorN* x\MO actorNN y=There's really nothing to be gained by climbing the arches. /8gggB grass 66It's short, tough grass, sparkling with evening dew. /9```B dew 11The dewdrops shine like clusters of tiny stars. /:& wall The wall is about thirty feet to the south, and it stretches from one end of the palace perimeter to the other. It's as tall as the palace walls, fifteen feet high, and made of sturdy plywood.MO actorN g{FMO actorN {'Who do you think you are, Spider Man? MO actorN^ { KMO actorN {,You pound uselessly at the sturdy plywood. (;^$  LibraryMNgG\b\tThis strange one-room building appears to be a library of sorts; the walls are totally obscured by cedar shelves from floor to ceiling. On the shelves are scrolls, hundreds of them, stacked on top of one another in wooden cases. The shelves are labeled at regular intervals with tiny brass plaques that have dates written on them in both English and Japanese. In the center of the room, for no apparent reason, is a man- sized gingko tree with some nests scattered among its branches. On the back wall, a tall shrine with a laquered wooden statue inside of it sits quietly.>= 6 AN5\b\tThere's a faint glow emanating from the shrine.6MN%Y\n\tSurrounding the tree, arranged in a circle on the floor, are five marble figurines.;&;&Nm;&;&;&NBMN>  E >  E >  E >  E >  !N \b\tAs you turn to leave the library, you catch a flash of light out of the corner of your eye. Startled, you whirl around to face the gingko tree, which has inexplicably begun to shine with a bright, shimmering light... \b\tWithout warning, the world swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\t>&" NnA&N1>N<ZZZ0   model coat &&It's a small wooden model of a coat.=XXX0  model rat %%It's a small wooden model of a rat. >TTT= ghost The apparition is glowing brightly with shimmering red light. You can make out the man's features now; his face bears some resemblance to your own, although his young face bears a few battle scars and is lined with an unspeakable sadness. His armor is scarred, as well, and you notice a frail, dried orchid stitched into the breastplate. He is staring at the statue with an expression of longing.> gg\b\tThere is a strange apparition here, floating a few feet away, glowing with a brilliant red light.MO actorN**CoMO actorNNCPYou touch the spirit, and are surprised to feel cold steel beneath your touch. % 11You catch a faint scent of smoke and hot steel.'MO actorN*(D>  )N*pDYou don't have a camera!uN*DiYou take a snapshot of the ghost, knowing full well that these types of things NEVER show up on film... MO actorND MO actorN]EtYou don't think weapons will have any effect on it. Besides, you don't feel that the spirit means you any harm...NE`MOvdpiNE/It doesn't show any sign of having heard you.NE*UV __The apparition doesn't appear to notice your offer; it seems totally entranced by the statue.#MOactorioNFAMOactorioNFThe spirit doesn't respond.#MOactorioNFAMOactorioN/GThe spirit doesn't respond.T The ghost doesn't respond.MNGCpMNGF\b\tThe ghost sings a trembling low note that slowly dips in volume.CMNHU\b\tThe ghost sings a quavering high note, his unearthly voice tinged with sadness.CMNSIu\n\tThe melody trails off, and the spirit resumes staring at the statue, returning to his former trance-like state.! ?fffB path 66It's a long and winding path made of deep red brick. 1@&  building ^^The building is rather unremarkable on the outside. The door appears to be open, however... 1AC palace The walls of the palace proper are covered by a web of scaffolding that reaches up to the peaked rooftops. Even shrouded in darkness and iron, however, the building still retains a sense of majesty and great beauty.B^A /C^A (D$ Koi pond, southern shore ..\b\tThe walls of the palace and the hillside it sits on are reflected in the waters of this large, tranquil pond. From time to time, fat, colorful koi (carp) break the surface to disturb the floating lotus blossoms. A wooden footbridge crosses the pond to the north, and the park entrance is south.@?LE %%Not unless you can walk on water...F %%Not unless you can walk on water...EH H H$  Shady path __\b\tTiny stones crunch softly beneath your feet as you walk down this shady, tree-lined path. Cherry blossoms carpet the trail like new fallen snow, and the surrounding cypress, oaks, and maples diffract the late afternoon sun into dappled amber hues. To the east, the path widens into a large open area. You can return to the park entrance west. 77The air is fragrant with the scent of cherry blossom.A^B ,,The trees are too thick in that direction.C You can't go that way.D You can't go that way.F:  $  Pine trail \b\tThe fresh scent of Japanese black pine awakens your senses as you make your way down the needle-covered trail. The stately trees line the path on both sides like quiet sentinels. West, the trail leads to an open, grassy meadow. The park entrance is east. AAYou take a deep breath, enjoying the cool, fresh scent of pine.AB ,,The woods are too thick in that direction.C You can't go that way.D You can't go that way.H= daimyoMN mpHe's an old, wizened man whose features have been hardened by a lifetime of enduring and inflicting cruelties."C> ))Shinobu is here, sitting on his throne. T $$He just stares at you impassively.MO actorN 8MOactordobjNB Tx wNB _You wave the blade threateningly at the daimyo's throat. He doesn't appear to be frightened.NB RNB .FThe only thing you want to show him is the sharp end of your katana.UMO actorN< ;VMOactordobjN` Wx UN` FThe only way you'll give it to him is point first through the heart.;N` /The only thing you want to give him is death.#MOactorioN! HMOactorioNJ 1$He just stares at you impassively.  MO actorN | \b\tWithout uttering a word, you approach the throne and raise your katana to strike at Shinobu's black heart. But before you can deliver the death blow, a horde of armored warriors bursts from the shadows all around you. A trap!!! you realize too late. Taken completely by surprise, you fight bravely but are quickly overpowered. The guards relieve you of your weapons and force you to kneel at the throne of the daimyo. The old man stares down at you for a long time before he speaks. Twin sparks of reflected firelight flicker in his eyes.\n\t"Good evening, Kaneiji," he says finally in his distinctive deep voice. "We've been expecting you." He smiles sadly. "You have courage, boy. It's a pity you don't have the wisdom to match it." He fishes a letter out of his pocket and tosses it casually on the floor in front of you. You recognize the handwriting immediately as your own.\n\t"Where the hell did you get..."\n\t"I can't say I blame you, Kaneiji," the daimyo continues, ignoring your outburst. "I find her as undeniable as you did. I searched my heart for days, trying to find an alternative. Send you to another daimyo. Dismiss you. Order you to accept the situation. But I know you too well, boy. We are too much alike. You wouldn't have been able to let her go..."\n\tYou remain staring at the letter, lost in thought, barely hearing the old man's words. Your heart sinks as the realization hits you. You've been betrayed. \n\t"Where is she?" you whisper, tears welling in your eyes. \n\t"Forget her," Shinobu says, eyes darkening. "She has made her choice." He turns his head towards a shadowy alcove behind him. "Come," he says sharply. "Show him." Slowly, a dark figure emerges from the shadows behind the daimyo. Your heart sinks as you look into the face of your betrayer. "No..." you whisper, unable to believe it. The traitor refuses to meet your stare. The daimyo stands and begins to walk towards the door. He pauses at the threshold, gazing at the dying flames outside. \n\t"Forgive me," he says. "I wish there were another way..."\n\tShinobu waves dismissively at the guards holding you. "Take him away," he commands. "The penalty for treason is death." The traitor's eyes widen in shock and horror. "No!!" the betrayer screams. "You promised he would be spared!!..." As the soldiers drag you to your fate, you cast a final glance back at the person standing beside the golden throne. "It doesn't matter now," you say. \b\tSuddenly, the world swirls and fades before your eyes. You drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\tCCN Ř >&AAN ! "H>x&IB sky XXThe sun is gradually descending, painting the sky with subtle touches of red and gold.J^I K^I DL^I LM^I N^I dO^I EP^I FQ^I RR Pond (on the pond) \b\tYou are on the west side of the koi pond, surrounded by thick reeds. The cool water laps gently at the edges of the raft. You can land on the shore here.dS^I TT4 Pond (under the bridge)MN I\b\tYou have arrived in the cool, shady area underneath the footbridge.> T SN G\b\tSomething shiny beneath the surface of the pond catches your eye.U^I VVL    Pond (eastern end) \b\tYou are at the eastern end of the large pond. It's very peaceful here, though there's not really much to look at. There's a tiny clearing on the eastern shore where you could probably land the raft.XW^I XX$V  Camp site \b\tYou are at the eastern shore of the pond, in a tiny clearing surrounded by thick woods on all sides. It looks as though this spot was recently used as a camp site, as there are remnants of a fire here in a small pit. ,,The woods are too thick in that direction.B The pond is that way.D You can't go that way.C You can't go that way.Y^I Z^I [[z999$  Deer glade]MN [u\b\tThis pleasant glade, nestled in the deep woods at the western edge of the park, is home to dozens of small deer ! FN E\7, although you can't see any of them at the moment. . N \vThere is a tall wooden fence to the west, which marks the boundary of the nature preserve. The meadow is back east.AB2MN \The fence blocks your way.! ,,The woods are too thick in that direction.C You can't go that way.D You can't go that way.\^I K]^I ^^$ Rock garden (West) ||\b\tThis is the western edge of a magnificent lake of multicolored sand. Japan is famous for its spectacular rock gardens, and this one is a beautiful example of the ancient art form. The garden is approximately sixty feet in diameter, and seems to be divided into four different colored sections. Octagonal flagstones lead east over the sand to a small island in the center.AmBE_^I ``$ On the steps \b\tYou are at the foot of a long flight of stone steps that have been carved into the steep hillside. Small granite statues flank the stairway at regular intervals. Far above you, the bronze palace gate shimmers in the sun like a beacon. A footbridge crosses the pond to the south.C?@LDL ..The hillside is too steep to explore safely.a^I Jb^I Ic^I Hd^I ee6$ Rock garden (Northwest) \b\tThis is the northwest corner of the rock garden. Here, varying shades of blue and green sand are raked to form vibrant patterns that resemble ocean waves. The flagstone path leads back southeast to the center of the garden.\b\tThere is a large statue here.Gm iiYou'd be walking on the sand if you went that way, and you'd hate to ruin such a beautiful work of art.C You can't go that way.D You can't go that way.f^I gg$ Rock garden (Northeast) \b\tThis is the northeast corner of the rock garden. In this corner, blue and white sand is raked into swirling, airy patterns. The flagstone path leads back southwest to the center of the garden.\b\tThere is a large statue here.Hm iiYou'd be walking on the sand if you went that way, and you'd hate to ruin such a beautiful work of art.C You can't go that way.D You can't go that way.h^I ii$ Rock garden (Southeast) \b\tThis is the southeast corner of the rock garden. In this area red, orange, and yellow sand is raked into flame-like shapes. The flagstone path leads back northwest to the center of the garden.\b\tThere's a large statue here.Fm iiYou'd be walking on the sand if you went that way, and you'd hate to ruin such a beautiful work of art.C You can't go that way.D You can't go that way.j^I kk$ Rock garden (Southwest) \b\tThis is the southwest corner of the rock garden. The sand here is mixed with regular dirt, and it's not even raked. The flagstone path leads back northeast to the center of the garden.\b\tThere's a large statue here.Em ccYou walk around in the dirty sand for a while, but eventually get bored and return to the statue.C You can't go that way.D You can't go that way.l^I mm  $ Small island MN 4\b\tYou're standing on a tiny island of rock in the middle of the garden. More flagstone trails fan out from here to the northeast, northwest, southeast and southwest corners, and another path leads west back towards the park. You can also see a small stone building sitting unobtrusively at the eastern edge of the lake. \b\tThere is a six-foot tall slab of marble standing in the center of the island.>y" ZN 5N\b\tSomething's different here, but you can't quite put your finger on it...B^EgFeGiHkAo@MN 5kYou'd be walking on the sand if you went that way, and you'd hate to ruin such a beautiful work of art.\b!N .6?MN 6kYou'd be walking on the sand if you went that way, and you'd hate to ruin such a beautiful work of art.\b!N 6n^I ooH  $ Tomb entrance 11\b\tYou're standing in the shadow of a small, simple building made of gray stone. It looks like it could be the entrance to a tomb. The sand surrounding the building is a muted shade of gray, and is raked in abstract, looping circles. The rocky island at the center of the sand garden is to the west.BmAMN *i> o The door blocks your path.N vi> y E > y E > y E >z y E > o N j...\n\t...but suddenly you hear a rumbling noise from deep inside the structure. Slowly, the granite slab descends into the floor, revealing a dark opening. Apparently, you did something right.\bCN k?>  N 0k> !  ?>IMN lk> o The door blocks your path.N k> y E > y E > y E >z y E > o N l...\n\t...but suddenly you hear a rumbling noise from deep inside the structure. Slowly, the granite slab descends into the floor, revealing a dark opening. Apparently, you did something right.\bCN Dm?>  N om> !  ?>6 \b\tYou're not a morbid person by any means, but something about this building draws you to it. You feel a powerful urge to find out who or what is inside. iiYou'd be walking on the sand if you went that way, and you'd hate to ruin such a beautiful work of art.C You can't go that way.D You can't go that way.p>B trees JJThis part of the garden is home to Japanese red maples and spruce trees.MO actorNv RMO actorN 3None of the trees here are suitable for climbing. qj)))0 piece of gum JJIt's an unwrapped piece of "Super Fish: Final Champion!" gum. You bought it at the Nagoya airport, thinking that it might make an amusing souvenir. As an added bonus, the original wrapper said you can even chew it underwater and it won't lose its flavor or stickiness (whatever good THAT'll do you, since you can't even swim). rMO actorN TMO actorN ,It smells kind of nasty, like rotten fish.N O %MO actorN R &MO actorN'  You put the gum in your mouth and chew it, and promptly spit it back out. Yuck! Why would anyone go to the trouble of inventing a chewing gum that tastes like rotten fish?N' 6 !>q&N' L  >+&N' m rH  0> wallet ppIt's a plain brown, faux-leather wallet. If you had a family, you'd have their pictures in it, but you don't.fMO actorN #hiMO actorN JThe wallet doesn't open or close, really... You can look in it, though.ifjhMO actorNB PMOactordobjNf KMNf &You put the gum back in your wallet.r>q&Nf TNf WNf _ That would make an awful mess.Nf Nf (You put the check back in your wallet.!>u&Nf Nf Nf "You put the coin in your wallet.r>{&Nf <ONf DThat won't fit in the wallet.Nf oq+u4{~Nf r s@& **Sorry. You threw it out a few days ago.  wrapper q#UMOavipN` ) 'N` It's gone. Get over it.*"BMOavdpN I It's gone. Get over it.*t0 bunch of traveler's checks6MN 7It's a bunch of traveler's checks in various denominations. You brought way more than you needed; but then again, you've got money to burn...N B|This should not need an explanation, but just in case - To take a single check out of your wallet, simply type TAKE CHECK.N  rMO actorN ;MO actorN Uu  IN 0You take one of the checks out of your wallet.>u&[N #OYou don't want to lose any more money than you have to. One at a time, okay?MO actorN{ . 88You'd better hold on to your money until you get home.MO actorN  88You'd better hold on to your money until you get home.K#MOactorioN? #MOactorioNh !#MOactorioN @u  0 single traveler's checkMN <`N QThe check is on fire, blazing hot. You won't be able to hold onto it for long.QN SEIt's a regular, paper traveler's check, worth about twenty dollars.MO actorN {MO actorN' -You drop the check on the ground and a sudden gust of wind blows it away. Well, there goes twenty bucks. You kick yourself for your stupidity.N' @!>u&MO actorN ZMO actorN You throw the check in the air and a sudden gust of wind blows it away. Well, there goes twenty bucks. You kick yourself for your stupidity.!>u&K#MOactorioN 8MN \b\tThe check burns up to your fingertips, and you drop it to the ground. It shrivels into a tiny ball of black ash and scatters to the wind.N !!<&IMO actorN -JMOactordobjN L<<N -I think you mean "LIGHT CHECK WITH FIRE"...=N v >vjN [You touch the flaming check to the pile of coals, but try as you might, they won't light.N ^You touch the flaming check to the pile of coals. After a few moments, the coals catch fire.!>v&wx&N yz&"yN That won't burn. vn& coalspMN zQIt's a pile of cold coals.<" ;N Q/\b\tThe coals have been soaked with kerosene. ..You don't really have any use for the coals. There's nothing in the coals.  66You move them around a bit, but don't find anything.K#MOactorioN1 RMO actorNZ RMOactordobjN~ R6 NN~ KS'You pour the kerosene onto the coals."!>6&>7&N~ S)MO actorN  SOMOactordobjN/ SKPN/ S>u" N/ =T3You touch the flaming check to the pile of coals.<" sN/ T. After a few moments, the coals catch fire.N/ T!>v&w>x&y>z&N/ T"y@N/ 9U4 For some reason, the coals just won't catch fire. What for?N/ VUN/ YU,N/ aU What for?N/ xU uN/ {UPO wMMO actorN UwP& statueMN *NThis statue, carved from some type of red stone, depicts an ugly old man, surrounded by flames, carrying a sword and a rope. There's some writing along the base of it.>v w JN xN>\b\tThere is a cold pile of coals at the foot of the statue.>x w JN N>\b\tThere is a small fire blazing at the foot of the statue.>  w JN XO>\b\tThere is a pile of hot embers at the foot of the statue.MMO actorN iO ix||| OUsMO actorN/ @'0You take a deep breath and blow out the flame.!<&w &>z&N/ 'AAMOactorioN '4 N '<You pour some water on the fire, putting it out instantly.N (!<&!>4&w> N d(>z&N (5 N (FThe sand trickles out of your hand onto the flame, extinguishing it.N (!<&!>5&w> &N 9)>z&MO actorN ^)fMOactordobjN z)4 N )<You pour some water on the fire, putting it out instantly.!<&N *!>4&w> &>z&N N*N ]*6 N A+You pour the kerosene on the flame. WHOOMF!! An impressive ball of fire shoots into the air, and the accompanying blast of heat forces you to back away for a few seconds. What fun!! Too bad you just made the game unwinnable...N e+!>6&>7&N +5 N +FThe sand trickles out of your hand onto the flame, extinguishing it.!<&w> &N ),!>5>z&N d,y& marbleMN 8MIt's an asymmetrical, rough-hewn slab of white marble, about six feet tall.N 8> y FN E9:\n\tThere's a Kanji symbol for air carved in the marble.N V9>z y GN 9;\n\tThere's a Kanji symbol for fire carved in the marble.N 9> y HN 9<\n\tThere's a Kanji symbol for water carved in the marble.N :> y HN b:<\n\tThere's a Kanji symbol for earth carved in the marble.N }: mMMO actorN  :MO actorN. :BMO actorNR :#It's not really worth the effort.z&  fire symbol 00It's the Kanji character that represents fire. ##Touching the symbol does nothing. {RRR0  coin $$It's a small, silver ten-yen coin.|& pile of garbage DDThe garbage is a revolting mixture of old food and wet newspapers. }MO actorN yKMO actorN #Why, it smells just like garbage!N lMO actorN @Why on earth would you want to carry around a pile of garbage?!N 8% MO actorNi P<Ni WHolding your breath, you sift through the smelly pile and discover a soggy paperback. Ni }~&Ni "Ni  FNi  :You can't bring yourself to touch that nasty mess again.Ni V &% %#%}lll&>  trash can It's an orange, government-issue trash can, chained to a concrete post. It's a good alternative to throwing garbage on the park grounds. MO actorN !`MO actorN !AThe trash can is chained to a concrete post and can't be moved.  MO actorNg %"PbMOactordobjN "<You'd better not throw that away; you might need it later.fMO actorN "h:MO actorN "The trash can is lidless.ifjh ~ V V V 06 soggy paperback ddIt's an old, worn American joke book called Stupid Jokes, vol.3. It smells a little like garbage. MO actorN $ZMO actorN $2It smells like it's been sitting in a trash can.N ?% MN P%'You turn to a random page and read-\bN z%KN %N %J"Why did the chicken cross the road?\t-To get away from Frank Perdue!!" N %N %N %7"What's yellow and wears a mask?\t-The Lone Lemon!!" N 4&PN <&N F&D"What do you call a paraplegic in a pile of leaves?\t- Russell!!" N &N &N &C"What do you call a drummer without a girlfriend?\t- Homeless!!" N &N &N >'K"What's the difference between a laywer and a bag of crap?\t- The bag!!" N J'!N R'N '\"What do you get when you cross a crooked politician with a crooked lawyer?\t- Chelsea!!" N 'N 'N '?"What do you call a paraplegic in a swimming pool?\t- Bob!!" N (HN (N #(:"What do you call a cow with no legs?\t- Ground beef!!" N b(N j(N s(E"A guy walks into a bar and goes... OW!!! (It was a metal bar...)" N (N (N )L"This horse walks into a bar and the bartender says 'Why the long face?'" N ) N ()N q)\"What do you call a thousand lawyers buried at the bottom of the ocean?\t-A good start!!" N )N )N )["A lawyer and a politician jump off a bridge. Who hits the ground first?\t-Who cares!!" N *+N *N *"A grasshopper walks into a bar. The bartender says, 'Hey, we've got a drink named after you!' The grasshopper replies, 'Really? You have a drink named Bill?'" N *hN *N +}"How many divas does it take to screw in a lightbulb?\t-Just one; she holds it still while the world revolves around her!" N U+N ]+N +E"How many buddhists does it take to change a lightbulb?\t-A fish." N +h[ h& C   x AN +2\bYou laugh heartily. You really must be tired.>  E N s...\b\tSo tired, in fact, that you just can't stop. You fall helpless to the ground, tears streaming down your face, laughing uncontrollably. You feel totally ridiculous, but wonderfully refreshed at the same time, as if the very act of laughing was cleansing your soul. Suddenly, a powerful sensation of deja vu overtakes you... You've been here before, laughing just like this... \b\tWithout warning, the world slowly swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death- like state you have no idea where or even who you are...\b\tb>&N .ACN /" >  lN /`\b\tThe vendor watches your antics with an amused smile on her face. "I no get it," she says.N /K#MOactorioN0 /YYYB post ))Really, you've got better things to do. = crowd The crowd is made up of rowdy young samurai like yourself. They're relaxed and having a good time, and it's obvious that most of them have been drinking plenty of rice wine this evening.> 77There is a large rowdy crowd here, enjoying the show.ZMN3< > 7<N3 KN 4N74E\b\tThe crowd erupts into laughter after a particularly bawdy joke.N[4Nc4N4o\b\tA drunken comrade stumbles past and nearly falls on you. He mumbles something incoherent and moves away.N4"N4Nw5\b\tA slightly inebriated spectator in the front stands up and yells something obscene at one of the puppets. He is promptly knocked down by another samurai, much to the amusement of the crowd.N5?N5N6X\b\tSomeone behind you bursts into song, and is immediately shouted down by the crowd.N#6N+6Ns6\b\tSomeone makes a lewd comment to one of the performers at the side of the stage. The performer ignores him and continues to play.N6"mET FFNobody's particularly interested in having a conversation right now.U QQThey don't want anything but more sake, and unfortunately you don't have any... AAThey could care less. "Down in front!!" someone shouts at you.#MOactorioNs7 ##You are immediately shouted down. MO actorNN8  00You don't feel like picking a fight right now.MO actorN8 00You don't feel like picking a fight right now.:MOvdpiNy9They ignore you.* bpppp0C palace The palace is an impressive piece of fourteenth-century architecture; a four-story stack of ornate peaked roofs, noteworthy for its unusual octagonal outer wall.'MO actorN 0(wMO actorN 0>  )You don't have a camera!N F1'$You take a snapshot of the palace.^ ^ D^ L^ `^ ^ HP0C pond >>It's a large pond that runs the entire length of the palace. 'MO actorNs 3(uMO actorN "3>  )You don't have a camera!N p3%"You take a snapshot of the pond.XXXB  dirt road ##It's nothing to write home about. B gravel 11This isn't one of the sights you came here for. MMO actorNf 4]]]C  footbridge ''The footbridge is just north of here. DD  &#[MOavipN }7) -N 7 How do you propose to do that?*"[MOavdpNz 7) -Nz (8 How do you propose to do that?*'MO actorN ;8(tMO actorN V8>  )You don't have a camera!N 8$!You take a snapshot of the koi. koi ||The koi are revered in Japan as symbols of luck and prosperity. The ones you see here seem especially large and colorful.^ D^ d^ R^ T^ V^ LB lotus blossoms HHThe white lotus blossoms float gracefully on the surface of the water. DB path aaIt's like you've stepped into a painting. You wish there were more places like this back home. EB stones ^^The groundskeepers must rake them frequently. The path looks like it hasn't been disturbed. EMMO actorN m?B cherry blossoms eeThey're very beautiful this time of year. Some tourists come to the park specifically to see them. ENB trees LLThe beauty of the natural surroundings fills you with a sense of serenity.MO actorNx bAaMO actorN ABUnfortunately, none of the trees here are suitable for climbing. ETTTC meadow ""The meadow is just west of here. FZ Z ZB pines ''The woods are lovely, dark, and deep. FMO actorNa KEYMO actorN fE1Sharp, fresh, reminiscent of Christmas morning.N EMO actorN EOMO actorN E0The pines aren't really suitable for climbing.nnnB  needles 55The needles feel soft and spongy beneath your feet. Fd((= vendor The vendor is a very old woman dressed in a simple kimono. Her snow-white hair is pulled away from her weathered face in a neat bun. She seems very friendly.> >>A vendor is here, selling biscuits from a small wooden cart. MN< > KN NN NN  NN N-N5 \b\tThe vendor stifles a yawn.N`SNh$\b\tThe vendor counts some change.NN$\b\tThe vendor looks at her watch.NNN M\b\tThe vendor looks at you and shrugs, as if to say "Where is everybody?" N1sN9)\b\tThe vendor hums quietly to herself.Nm4Nu NN NN NN NN NN9\b\tThe vendor nods off for a second, then snaps awake.N-h}'Z     -?V#MOactorioN<4^MOactorioNeu(The vendor smiles politely and nods. NeKNeNe"Yes, yes." NeNeNe"Nihongo ga wakarimaska?" NeNe Ne#"Sorry- English no that good..." Ne<LNeDNeN"Eigo ga wakarimasen. " 'MNep#MOactorioNsMOactorioNK3N#"Palace closed for renovation!!" NqN"You seem like nice person!" N-<N5Nz@"They so greedy! Sometime you even have to scare them away!" NN"My name Michiko!" NN$"Only ten yen! Very good value!" NxN$"Only ten yen. Very good value!" N8>N@NL"Big statue, huh? His name Ryuko! Shinobu built him to protect palace!" NNN?"That tomb protected by powerful magic! All four elements!" She looks around furtively and whispers, "Blow out Fujin's fire and see what happen to the door!" NfNn"He just a red herring!" NN"Aah... You like to fish?" NN2"Ooh, that one... Poor thing... He so skinny!!" N fN +"Tourist sometime throw coins in there!" N^ %Nf N B"People lose kite up there all the time! Have to shake loose!" N N  "You have any lighter fluid?" N N '"Sound like you need wet washcloth!" N1 QN9 "Don't touch! Off limits! " Nk Ns "He was very mean person!" N N "Ever see Die Hard 3?" N N )"It take study to use sword properly!" N {N "Hotei like a good joke!" NM INU &"You find the seven treasures yet?" N  N "Aah... Such sad story!" N N  "He was very famous warrior!" N N #"Sorry... My English terrible!!" y7!CovxHI?JiKL3[N,  MO actorN /  [MO actorN b 3I wouldn't mess with her. She might know karate.N  MO actorNW  %]MO actorN{  5"Get your hands off me, mistah!! I call police!!" N{  %% %MO actorN9 IMO actorN2T *"Keep your hands to yourself, mistah!!" +MO actorN ,oMO actorNPGood lord. She's at least seventy years old!! What's wrong with you, anyway?MO actorN1MO actorN>9She smells nice.UVMO actorNMOactordobjN  "Nice camera!" N{ NYou hand the coin to the vendor. She accepts it with a smile and hands you a packet of biscuits. "Domo origato gozaimashta!!" she says.>&N!>{& Nt $"Sorry - Cash only please!" u -N,"Sorry - Cash only please!" k~ <Ny-"That smell funny! You get from garbage?" ' <N-"Ooh! Too bad! Now it just useless rag!" 6 fNeWThe vendor eyes you suspiciously. "You not supposed to start fire on park grounds!" u \NM"Nice key!" The vendor looks at you suspiciously. "Where you find that?" x dNPU"Nice sword!" The vendor looks at you suspiciously. "Hey... Where you find that?" F WNH"Look like lots of useful stuff in there! Why it all wet and slimy?" F+ *N"That look very sticky!"  &N""Sorry - no refund!"  +Np"Nice stick! Many uses!"  BN3"Hmm.. Look like that belong in treasure ship!" iN C4"Hmm... Look like that belong in treasure ship!" N' CN44"Hmm... Look like that belong in treasure ship!" M "N"Throw it away!"  CN4"Hmm... Look like that belong in treasure ship!" UN IShe looks at it politely, but you can tell she's not really interested.N[[MO actorN^\yMO actorNZYou plant a kiss on the old woman's cheek. She giggles and turns a bright shade of red.MO actorND(MMO actorNh.Now, that's just plain wrong. Shame on you.'MO actorNK(MO actorNf>  )You don't have a camera!N74The vendor grins widely and poses for the picture.MOvdpiNl 4NlJ$"Konichiwa!" she replies, bowing.*kNl^She just looks at you and smiles politely. You don't think she understood a thing you said.*fMO actorN=gMO actorNa8f"Boo!" you shout. The vendor jumps back, startled. "You almost give me heart attack!!" she scolds.  &  flowers ppIrises, violets, roses, and hundreds of other species in full bloom dazzle the eyes with their vibrant colors. MO actorN JvMO actorN KNYou inhale deeply, reveling in the sweet, heady mixture of natural perfumes.N -KMO actorNL 0K~MO actorNp K_You reach for a flower, but before you can take it, the vendor scolds you loudly in Japanese.jMO actorN Kk~MO actorN +L_You reach for a flower, but before you can take it, the vendor scolds you loudly in Japanese.jjj& cart ::It's just a plain wooden cart, piled high with biscuits. } } }& vendor biscuits 44They're thin, brown wafers, sold in large packets. MO actorNr M}MO actorN aNUThe vendor watches you suspiciously as you reach for a packet. "Ju-en!" she snaps.N oNMO actorN rN7MO actorN= N>{  SN= NDThe vendor shakes her head apologetically. "Sorry... Cash only!"N= qOYou hand the coin to the vendor. She accepts it with a smile and hands you a packet of biscuits. "Domo origato gozaimashta!!" she says.&N= O!>{& f% % %0 packetMN PIt's a thick packet of brown, rectangular deer biscuits.\b[This does not really need an explanation, but just in case... Type TAKE BISCUIT to take a single biscuit out of the packet.] MO actorN (Q(XMO actorN" AQ9You nibble on one of the biscuits. Not bad, you think.MO actorN QMO actorN Q>  !Taken.>&N Q  JN LR1You take one of the biscuits out of the packet.>&_N RSYou spent good money for these. You really should ration them out one at a time.MO actorN RMO actorN R [ N SYou drop the packet on the ground. In an instant, dozens of greedy, hungry deer swarm upon it, devouring the biscuits in seconds. You get the feeling that maybe that wasn't such a great idea.!>&)MO actorN T&MO actorN 5T [ N UYou throw the packet and it lands a short distance away. In an instant, dozens of hungry, greedy deer swarm upon it, devouring the biscuits in seconds. You get the feeling that maybe that wasn't such a great idea.!>&N hU)  0 single biscuit 99It's a thin, brown biscuit about the size of your hand.MO actorNn V(kMO actorN V;You eat the biscuit. It didn't taste too bad, actually...N mV!>&MO actorN V9MO actorN' V [ N' AWpYou let the biscuit fall out of your hand. Before it even hits the ground, it's snatched up by a greedy deer.!>&N' WmYou drop the biscuit on the ground. After a few moments, some birds discover it and peck it into oblivion.N' W!>&MO actorNf W3MO actorN X [ N XiYou throw the biscuit into the air. Before it even hits the ground, it's snatched up by a greedy deer.!>&N XnYou throw the biscuit on the ground. After a few moments, some birds discover it and peck it into oblivion.N GY!>& hhhB kimono 66It's light blue, with red flowers embroidered on it. BB pines QQThey're the Japanese black variety, like most of the pine trees in the gardens. MO actorN ZOMO actorN Z0The pines aren't really suitable for climbing.TTZ&&= deer The deer are fat, lazy specimens who survive mainly off the generosity of tourists. They eye you greedily, expecting a handout.VMOactordobjN a N `bYou take out a biscuit and offer it to the deer. Before you can blink, the biscuit is devoured by dozens of greedy mouths. You retreat to the meadow before they can consume the entire packet.\b!>&>N b N &+u N cqYou offer a traveler's check to the deer, and a greedy mouth gobbles it up. These creatures will eat anything!!>u&t JN "d;You'd better not. You still need some money to get home.IN md=The deer sniff dubiously at your offering, then turn away. UV#MOactorioN d;MOactorioN dOkay, Dr. Doolittle. #MOactorioN 0eHMOactorioN8 Se$The deer seem fascinated. Really.MO actorN e>MO actorN eThey haven't bathed in weeks.mMO actorN enMO actorN fYou scream at the deer at the top of your lungs. Instead of frightening them, however, you only manage to attract a few curious stares.fMO actorN fgsMO actorN f>x  uN _gfYou advance on the deer menacingly, but they aren't convinced by your act. Maybe you need a prop...N gYou charge at the deer like a wildman, waving the katana over your head. Something in your eyes tells them that you mean business, and they bolt like lightning into the woods.!<& N Lh MO actorN^ Qh MO actorN mh>x  fN hWYou're not going to scare them that easily, especially since you don't have a weapon./N i#Could you be a tad more specific?MOactorioND ,i ND iYou whack one of the deer with the walking stick. That only serves to make it angry, and it charges you. You hurriedly retreat to the safety of the meadow.\bND j> x ND jYou charge at the deer like a wildman, waving the katana over your head. Something in your eyes tells the deer you mean business, and they bolt like lightning into the nearby woods.!<& -ND 9k!You can't use that as a weapon.MO actorNB Hk(DMO actorNf ak%Mmmm. Raw venison. How appetizing.+MO actorN k,;MO actorN kYou must be from Arkansas! [> BBThere are dozens of fat, hungry-looking deer milling about here.[MO actorNq pl\;MO actorN lYou must be from Arkansas!'MO actorN l(MO actorN l>  )You don't have a camera!N *m=:They watch you, motionless, as if posing for the camera.lMOvdpiN mDThey look at you with slightly puzzled expressions on their faces.*MO actorN m%yMO actorN# DnZYou have better things to do than conduct a full cavity search on a bunch of mangy deer.MO actorN qndMO actorN nEYou push one of the deer and it falls over. Yee-haw! Deer tippin'!MO actorN0 nMOactordobjNT o gNT XoXYou wave the stick at the deer. However, they don't seem the least bit scared of you.0x NT @pYou charge at the deer like a wildman, waving the katana over your head. Something in your eyes tells the deer you mean business, and they bolt like lightning into the nearby woods.!<& RNT pFThey just look at you with bemused expressions on their furry faces.TTTC meadow ""The meadow is just east of here. [B woods ##The forest is quiet and peaceful.[MO actorNO ^3None of the trees here are suitable for climbing.NO ^ [ggg& fence A large portion of the palace grounds was converted into a nature preserve in the 1940's. This fence separates the preserve from the public areas. [MO actorN `wMO actorN ;`KNo way. The fence is nearly ten feet tall, with no handholds whatsoever.N `!d$ $ $= buck It's a skinny, half-starved buck. It seems intent on eating the textbook, but is having some difficulty with the cardboard cover.> dd\b\tA scraggly, scrawny young buck is here, messily devouring what appears to be a large textbook.#MOactorioN LrFMOactorioNA nrThe buck ain't talkin'.NA r#MOactorioN rRMOactorioN r%Honestly, the buck could care less.N s MO actorN s dMO actorN2 sEBut this is a nature preserve! Besides, he's just too darn cute...JMOactorioN s N 'tYou whack the buck on the head a few times with the stick, but he's so caught up in what he's doing that he doesn't even notice your feeble attack.tx ?N qt0You just don't have the heart. He's too cute.-N t!That can't be used as a weapon.N tMO actorN tAMO actorN tIt smells rather musky.N )u+MO actorNW ,u,;MO actorN{ FuYou must be from Arkansas![MO actorN {u\;MO actorN uYou must be from Arkansas!MO actorN! u(DMO actorNE u%Mmmm. Raw venison. How appetizing.VMOactordobjN v> [ E  #N GwYou take out a biscuit and offer it to the buck. Before it can react, a dozen greedy deer surround you and snatch the biscuit out of your hand. You hastily retreat to the safety of the meadow before the deer can consume the rest of the packet.\b!>&>N w> [ E u  N zxYou take out a check and offer it to the buck. Before it can react, a dozen greedy deer surround you and snatch the check out of your hand. You hastily retreat to the meadow before the deer can eat the rest of your money.\bN x!>u&>> [ E t JN Sy;You'd better not. You still need some money to get home.3> [ E  N 6zYou hold out the packet to the buck. Before it can react, the packet is snatched out of your hand by dozens of greedy mouths. Immediately, you regret the act.!>&e ~N o{3The bucks sniffs eagerly at the offering, and lets the book fall from its mouth. It greedily inhales the biscuit, and looks to you for another offering. Resignedly, you give the rest of the packet to the hungry buck. He looks at you with what could swear was gratitude and scampers off into the forest.N {!<& !>&!>&N {[>F& vN |The buck sniffs eagerly at your offering, and lets the book fall from its mouth. It takes the entire packet from you, with a look that you could swear was gratitude, and scampers off into the forest.!<&N %} !>&[>F&N i}!>&! WN }A\b\tA loose page falls out of the buck's mouth as he runs away.[>&aN .~UThe buck sniffs dubiously at your offering, then returns to attacking the textbook.UV'MO actorN }~(MO actorN ~>  )You don't have a camera!N ~SN /GYou could swear the darn thing smiles at you as you take his picture.fMOvdpiN >It just looks at you with a confused expression on its face.*MO actorN %MO actorN QThe buck spots you approaching and lowers his antlers menacingly. You wisely decide to give the animal some breathing space.MO actorN ^MO actorN mYou approach the buck to give him a shove, but he lowers his antlers menacingly at you, and you reconsider.mMO actorNk nMO actorN hkYou scream at the buck at the top of your lungs. It looks at you with a confused expression on its face. [06 page &&It's a soggy page from the textbook.   It's a rather long entry...\b\tAMATERASU-\b\tThe Japanese Shinto sun goddess, ruler of the plain of heaven, whose name means "she who shines in the heavens." She is the central figure in the Shinto pantheon and the Japanese Imperial family claims descent from her. When her brother, the storm god Susanowa, ravaged the earth she retreated to a cave because he was so noisy. She closed the cave with a large boulder. Her disappearance deprived the world of light and life. The other gods tried everything in their power to lure Amaterasu from the cave, with no success. \n\tFinally, it was Uzume who succeeded. The laughter of the gods when they watched her comical and obscene dances aroused Amaterasu's curiosity. When she emerged from her cave, she then saw her own brilliant reflection in a mirror which one of the gods had hung in a nearby tree. When she drew closer for a better look, the gods closed off the entrance to the cave behind her. She returned to the sky and brought light back to the world...\b\tThe rest of the page is eaten.K#MOactorioN| &&  textbook MMYou can't really tell what it is, since the buck is slobbering all over it.#kMOavipN| l) =N| 0The buck won't let you anywhere near the book.*"aMOavdpN ܂0The buck won't let you anywhere near the book.N '*MO actorNT 1cMO actorNx K>  Nx (You try to take the book away from the starving buck, but succeed only in tearing out one of the pages. The buck lowers his head angrily and points his antlers in your direction. You'd better not try that again.>&"Nx w<Nx 0The buck won't let you anywhere near the book. 0 ! ! K  raft BBIt's a flat, five-foot by four-foot raft, constructed of bamboo.0MO objN}  Dropped.& ##It's far too big to carry around.gMO actorN < "1N D"Sorry, you can't swim, remember?N i)MO actorNI FMO actorNm Okay, you're now in the raft.>&JMN < "MN I1You can't get out until you've landed the raft.N !N )JN  /0/0/0/MO actorN զ0MO actorN < "'N 3You're already afloat.`N N< ! CN v4There's no suitable place to launch the raft here. N >  LN Χ=You have to get in the raft first before you can launch it.N >  -N 0You don't have any leverage.jN WHUsing the walking stick for leverage, you push the raft into the pond.N < <&N Ш1MO actorNp Ө2?MO actorN < ! 8N $)There's no place to land the raft here.N P>  (N qYou're not in the raft.N < d )N You're not in the water.bN ש5You land the raft, and step out onto the shore.\b\tN < <&< >N ZAMN ]>  $You don't have any leverage.< R qN 9Using the stick for leverage, you pole the raft east.\bT<&\(>T\)N 7>T.N H< T qN 9Using the stick for leverage, you pole the raft east.\bV<&\(>V\)N ګ>VN < V eN 95You land the raft, and step out onto the shore.\b\tN G< <&< >4N (You need to get out of the raft first.BMN ¬>  $You don't have any leverage.< T qN Q9Using the stick for leverage, you pole the raft west.\bR<&\(>R\)N >R.N < V qN 9Using the stick for leverage, you pole the raft west.\bT<&\(>T\)N ?>TN O< R eN 5You land the raft, and step out onto the shore.\b\tN < <&< >4N (You need to get out of the raft first.MN &< R ?N n0There's nothing interesting in that direction.< T >N /There's nothing interesting in that direction|< V ?N 0There's nothing interesting in that direction.4N L(You need to get out of the raft first.DMN X< R !You can't swim, remember?< T *N You can't swim, remember?N< V *N You can't swim, remember?You can't go that way.C You can't go that way.MN < MN < UUUC meadow ##The meadow is just south of here. dB d trees ,,The trees here are mostly weeping willows.GMO actorN` (Nope. You can't climb the trees here.   & pond The pond's water is clear and still, with scattered flecks of green algae floating on it. The sunlight sparkles on the still waters like liquid gold.MO actorN ڑMO actorN >  :N A+You'll have to be a little more specific.(  1N "You'll have to be more specific.>6  1N Ԓ"You'll have to be more specific.>7  1N "You'll have to be more specific.s  1N `"You'll have to be more specific.63You don't have anything suitable to put water in.53MOactorioNv  WNv >Using the bird's nest, you scoop up a small amount of water.>4& UNv H3Using the bucket, you scoop up some of the water.Nv >4&V7 ONv ٔ6Using the can, you scoop up a small amount of water.7>4&6 WNv vHThat wouldn't be such a good idea. There's still kerosene in the can. Nv vUsing the bucket, you scoop up some of the water, which immediately trickles out through the huge crack in the side.Nv How!?MO actorN &MO actorN rYou lap up some of the water. Your thirst is quenched, but the swampy taste leaves you feeling a little queasy.MOactorioNj Ζ 8You fill the nest with water.Nj >4&| :Nj k!You fill the bucket with water.>4&: ZNj KYou attempt to fill the bucket with water, but it flows out of the crack.Nj 7 =Nj 4$You fill the empty can with water.7>4&6 XNj IThat wouldn't be such a great idea; there's still some kerosene inside.*Nj јYou can't put water in that.MO actorNM MOactordobjNq  8Nq LYou fill the nest with water.>4&N :Nq !You fill the bucket with water.>4&  ZNq 3KYou attempt to fill the bucket with water, but it flows out of the crack.7 =Nq r$You fill the empty can with water.7>4&e6 XNq IThat wouldn't be such a great idea; there's still some kerosene inside.)Nq MO actorN1 PSMOactordobjNU 1 ONU |8You dunk the kite in the pond, getting it soaking wet." NU ̛>0 8NU You fill the nest with water.>4&y :NU c!You fill the bucket with water.>4&7 ZNU KYou attempt to fill the bucket with water, but it flows out of the crack.7 =NU ;$You fill the empty can with water.7>4&6 XNU IThat wouldn't be such a great idea; there's still some kerosene inside.0NU ٝ$You wouldn't want that to get wet.MO actorN OMOactordobjN )You'd lose it for good if you did that!MO actorN' \OHMOactordobjNK w"The pond isn't frozen, you know.vMO actorN wgMO actorN "HYou can't swim, and you don't really feel like getting all wet anyway.EMO actorN* 7FdMOactordobjNN >It's waterproof, but that doesn't mean it'll stick to water!   0P bucket VV It's a big metal bucket, with chunks of dried cement stuck to the sides and bottom.MO actorNyLMO actorN(If you insist. You kick the bucket!!!MO actorNNMO actorN>" E > O NYou push the bucket over the edge of the platform, and it lands with a bone-jarring crash on the hard floor below. You realize with dismay that it's probably broken.\b\tFar away, you hear a mournful woman's voice cry out in anguish...!<&NN5>&>" E > O NqYou push the bucket over the edge of the platform. It lands quietly on the big pillow beneath the scaffolding.5<&N? VNT>" E > O 5N)Pushing the bucket doesn't do anything. MO actorNMO actorN> O S<SNp!>You pick up the bucket, and find it's surprisingly heavy (probably because of all that cement inside). The weight causes you to lose your balance, and you very nearly topple off of the scaffold. Sweating profusely, you drop the bucket back onto the platform and hold your arms out to both sides to steady yourself."<" NI"Summoning your courage, you make a second attempt to take the bucket. This time you're not quite as fortunate, although you do manage to get halfway back across the platform before you topple to a nasty death.N")3MO actorN,"4MOactordobjNP" ;NP#,Try "PUT YELLOW FISH IN BUCKET" instead... 9NPe#*Try "PUT BLUE FISH IN BUCKET" instead...G :NP#+Try "PUT GREEN FISH IN BUCKET" instead...)4MO actorND#PbMOactordobjNh# >  LNh{$=The bucket is only big enough to hold one fish at a time. k>  LNh$=The bucket is only big enough to hold one fish at a time. Nh %5You scoop up the small yellow fish with the bucket.>&CNhW%>  E >  Nh& As you remove the yellow fish from the pool, the green fish becomes agitated, turns, and begins swimming after the blue fish.CrNhQ& >  LNh&=The bucket is only big enough to hold one fish at a time. >  LNh '=The bucket is only big enough to hold one fish at a time. WNhN'-You scoop up the blue fish with the bucket.>&CNh'YNh' >  LNh(=The bucket is only big enough to hold one fish at a time. V>  LNhc(=The bucket is only big enough to hold one fish at a time. Nh(4You scoop up the large green fish with the bucket.>&>  E >  Nh{) As you remove the green fish from the pool, the blue fish becomes agitated, turns, and begins swimming after the yellow fish.CNh) 8!You fill the bucket with water.Nh*>4&ONhU*CPutting things in the bucket won't make them any easier to carry.#MOactorioN t*MO actorN *sMO actorN *TSorry to be a pain, but you have to remove things from the bucket one at a time... 0 broken bucket }}It's a big metal bucket, with chunks of dry cement stuck to the sides and bottom. There's a large crack in one side of it.MO actorN/PHMOactordobjN/ N\0You try to scoop up the fish with the bucket, but the water pours out the huge crack in the side and the fish flops back out into the pool. N0You try to scoop up the fish with the bucket, but the water pours out the huge crack in the side and the fish flops back out into the pool. N1You try to scoop up the fish with the bucket, but the water pours out the huge crack in the side and the fish flops back out into the pool. iN+2]You try to scoop up the water with the bucket, but it pours out the huge crack in the side.4 lNy2]You try to scoop up the water with the bucket, but it pours out the huge crack in the side.]N 3QPutting things in the broken bucket really won't make them any easier to carry.#MOactorioN#"3~ @@It's no use. The bucket is broken beyond all hopes of repair. ^ D^ d^ R TMO actorN! Z%MO actorNE v T WNE ƠHThere's a shiny object on the floor of the pond, about five feet deep.)%&%  C T shiny object DDIt's hard to tell from here, but it looks like it might be a coin.MO actorN >  .N ?You can't reach it from here.m ! :N +You'll have to be a little more specific.)&Could you be a little more specific?5QMOactorioNG ͹ E > ! WNG HYou push the object around with the stick but don't make any progress.NG h E > ! NG WUsing the stick with the gum attached to it, you manage to retrieve the shiny object.NG  >{&!>&!&NG ENG THow?! 56=5>6^ V^ XB birds and frogs ``You can't really see them, but their twilight music lends an air of peacefulness to the scene. df%%%& shore ##The ground is wet and muddy here.=#MOactorioNO >PMOactorioNx  >0Nx ` Pointless.MO actorN q(MO actorN >0 d$  & reeds ^^The thick clusters of tall reeds hug the shoreline, providing shelter for countless insects. d%*MO actorN <N You push the reeds aside to find a small raft floating in the shallow water! Carefully, you reach in and drag it onto the shore. N :"4d>&N k"N 0N $There's nothing else in the reeds.N  % <<You think you see something in there, but you're not sure.vMO actorN *wRMO actorN8 E3You really don't feel like getting your feet wet.B  insects HHThey're what you'd find in any pond - gnats, mosquitoes, and the like. nnn& reeds ==The thick, tall reeds enclose you on all sides except east. R^&  wad of chewed gum SSIt's a wad of sticky gum. It's currently stuck to the end of your walking stick.MO actorN g.HIt takes some effort, but you manage to peel the gum off of the stick.!>&>+&N .!+aaaC light 00You can't really tell what it is from up here. L&  footbridge __You stare at the bridge, admiring the craftsmanship of the artisans who built it so long ago. T.=> UUAn enormous, two-and-a-half foot catfish is swimming around just below the surface. rrIt's the biggest catfish you've ever seen, with long whiskers and a fat, reddish-colored, powerful-looking body.  catfish VT Uh, it's a fish.EMOvdpiN ȾWhat have you been smoking?*MO actorNf (AMO actorN $"You'll have to catch it first...[MO actorN ^\rMO actorN ƿSIt turns into a beautiful princess and grants you three wishes!! Just kidding...+MO actorNm ,jMO actorN KKYee-haw, Jethro!! Let's get a six-pack of Miller and fuck some catfish!!'MO actorN d(MO actorN% >  )N% You don't have a camera!uN% iThe catfish seems camera shy... He vanishes beneath the surface every time to try to take his picture.f%%%& shore ##The ground is wet and muddy here.=#MOactorioNO >PMOactorioNx  >0Nx  Pointless.MO actorN (MO actorN 0>0 X&P pit hhIt's a small hole dug into the ground, encircled by rocks. It's full of ashes from a recent campfire. XpppB X rocks They're just rocks.MMO actorNO N   0  pile of ashes They're just ashes.%MO actorNQ \<NQ You rummage through the ashes and find a small can of kerosene. What a bunch of litterbugs! The campers must have been American tourists...>6&NQ 9"/,You don't find anything else in the ashes.GMO actorN_ (What do you need a bunch of ashes for?NMO actorN /If you want to search the ashes, just say so. %0 ringcMN KIt's a tiny, bright crimson ring with a picture of a hare engraved on it."4MO actorN _@MO actorN You're not holding it.N MO actorN <4+N >Have you looked at it yet?)N gIt's just a red hare-ring!!N  U  bronze key VVIt's a big, ornate key made of bronze. It probably unlocks something. Like a gate. B woods --The woods are very thick in all directions.IMO actorN_ P*No, you can't climb these trees, either. XUUUC meadow ##The meadow is just north of here. KFB trees ZZThe trees, mostly colorful dogwoods, are arranged around the giant oak in circular rows. KMO actorN KMO actorN ,The dogwoods aren't suitable for climbing.ttt&  oak tree This tree has probably been around for hundreds of years. Its trunk is over ten feet in circumference, and even when you crane your neck you can't see the top of it. You feel small and insignificant next to this miracle of nature. KMO actorN .MO actorNC >  QNC >You can't climb the oak with that big stick in your hands.\b!NC eOn an impulse, you grab a low hanging branch. Feeling like a twelve year old climbing into a treehouse, you pull yourself up...\bNC NC JNC RRR& oak CCIt's just like the rest of the tree, only higher from the ground. JMO actorNu MO actorN zMuscles straining, you pull yourself even higher into the tree. You're really getting too old for this sort of thing.\bN :IN Y|||B leaves and branches 77They're very thick. And no, there's nothing in them. Ih& trunk --There's something carved in the trunk here. IMO actorNa qMO actorN l>Ever so carefully, you make your way higher into the tree.\bHN DDD&  carving The carving looks very old, perhaps nearly as old as the tree itself. Even so, it's still in good condition- It's a surprisingly detailed portrait of a beautiful young woman. You get a strange feeling of deja vu looking at the portrait, and feel a curious pang of loss. BBB&  portrait Whoever carved this portrait evidently had a great deal of love for his subject. The young woman has a winsome smile on her face and exquisitely delicate features. The detail is extraordinary, from the tiny flower in her hair to the stringed instrument in her hands. & carving of a flower You peer closely at the portrait. The flower looks like it might be an orchid of some sort. The detail certainly is incredible, you think. B& carving of a biwa You peer closely at the portrait. The instrument she's playing appears to be a four-string traditional Japanese guitar called a biwa. Amazingly, even the fretboard is rendered in sharp detail. n...& carving of the fretboard Squinting your eyes, you peer even more closely at the portrait. You're no guitarist, but it looks as if the woman is pressing down on the middle of the fretboard while plucking the third string. What amazing skill the carver had! 0C kite aaIt's a huge orange and white cloth kite, shaped like a carp, tangled in the branches above you. h'''B view From up here, you really get a sense of the harmony that the gardens possess. It looks almost like a mosaic. Inside the palace walls there appears to be some construction in progress, but you can't really make out any of the details from here. H&& oak ,,The branches up here are dangerously thin.MO actorNV TMO actorNz You start up a nearby branch, but it dips violently beneath your weight. Heart pounding in your chest, you return to your original location.\b-MO actorN0 .uMO actorNT VYou can't shake the whole tree, but you might be able to shake some of the branches. Hl+ + +&  branchesMN > H TN 7EThe kite is deeply entangled in the thick branches above your head.1N [%There's nothing special about them.N -MO actorN .HMO actorN > H N You grab hold of a nearby branch and shake it violently. After a few moments, you manage to work the kite free. You watch with satisfaction as it flutters to the earth below.!>&K>& <N 0Shaking the branches doesn't do anything else.N + 22The branches resist your attempts to break them. MO actorN kMO actorN CYou move the branches around a little. Nothing exciting happens.N  H& walls TTThe north, south, and east walls are covered with paintings from floor to ceiling. MMO actorN \xxxC steps AAThe steps wind up the hillside to the north like a stone snake. L&' bridge You stare at the bridge, admiring the craftsmanship of the artisans who built it so long ago. It would be a nice spot for a first kiss, you think idly. LC pondMN g6You gaze down at your reflection in the clear water.> T SN G\b\tA brief flash of light catches your eye from beneath the surface. LcccC  footbridge --The footbridge lies below you to the south. `,&  statues You recognize the statues as being "Koma-inu", or Korean Dogs, which are dog-like, mythical creatures that supposedly ward off evil spirits. `MMO actorN &' steps >>The steps are worn down in the middle from centuries of use. `MMO actorNz lllC gate <<From here, it almost looks like some sort of magic portal. `cccB  hillside //It's very steep, and covered with lush grass. `kkkB grass ::The rugged mountain grass whispers softly in the breeze. `vvv& statue  It's seven feet tall and quite fierce-looking, and it's carrying a big axe. You're thankful that it's only a statue, and that there's no chance of it suddenly coming to life and attacking you.\b\tIt looks a little familiar, as well. Maybe you've met this fellow in another lifetime... MMO actorNU    => >>The stone warrior is here, brandishing a wicked-looking axe.  warrior llIt's seven feet tall and quite fierce-looking. You get the distinct impression that it wants to kill you. MO actorN  CMO actorN >x  )N CYou don't have a weapon!N \tWith a cry of rage, you plunge the katana into the warrior's stone heart. He emits a brief wail of despair and collapses into a pile of rubble.!<&!N &"x"xN d  C#MOactorioNK MOactorioNt x  < |Nt 8pYour stupid choice of weapon only seems to enrage the warrior. He swings at you, barely missing with the axe.MN  #MOactorioNG ZMOactorioNp 6This is hardly the time to strike up a conversation!#MOactorioN ZMOactorioN |6This is hardly the time to strike up a conversation!VOMOactordobjNY )It doesn't want anything but your head.MO actorN KMOactordobjN %You'd really better start fighting.^MOvdpiN#  6This is hardly the time to strike up a conversation!*'MO actorN (MO actorN >  )You don't have a camera!N !N m"\b\tThe mammoth warrior watches incredulously as you put down your sword and take out your digital camera. He studies the strange device in your hands for a moment, decides that it's not a weapon, and neatly severs your windpipe with a swift blow of his axe. Your head flies right in front of the camera lens as your still-twitching finger presses the button. It should make a great picture!![MO actorN "\MO actorN #w\b\tYou plant a kiss on the warrior's cheek. He returns the friendly gesture by burying his axe blade in your skull.+MO actorNd ]#,MO actorN $\b\tOkaaaay... In a mad lapse of sanity, you attempt to mount the giant warrior. He stares at you in utter disbelief for a moment before eviscerating you with his axe.T 66This is hardly the time to strike up a conversation!  &  gateMN HSThe gate, which is over ten feet tall, is cast from two massive pieces of bronze.<"  It's currently open.MO actorN *MO actorN  Hopeless. MO actorN   aMO actorN1 6BYou pound on the unyielding bronze with your fists, to no avail.iMO actorN HjsMO actorN c<" 7N (The gate's too heavy for you to close.It's already closed!fMO actorN5 h6MO actorNY > ! _NY DP\b\tThe armored warrior tries to chop your hand off as you reach for the gate.<" MNY >It seems to be locked. There's a small keyhole at eye level.UNY CMuscles straining, you slowly manage to push the heavy gate open."NY J!MO actorN M"ZMO actorN j2You pound on the heavy gate, but no one answers.N oMO actorN pMO actorN= >  N= gtYou put the key in the keyhole and turn it, and are rewarded by the sound of ancient tumblers clicking into place."> ! N= I\b\t...Suddenly, you hear a harsh grating noise. To your amazement, the giant warrior statue steps towards you, raising its wicked-looking axe high above its head. >x  N= \b\tPanicked, you turn to flee, but the stone warrior is too fast for you. "Kaneiji..." is the last word you hear before your severed head tumbles down the palace steps.N= 2N= _M\n\tIt starts to swing, but then abruptly hesitates, eyeing the katana in your hands. "Kaneiji," it hisses in a demonic voice. The stone warrior approaches you warily, slowly swinging the axe in low, sweeping arcs. The sword glows in your hand, and you suddenly feel a surge of power, as if a warrior spirit has possessed you...!>&N= >&N= &"4N= (Unfortunately, you don't have the key.s#MOactorioNE =t^MOactorioNn a  <p(Nn That doesn't fit the lock.oooC steps 88The steps snake south down the hill to the footbridge. L   B  watchtowers zzThey're nondescript towers which sit at the corners of the palace's octagonal outer wall. There's one at each junction. MO actorN 1 *MO actorN L  Hopeless.ZZZ&6 sign TTIt's just a plain wooden sign. There's writing on it in both Japanese and English. MO actorN W 'MO actorN "Shinobu Palace is closed for the renovations. Sorry for inconvenience."\b\tWell, that explains the lack of tourists, at least.N & axe aaYou're no expert on weapons, but you guess it could easily sever your head with one swift blow. l, , ,&  keyhole RRIt's a large, dark keyhole. You see nothing but darkness when you peer into it.MO actorN -PgMOactordobjN H  Why?0N $How about "UNLOCK GATE" instead...MO actorN &>MO actorN5 You see nothing but darkness.MO actorNy %MO actorN oeYou don't find anything in the keyhole except dust. And no, you can't play around with the dust... @@@&  darkness  It's dark. YYYB dust ))Yep, there's some dust here, alright... & axe aaYou're no expert on weapons, but you guess it could easily sever your head with one swift blow. B rubble AAIt's a small pile of rubble, left behind by the fallen warrior. MMO actorNt &l+ + +& @ gateoMO actorN- &p ..There's no keyhole on this side of the gate.kompfMO actorN 'hMO actorN 1'>" !The gate is already open!`N 'TThe fierce wind has blown it shut, and there's no way to unlock it from this side.iMO actorNe 'jMO actorN '>" XN B(IYou attempt to close the massive gate, but it's much too heavy for you."N (It's already closed!  & sand 77The sand is immaculately raked in beautiful patterns.#MOavipNb ~) mNb ` You decide to leave the sand alone here. You don't want to disturb the beauty of the garden.*Nb "MOavdpN  p_You decide to leave the sand alone here. You don't want to disturb the beauty of the garden.*'MO actorN ( ""You take a snapshot of the sand.EMO actorN F@MOactordobjN  It won't stick to SAND!!MO actorNO P(SMO actorNs i4You need grains in your diet, but not THAT kind...    & fire ''It's a small flame, burning brightly.#tMOavipNR 0) =NR a0It's a small fire, but still too hot to touch.*NR IMO actorN JMOactordobjN u xN HYou touch the check to the fire, and it immediately bursts into flame."uN ZCuB~ KN <It's still way too soggy to catch fire. Nice try, though.t VN GYou still need some money to get home. You shouldn't burn all of it. N You put the end of the stick in the flames, but it won't catch fire. It must have been treated with something. Nice try, though.N  lN 6]For some reason, the nest won't light. There must be too much mud in it. Nice try, though.y aN AWhoosh!! The page goes up in smoke. Hope you read it already...N !>&F oN `For some reason, it won't catch fire. Must be too much buck slobber on it. Nice try, though.N _ nN _If you set that on fire, you'd probably end up burning down half the park. Nice try, though.N 6 N tYou toss the can onto the fire. BOOM!!!! It explodes, and you dive to the ground to avoid the flying metal shards. Wow, that was fun! Too bad you just made the game unwinnable...N !>6&1N %You don't want to set that on fire.IPJIOJ'MO actorN , ( ""You take a snapshot of the fire.UaMO actorNG <It takes a few puffs, but you manage to blow out the fire.!<&A7MOactorioN 5 _N @ 9You pour the sand on the fire, smothering it instantly.N i !<&!>5&N 4 bN <You pour some water on the fire, putting it out instantly.N !<&!>4&3N 2 'You wouldn't want that to get burned.N \ EMO actorN _ F6MOactordobjN | Are you crazy?MO actorNK 0MOactordobjNo 4 bNo  <You pour some water on the fire, putting it out instantly.!<&No U !>4&No s 5 VNo 9You pour the sand on the fire, smothering it instantly.!<&!>5&<6 No You pour the kerosene on the flame. WHOOMF!! An impressive ball of fire shoots into the air, and the accompanying blast of heat forces you to back away for a few seconds. What fun!! Too bad you just made the game unwinnable...!>6&No >7&"No 5You can't pour that.MO actorN U(9MO actorN nThis isn't the circus...TSSS&  hot embers ((It's a glowing pile of red-hot embers.#_MOavipNY P) (NY They're too hot to touch.*NY MO actorN PMMOactordobjN 'You wouldn't want that to get burned.MO actorN5 OMMOactordobjNY )'You wouldn't want that to get burned.A %%Why bother? The fire's already out.MO actorN MOactordobjN 6 SN #DIf you want the fire back, just BLOW ON the embers, or STOKE them.1N m%Why bother? The fire's already out.N }UMO actorN V The fire's already out!'MO actorN ( $$You take a snapshot of the embers. ___B algae .. It's just algae. Nothing special about it. ^ ^^ m^ g^ e^ i^ ot$$$ U|MO actorN! 0You take a deep breath and blow out the flame.!<&y&"yN! l&OMO actorN +MOactordobjN 5 iN 9You pour the sand on the fire, smothering it instantly.!<&!>5&N e>&6 N |You pour the kerosene on the flame. WHOOMF!! An impressive ball of fire shoots into the air, and the accompanying blast of heat forces you to back away for a few seconds. What fun!! Too bad you just made the game unwinnable...!>6&N >7&}N 4 jN =The water cascades onto the fire, putting it out instantly.!<&N 1>&!>4&AMOactorioN j5 iN 9You pour the sand on the fire, smothering it instantly.N !<&!>5&>&~N 14 kN M>You pour some water onto the fire, putting it out instantly.N !<&!>4&>&N && statueWMN BThis onyx statue depicts a fearsome demon wearing leopard skins and carrying a large bag over its shoulder. There is some writing along the base of the statue.>  DN &C8\b\tThere's a fire blazing at the foot of the statue.>  IN nC=\b\tThere's a pile of hot embers at the foot of the statue. gMMO actorN C&  air symbol, an air symbol //It's the Kanji character that represents air. ##Touching the symbol does nothing. "WMO actorN =uYou patiently blow on the hot embers. After a few minutes, you manage to stoke the hot coals into a roaring flame.N !<&>&>&N  U U U& o doorMN < ! ON ٙCIt's a solid slab of granite that fills the entrance to the tomb.N >z  HN C<\n\tThere's a Kanji symbol for fire carved in the granite.N X>  GN ;\n\tThere's a Kanji symbol for air carved in the granite.N >  IN =\n\tThere's a Kanji symbol for water carved in the granite.N #>  IN m=\n\tThere's a Kanji symbol for earth carved in the granite.fMO actorN hJMO actorN' ƛ+There's no apparent way to open the door. MO actorNw  `MO actorN sAYou pound on the unyielding stone with your fists, to no avail.!MO actorN "-MO actorN% No response.z--- OU`MO actorN1 o0You take a deep breath and blow out the flame.!<&&A+MOactorioN 5 iN 9You pour the sand on the fire, smothering it instantly.N %!<&!>5&>&N t4 N =The water cascades onto the fire, putting it out instantly.N !<&y&"yN !>4&>&MO actorN W>MOactordobjN s5 iN 9You pour the sand on the fire, smothering it instantly.!<&!>5&N >&6 N *You pour the kerosene on the flame. WHOOMF!! An impressive ball of fire shoots into the air, and the accompanying blast of heat forces you to back away for a few seconds. What fun!! Too bad you just made the game unwinnable...!>6&N Q>7&N h4 }N =The water cascades onto the fire, putting it out instantly.!<&N >&!>4&N y>&& statue*MN dHtIt's a beautifully carved jade statue of a coiled dragon rising out of the waves. There's writing along the base.>  DN H8\b\tThere is a fire blazing at the foot of the statue.>  JN I>\b\tThere is a pile of hot embers at the foot of the statue. eMMO actorN_ hI"WMO actorN uYou patiently blow on the hot embers. After a few minutes, you manage to stoke the hot coals into a roaring flame.N !<&>&>&N /  & water symbol ""It's the Kanji symbol for water. ##Touching the symbol does nothing. WWW OU`MO actorN1 0You take a deep breath and blow out the flame.!<&&A8MOactorioN !4 uN E!<You pour some water on the fire, putting it out instantly.N !!<&!>4&>N !N !5 N !FThe sand trickles out of your hand onto the flame, extinguishing it.N ?"!<&!>5&y&N ">&MO actorN "[MOactordobjN "4 lN #<You pour some water on the fire, putting it out instantly.!<&N T#!>4&>&N #6 N r$You pour the kerosene on the flame. WHOOMF!! An impressive ball of fire shoots into the air, and the accompanying blast of heat forces you to back away for a few seconds. What fun!! Too bad you just made the game unwinnable...N $!>6&>7&N $5 N %FThe sand trickles out of your hand onto the flame, extinguishing it.!<&>&N ]%y>&"y!>5&N %& statue/MN pX{This statue, carved from sandstone, depicts a fat, bald man sitting on a mountain. There is some writing along its base.>  CN X7\b\tThere's a fire blazing at the foot of the statue.>  IN DY=\b\tThere's a pile of hot embers at the foot of the statue. kMMO actorNd Y"WMO actorN &uYou patiently blow on the hot embers. After a few minutes, you manage to stoke the hot coals into a roaring flame.N T&!<&>&>&N & & earth symbol, an earth symbol ""It's the Kanji symbol for earth. ##Touching the symbol does nothing.  " WMO actorN ,uYou patiently blow on the hot embers. After a few minutes, you manage to stoke the hot coals into a roaring flame.N -!<&w>x&y>z&N h-  & garden The rock garden is roughly circular in shape and about sixty feet in diameter. It seems to be divided into equal quadrants of differently colored sand. ^ C island MMIt's a ten-foot by ten-foot chunk of flat rock in the center of the garden. ^ B  flagstones ::They're worn perfectly smooth by centuries of footfalls.MMO actorNq 1 ^  ^^  m^  g^  e^  i^  k^  oeeeC  building 11It's hard to tell exactly what it is from here. m& island MMIt's a ten-foot by ten-foot chunk of flat rock in the center of the garden. mMMO actorN 8&6  writing ||You can't decipher the Kanji characters, but a small plaque in English says that this is a statue of the Shinto god Fujin.MO actorN D'MO actorN EE|You can't decipher the Kanji characters, but a small plaque in English says that this is a statue of the Shinto god Fujin.N |E uuu&6  writing wwYou can't decipher the characters, but a small plaque in English says that this is a statue of the dragon god Ryujin.MO actorN lJ'MO actorN JwYou can't decipher the characters, but a small plaque in English says that this is a statue of the dragon god Ryujin.N K QQQ&6  writing eeYou can't read the Kanji, but a small plaque in English says that this is a statue of the god Fudo.MO actorN nP'MO actorN PeYou can't read the Kanji, but a small plaque in English says that this is a statue of the god Fudo.N Q wW W W&  dirty sand KKIt certainly doesn't have the aesthetic appeal of the rest of the garden.MO actorN| Vd%ZMO actorN d;You search the sand for a while, but don't find anything.MO actorN dMO actorN$ d>5  RN$ e'You scoop up a small handful of sand.N$ De>5&N$ ^e<N$ ge0You've already got all the sand you can carry.N$ e kEMO actorN eF@MOactordobjN eIt won't stick to SAND!!{{{&6  writing zzYou can't read the Japanese writing, but a small plaque in English says that this is a statue of the Shinto god Onamuji.MO actorN f'MO actorN YgzYou can't read the Japanese writing, but a small plaque in English says that this is a statue of the Shinto god Onamuji.N g kkk& o tombMN dpmIt's an unremarkable, slate-gray building, about the size of a tool shed, with a slanting pagoda-style roof> ! /N p# and a thick door made of graniteN qV. Despite its mundane appearance, you're feeling an irresistable urge to go inside.'MO actorNJ 8q(MO actorNn qYou take a snapshot of the building, but it doesn't leave you feeling satisfied. You can't leave this place until you find out what's inside.!MN q!>&!yMMO actorNJ   N You attempt to clean the grime with your bare hands but only succeed in getting yourself dirty. If only you had a rag of some sort...7N - +You'll have to be a little more specific.'MOactorioN} <  ;N} ,You've obviously never done any housework.`>rN}  _You scrub the walls valiantly with the dry cloth, but the stubborn grime refuses to come off.!N} Using the wet kite as a washcloth, you carefully begin scrubbing the grime from the walls. After several minutes of back- breaking effort, you manage to clear enough of the dust off to reveal the paintings beneath. !>&!#&N} I?>&?$&?%&N} ?&&?'& MMO actorN  kkk$ Burial chamber 11\b\tYou have arrived a in a long, low-ceilinged chamber far beneath the earth. A feeling of intense claustrophobia overtakes you momentarily, but your curiosity eventually wins out. Not that there's much to see here; the chamber is barren save for a white marble sarcophagus in the center of the room.C?!H& stepsMN 3>ZN KOn closer inspection, it looks like the steps have some carvings on them.AN 5The stairs are awash in an otherworldly amber glow. ?MMO actorN "& !  darkness QQIt's a thick, almost tangible blackness that covers the stairway like a shroud.#|;;;&  outlines eeThere appears to be some paintings on the walls, but the dust is too thick to make out any details.MO actorN rMO actorN cSYou'll have to clean the dust off before you can get to the paintings underneath. ?$J   &  north wall On this wall, a wild-looking, bearded figure in blue and green garments is painted, surrounded by thundering storm clouds. He holds a mirror in his hands.\b\tThe portrait is incredibly lifelike, so much so that you feel an overwhelming urge to reach out and touch it. MO actorNE zMO actorNi ( ! MNi >You touch the painting again, but nothing happens this time.Ni You feel a strange sensation as you touch the portrait, as if a part of you were leaving your body and stepping into the painting itself. Suddenly, as if in a dream, you find yourself...\b>@ANi >= ! Ni 5>(&MMO actorN Q% &  south wall This wall serves as a canvas for a portrait of a laughing, dancing woman, with snow-white robes whirling around her.\b\tThe portrait is incredibly lifelike, so much so that you feel an overwhelming urge to reach out and touch it. MO actorN 9vMO actorNB :>>e NB :You feel a strange sensation as you touch the portrait, as if a part of you were leaving your body and stepping into the painting itself. Suddenly, as if in a dream, you find yourself...\b>@ANB 0;>2 6  >2&JNB ;>You touch the painting again, but nothing happens this time.MMO actorN ;&&  east wall This wall is covered by an enormous painting of a beautiful woman in a flowing red and orange kimono, standing in front of the sun.\b\tThe portrait is incredibly lifelike, so much so that you feel an overwhelming urge to reach out and touch it. MO actorN, UWFMO actorNP pW>NP TXYou feel a strange sensation as you touch the portrait, as if a part of you were leaving your body and stepping into the painting itself. Suddenly, as if in a dream, you find yourself...\b>@A?NP X3You touch the painting, but nothing else happens.MMO actorN X'&  west wall <<The open tomb door takes up the majority of the west wall. MMO actorNr !e(A A A0 mirror CCIt's a beautiful mirror, about two feet long, framed with jewels.a#MOactorioNp !MO actorN 3!&uMO actorN !VYour crazed, bearded visage snarls back at you. No wonder your sister is so afraid.MO actorN8 !MO actorN\ t"You draw back your fist to smash the mirror, then decide against it. After all, it was senseless acts of destruction like this that caused this situation in the first place. *MO actorN9 "MO actorN] "< * N] n#You stride towards Uzume to snatch the mirror, but a host of angry gods stops you. "You've angered enough goddesses for one day, Susanowa," one of them says.)N] #)$*F= UzumeMN n+DThe goddess of happiness is resplendent in a flowing white kimono.>( * HN +<\b\tShe is admiring herself in a beautiful jeweled mirror.>>e! GN ,;\b\tShe appears to be engaged in a fluid, hypnotic dance.>MN :,>>e! SN ,DThe goddess of happiness, Uzume, is dancing a short distance away.QN ,EThe goddess of happiness, Uzume, is standing a short distance away.#MOavipN -) bN Q-UThe other gods won't let you anywhere near her. You've already done enough damage.*"}MOavdpN} -UThe other gods won't let you anywhere near her. You've already done enough damage.* +QQQB robes They're just your robes. ,hhhB beard 77You've never been all that keen on personal grooming. -(& cave It's a small opening, set into the mountainside. The entrance is blocked by a giant boulder. You can see light flickering around the edges of the big rock. .& light TTIt hurts to look at it. It's as if the sun itself was trapped behind the boulder. -/r222&  boulder FFIt's an enormous chunk of rock which fills the entrance to the cave. MO actorNt MO actorN SYou push and pull with all your strength, but are unable to budge the massive rock. Clearly, there must be some magic holding it in place.    MO actorNz  MO actorN >You rage and pound against the boulder, with no effect. It suddenly occurs to you that this might be the very reason that your sister's in hiding.MO actorNX ]MO actorN| You kick at the stone with all your might, to no avail. It occurs to you that this might be the very reason that your sister's in hiding. -0& jewels NNThey're beautiful gems in a variety of shapes and sizes, set into the frame. (1& jewels NNThey're beautiful gems in a variety of shapes and sizes, set into the frame. 22  0 mirror CCIt's a beautiful mirror, about two feet long, framed with jewels.a#MOactorioNp KDMO actorN kD&TMO actorN D5Your beautiful, radiant features smile back at you.MO actorN DCMO actorN; D$You wouldn't dare! It's gorgeous! 3  & tree AAIt's a beautiful sakaki tree, with lots of long, thin branches. MO actorNt u$aMO actorN $BIt's a young tree, and it probably wouldn't support your weight._MO actorN $`MOactordobjN# %( ]N# ^&+You muscle your way through the crowd and hang the mirror on a low branch, facing the cave entrance. As you do so, you feel a strange sensation overtake your body, as if a part of you were being transported to another place and time. Suddenly, as if emerging from a dream, you find yourself...\b?>!>(&@AN# &MO actorN &PMOactordobjN &( `N (+You muscle your way through the crowd and hang the mirror on a low branch, facing the cave entrance. As you do so, you feel a strange sensation overtake your body, as if a part of you were being transported to another place and time. Suddenly, as if emerging from a dream, you find yourself...\b?>N V(!>(&@A-N (!You can't put that in the tree.N (MO actorN (OMOactordobjN (( `N )*+You muscle your way through the crowd and hang the mirror on a low branch, facing the cave entrance. As you do so, you feel a strange sensation overtake your body, as if a part of you were being transported to another place and time. Suddenly, as if emerging from a dream, you find yourself...\b?>!>(&@AN v*-N *!You can't put that on the tree.N *4   =>cMN 2.>>e  {.LThere are dozens of gods and goddesses here, dancing and singing joyously.N .nThere are dozens of gods and goddesses here, of all shapes and sizes, talking animatedly amongst themselves.KAN :/N /t\b\tThe god of rivers walks by, shaking his head despondently. "It's no use," he sighs. "She's never coming out!" N /N /N 0\b\tThe one-eyed god of smiths points at the dark skies and shakes his fist at you in anger. "This is your fault!" he growls.N S07N [0N 0s\b\tA young thunder god strolls past, pounding on a kettle drum. "Come out of there!" he shouts towards the cave.N 0N 0N +1x\b\tThe goddess of the moon approaches the cave. "Come now, sister," she implores, "you can't stay in there forever!" N l1N t1N 1L\b\tThe Blue Dragon of the East attempts to move the boulder, to no avail.N 1N 1N 2[\b\tA half dozen gods of war attack the boulder with their swords, accomplishing nothing.N <2)Oqj MO actorN C2 |MO actorN 2]You'd certainly like to kill all of them, but you have a more pressing issue at the moment.MO actorN( 2}MO actorNL =3^You'd sure love to kick some heads in right now, but that won't solve the immediate problem.MO actorN j3MO actorN 4Although they're speaking an ancient dialect of Japanese, you can understand every word. Mostly, they're saying bad things about you.#MOactorioN /4mMOactorioN 4INone of the gods or goddesses seem to be interested in speaking to YOU.#MOactorioN< 4\MOactorioNe -58They don't want to listen to anything YOU have to say.MO actorN :5bMOactordobjN 5<They don't want to look at anything YOU have to show them.UMO actorNS 5VSMOactordobjNw 5-They don't want anything YOU have to offer.  gods and goddessesMN l6>>e 7N 6(They're dancing and laughing joyfully.oN 6cThey seem quite agitated. Every so often, one of them casts a withering glare in your direction.5C sky aaThe sky is pitch black. The only light here is the flickering illumination cast from the cave. 6V$7\\\B kimono **It's a beautiful snow-white silk kimono. 8C sky aaThe sky is pitch black. The only light here is the flickering illumination cast from the cave. 9& cave It's a small opening, set into the mountainside. The entrance is blocked by a giant boulder. You can see light flickering around the edges of the big rock. :& light TTIt hurts to look at it. It's as if the sun itself was trapped behind the boulder. 9;  &  boulder FFIt's an enormous chunk of rock which fills the entrance to the cave. MO actorNt BMO actorN vCYou push and pull with all your strength, but are unable to budge the massive rock. Clearly, there must be some magic holding it in place.    9<\  & treeMN IAIt's a beautiful sakaki tree, with lots of long, thin branches.N KJ>( ! AN J5There's a beautiful mirror hanging in the branches. MO actorN JEMO actorN K&You're not close enough to the tree._MO actorNH BK`MOactordobjNl ^K2 l KOYou attempt to hang the mirror on the tree, but you can't get past the crowd.MO actorN KPMOactordobjN L2 ^N VLOYou attempt to hang the mirror on the tree, but you can't get past the crowd.VN LJYou couldn't put that in the tree, even if you could get past the crowd.N LMO actorN  LOMOactordobjN0 M2 ^N0 QMOYou attempt to hang the mirror on the tree, but you can't get past the crowd.VN0 MJYou couldn't put that on the tree, even if you could get past the crowd.N0 M=III=>MN =NnThere are dozens of gods and goddesses here, of all shapes and sizes, talking animatedly amongst themselves.KFN NN Nt\b\tThe god of rivers walks by, shaking his head despondently. "It's no use," he sighs. "She's never coming out!" N ON ON WO\b\tThe one-eyed god of smiths points at the dark skies and shakes his fist at Susanowa in anger. "This is your fault!" he growls.N O7N ON Os\b\tA young thunder god strolls past, pounding on a kettle drum. "Come out of there!" he shouts towards the cave.N ,PN 4PN {Px\b\tThe goddess of the moon approaches the cave. "Come now, sister," she implores, "you can't stay in there forever!" N PN PN QL\b\tThe Blue Dragon of the East attempts to move the boulder, to no avail.N QN $QN jQ[\b\tA half dozen gods of war attack the boulder with their swords, accomplishing nothing.N Q)Jqj MO actorN Q AMO actorN: Q"You're not that kind of goddess.MO actorN QAMO actorN R"You're not that kind of goddess.MO actorN ?RMO actorN RAlthough they're speaking an ancient dialect of Japanese, you can understand every word. Mostly, they're saying bad things about Susanowa.#MOactorioN SNMOactorioN +S*They're not paying any attention to you.#MOactorioN? vSMMOactorioNh S)They're not paying any attention to youMO actorN SPMOactordobjN T*They're not paying any attention to you.UMO actorN5 KTVPMOactordobjNY gT*They're not paying any attention to you.  gods and goddesses iiThey seem quite agitated. Every so often, one of them casts a withering glare in Susanowa's direction.>&  cave OOIt's a little cramped, but it's a good place to hide from your crazy brother.?@ @ @&   boulder AAIt's the huge boulder you used to block the cave entrance with. MO actorNw \rMO actorN \>>e N ^Curious, you push the boulder aside a little to see what is going on. To your surprise, all of the gods and goddesses are engaged in a festive dance outside the cave. You feel an almost irresistable urge to join them, but you see your horrible brother outside and decide not to.>( ! N bj.....\b\t....but then your brother does a strange thing. He puts something in the sakaki tree outside the entrance. When you look at it, a beautiful, shining goddess returns your stare. Unable to resist, you find yourself drawn to the enchanting image before you. Slowly, you move the boulder all the way to one side and exit the cave.\b\tThe gods and goddesses rejoice as they see you, and let up a great cheer. The dark skies are brightened as your radiance once again fills the heavens. As you approach the sakaki tree, your brother Susanowa drops to one knee and bows his head. "I am sorry, my sister," he says humbly. "I will trouble you no more. Please accept this magical mirror as a humble token of my sincerity." Magic mirror?, you think, confused. You hear the sound of stone moving and you turn to see that the other gods have blocked off your retreat. Your anger is rekindled as you realize that you have been tricked...\b\tA strange sensation overtakes your body, as if a part of you is being transported to another place and time. As if emerging from a dream, you suddenly awaken to find yourself...\b\t?>N b"!>"&  N *c@AWN RcKWhat for? Your horrible brother is surely still out there, sowing chaos.N c   /@eeeB kimono 33If your anger were a color, it would be this one. Arrr&>6  sarcophagusMN gIt's a simple, but elegant rectangular sarcophagus made of white marble. There are spidery Kanji characters covering the surface of the lid<" 9*, which is currently pushed to one side.N ;h.  fMO actorN$ ^hhMO actorNH xh<NH [iThe lid is solid marble, and must weigh several hundred pounds, yet somehow you manage to lift it a few inches. You silently pray to your ancestors for forgiveness as you shove the heavy lid to one side."It's already open!fh fhfhvMO actorN iw;MO actorN iYou'd really rather not...iMO actorN *jjMO actorN# Ej<" DN# j5You don't have the strength to move that lid again.It's already closed! You can't read most of the characters, but you can decipher the most important word, the name of your venerable ancestor, Kaneiji.MO actorN3 mk<+The sarcophagus is closed.N3 k>xN3 AlYou look into the sarcophagus, half expecting to see the remains of your long-dead ancestor. What greets your eyes, however, is a beautiful, shining katana.N3 l>x&)&MMO actorNQ lC   & MO actorN! }/MO actorNE }It's occupied. throneMN H~mIt's an enormous throne made of pure gold. It's encrusted with jewels and adorned with intricate carvings." MN ׈! \b\tSuddenly, a horde of armored warriors bursts from the shadows, surrounding you. A trap!! you realize too late. Taken completely by surprise, you fight bravely but are quickly overpowered. The guards relieve you of your weapons and force you to kneel at the throne of the daimyo. The old man stares down at you for a long time before he speaks. Twin sparks of reflected firelight flicker in his eyes.\n\t"Good evening, Kaneiji," he says finally in his distinctive deep voice. "We've been expecting you." He smiles sadly. "You have courage, boy. It's a pity you don't have the wisdom to match it." He fishes a letter out of his pocket and tosses it casually on the floor in front of you. You recognize the handwriting immediately as your own.\n\t"Where the hell did you get..."\n\t"I can't say I blame you, Kaneiji," the daimyo continues, ignoring your outburst. "I find her as undeniable as you did. I searched my heart for days, trying to find an alternative. Send you to another daimyo. Dismiss you. Order you to accept the situation. But I know you too well, boy. We are too much alike. You wouldn't have been able to let her go..."\n\tYou remain staring at the letter, lost in thought, barely hearing the old man's words. Your heart sinks as the realization hits you. You've been betrayed. \n\t"Where is she?" you whisper, tears welling in your eyes. \n\t"Forget her," Shinobu says, eyes darkening. "She has made her choice." He turns his head towards a shadowy alcove behind him. "Come," he says sharply. "Show him." Slowly, a dark figure emerges from the shadows behind the daimyo. Your heart sinks as you look into the face of your betrayer. "No..." you whisper, unable to believe it. The traitor refuses to meet your stare. The daimyo stands and begins to walk towards the door. He pauses at the threshold, gazing at the dying flames outside. \n\t"Forgive me," he says. "I wish there were another way..."\n\tShinobu waves dismissively at the guards holding you. "Take him away," he commands. "The penalty for treason is death." The traitor's eyes widen in shock and horror. "No!!" the betrayer screams. "You promised he would be spared!!..." As the soldiers drag you to your fate, you cast a final glance back at the person standing beside the golden throne. "It doesn't matter now," you say. \b\tSuddenly, the world swirls and fades before your eyes. You drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\tCCN  >&AAN c! "H>x&DmmmB jewels 55The throne is covered with jewels of all varieties. CEB flames xxThey're the fires that were set by you and your men when you stormed the palace. They seem to be dying down somewhat. FlllB  furniture 77Couches, tables, and the like, all made of pure gold. G|||B  carvings BBThe throne is carved with intricate pictures of various deities. CI&' altar}MNkIt's hard to imagine what purpose, if any, this altar may have served; It's a solid slab of dull white stone about the size of a desk. On top of it are two large clay jars. In between the two jars, in the center of the altar, is a round hole about a foot in circumference. A small pile of white sand sits at the base of the altar, underneath a tiny opening.MMO actorN !Jf f f& dummy mmIt's really not much more than a man-sized pillar of bamboo. It's got dozens of tiny nicks and cuts on it. {MO actorNs|MO actorN>x  >w}" tNGHaving taken a long look at the ancient diagram, you feel inspired to attempt the "soaring lark" on the practice dummy. Using the diagram to guide you, you move slowly through the maneuver step-by-step for several minutes. After a while, you feel confident enough to try it. With a warrior's yell, you leap through the air and chop at the bamboo with all your might.\b\tTo your immense surprise, you strike the dummy soundly.N>x" ON@ However, your dull blade barely makes a scratch in the wood.XN The top half of the bamboo pillar is severed neatly by your razor-sharp blade and lands with a soft thud in the dirt by your feet. \n\tSuddenly, a powerful sensation of deja vu overtakes you... You've done this before, sometime, somewhere... \b\tWithout warning, the world slowly swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\t\>&AN*X&!>J&NeY&" -N!You've played this game before!You don't have a weapon. MO actorN MO actorN>x  NQ+You chop clumsily at the dummy with your >x" Ndull /blade and manage to hack off a few splinters.&NYou don't have a weapon.MOactorioNx YN%JJust "ATTACK DUMMY" will do. You're obviously going to use the sword...(NqNot with that you don't...Kb" " "=>MNC~Gio is here, her beautiful body curled next to yours in the wet grass between the pools, clothed only in blue-black shadows. GiojMNC<,DLShe's sobbing helplessly. You wonder what could have gotten her so upset.N&EShe seems to grow more beautiful with each passing day; her glistening black hair catches the moonlight in brief silver flashes, framing her pale face like a halo. Her eyes, twin pools of light, sparkle seductively when they meet yours. GioMO actorN;E She doesn't seem interested.UMO actorNEVYMOactordobjNKF3She places a finger to your lips and shushes you.#MOactorioNUFMOactorioN/xF<.N/FShe doesn't seem to hear you.?N/F3She places a finger to your lips and shushes you.TMN0G<3-She's too upset to listen to your question.?NG3She places a finger to your lips and shushes you. MO actorNdG  You'd rather die!MO actorNH You wouldn't dare![MO actorNEH\MO actorN_H<RNHCYou try to comfort Gio with a kiss, but she just pushes you away.6NH*You plant another soft kiss on her lips.MO actorNIMO actorNI<ENlI6You touch Gio gently, but she pushes your hand away.KNI?You touch her, receiving comfort from the warmth of her body.+MO actorNI,eMO actorN2JFMaybe in a little while; for now you're content just to be near her.MO actorNDJCMO actorN@_J$She smells like fresh wildflowers.MOvdpiNJ<=NJ-She's too upset right now to listen to you.*XN1KLShe smiles, but her gaze is far away, distracted; you doubt she heard you.*yMNNS\b\tGio turns to you, tentatively, and puts her hand on your chest. You move to kiss her but she gently pushes you away. She looks at you, and you see something in her eyes you have never seen there before; fear. For a long time she is silent, staring at you apprehensively. Several times she opens her mouth as if to speak but then hesitates, as if the words themselves, weighted by some unknown burden, are too heavy to breathe into life. "Kaneiji," she finally whispers, her voice barely audible, "...There is something... I need to tell you..." She reaches out to you as her whisper collapses into a sob. \n\tConfused, you hold her close to you, feeling the warmth of her tears coursing down your neck. \n\t"Gio, what is it?" you ask. \n\tShe pushes you away once more and buries her head in her pale arms. "I'm so afraid..." she says.C"MNQ\b\tFinally, Gio manages to regain her composure. "I'm sorry," she says. She takes a deep breath and closes her eyes. "Kaneiji... I went to visit Makumura a few days ago." She pauses, looking at you expectantly.\n\tThe name doesn't register at first. Then it hits you. Your chest tightens and you feel a sinking sensation in your stomach. "The midwife?"\n\tShe nods, and the tears start to flow once more.\n\t"And are you...?"\n\t"Yes, Kaneiji," she says. "I'm pregnant." C!= MNK[ \b\tIt takes a few moments for her words to sink in. As the meaning of this revelation finally hits you, you find you can do or say absolutely nothing, as you are paralyzed by a tsunami of conflicting emotions. Finally, you reach out her and pull her to you. She grasps you tightly, though you are not sure whether it is out of fear or love.\n\t"What is going to happen to us?" she asks, not looking at you. "Shinobu..."\n\tYour heart sinks at the sound of the daimyo's name. Your love affair with Gio has remained a secret thus far, but you know that you will both surely be put to death once the pregnancy is discovered. Unless, of course...\n\t"Makumura tells me she has a certain herb," Gio says quietly, voicing your thoughts. "If I take it tonight, the pregnancy..."\n\t"No," you say, your voice icy with determination. You touch her face gently and look directly into her eyes.\n\t"I leave tomorrow for Buke," you say. "Meigi and I have been ordered to quell an uprising there. This will be the last service I perform for Shinobu. When I return, we will leave here. Forever." \n\tGio's eyes widen in shock at your words. "Kaneiji, no," she says. " We can't just run away! A samurai who leaves his lord is..."\n\t"Ronin," you finish. "And I would rather live my life as an outlaw than watch my beloved become my master's wife..."\n\t"There is nothing to be done, Kaneiji, don't you understand?" she pleads, "The marriage has been arranged, there is no stopping it! But it... it won't last," she adds quickly, seeing the anger on your face, "Shinobu is an old, old, man, Kaneiji. He will be lucky to see another winter. Please," she says, squeezing your hands in hers,"let me talk to Makumura tonight. By this summer we will both be free, I know it! If we run now, we will never know happiness..."\n\t\Slowly, deliberately, you pull away from her. "We will call our child Meigi if it is a boy," you say coldly,"or Sachiko, if it is a girl." You gather up your clothing and get dressed, avoiding Gio's gaze. As you start to leave, you feel something soft brush against your cheek. You turn and see Gio, still crying, holding a white orchid out towards you in her pale fingers. You take it from her, wordlessly, and walk away towards the palace. \b\tWithout warning, the world slowly swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\tN[,>&! N[A6><&N[ 3L   =  samurai The warrior's young face bears some resemblance to your own, although his bears a few battle scars and is lined with an unspeakable sadness. His armor is scarred, as well, and you notice a frail, dried orchid stitched into the breastplate. > ,,\b\tThere is a young samurai warrior here.lMN>  PKN N +N N N( N6N> NLNT?\b\tThe ghost watches you closely, his expression unreadable.NNNF\b\tThe samurai's fingers drift to the orchid stitched in his armor.N&N0\b\tThe samurai hums a soft melody to himself.N;NC2\b\tThe warrior looks over the edge of the hull.NN0\b\tThe samurai closes his eyes and meditates.NRN N9N N N NN NN' N6N>N_N\b\tThe samurai leans against the hull, staring wistfully into the distance.Nh&8J\nY     !8MO actorNoMO actorN PYou touch the spirit, and are surprised to feel warm flesh beneath your touch. % 44You catch a faint scent of orchids and cold earth.'MO actorN>  )NYou don't have a camera!uN9iYou take a snapshot of the ghost, knowing full well that these types of things NEVER show up on film... MO actorNo 5MO actorN Very funny.NVMOvdpiN%The samurai ignores you completely.N*VMOactordobjNOx NOThe samurai's eyes widen and his mouth drops in surprise as you hand him the sword. "Domo origato gozaimas..." he whispers, caressing the blade.!>x&NO  -*He shakes his head, refusing your offer.MO actorNj(MOactordobjNDx NThe samurai's eyes widen and his mouth drops in surprise as you hand him the sword. "Domo origato gozaimas..." he whispers, caressing the blade.!>x&N'   He doesn't seem impressed.#MOactorioN ^ RMOactorioN  .You don't speak his language, unfortunately.#MOactorioN  RMOactorioNE  .You don't speak his language, unfortunately.T The ghost doesn't respond. M0 rubber spider XXIt's a little black rubber spider. Tiny letters on its back spell out "MADE IN USA". OSSSB lawn ##It's just a wide expanse of dirt. PCCC&  barracks ppThe barracks are simple, sturdy abodes, made of ancient weathered pine. The doors and windows are boarded up.vMO actorNwMO actorNqYou walk around the barracks, searching for an opening, to no avail. It looks like they've been boarded up solidly for quite some time.fMO actorNrhMO actorN+You rattle some of the doors and windows, trying to gain entrance to the barracks, but have no luck. They're boarded up solidly. Q& shrineMO actorN''~MO actorNK_You can't figure out any of the Kanji. Maybe if you had studied a little harder in school...RFQMNIt's a wooden shrine, about eight feet tall and four feet wide, which is covered in kanji characters. There's a statue inside it.> 6 @NC4\b\tThe statue is glowing with a soft amber light. S|||& statueMN}It's a lacquered wood statue of a fully armored warrior, with a spear in his hand, standing on a pair of struggling demons.> 6 N( \b\tOddly, you notice that the statue is glowing with a faint amber light. Suddenly, one of the demons beneath the warrior's feet transforms into a living, breathing fiend with burning eyes and scaly red skin. As you watch, transfixed, the beast spits a small wooden model of a mallet on the ground at your feet. As you reach down and take your new find, the statue stops glowing, and the demon returns to its solid wood state. Faintly, you hear the sound of swords clashing in the distance.>& RMO actorN MO actorN `It's not really a big statue, maybe three feet tall, but it's still too large to carry around.Tvvv& demons UUIt's a pair of unhappy demons, depicted struggling under the weight of the warrior.%MO actorN <N fYou find a small piece of ancient parchment stuck in the mouth of one of the demons, which you take.U&"+N You don't find anything else.&% SU06   parchment TTIt's an ancient, weathered piece of parchment with a detailed diagram drawn on it. ))There's a detailed diagram drawn on it.V& demon's mouthMN HThe demon's big mouths snarl angrily at the warrior pinning them down.<PN D\b\tThere seems to be something in the mouth of one of the demons. T%MO actorNC<NfYou find a small piece of ancient parchment stuck in the mouth of one of the demons, which you take.>U&"+NYou don't find anything else.&%Wppp& spear ??It's a big wooden spear with a long blade, also made of wood. SX0 katana It's a well-crafted, straight-edged katana. Your name is etched in spidery Kanji on the blade. The sword is steeped in the blood and gore of your enemies. Y& dummy ppIt's a bamboo practice dummy, which used to be roughly man- sized. However, it's been severed neatly in half. MO actorNp KMO actorN,Oh, leave the poor thing alone, already...MOactorioNx ;N$,Oh, leave the poor thing alone, already...Not with that you don't... Z0 severed headuMN1]It's the head of a soldier from the Matzumu clan, his face frozen in a mask of pure terror." [r111=SMN'2< > 0<Np2KN2N2I\b\tA stray arrow flies directly over your head, missing you by inches."ZN 3N3N_3M\b\tA fellow samurai falls dead a few feet away, pierced by a dozen arrows."ZN3)N3N3A\b\tSwords clash loudly all around you as the enemy presses in."ZN3N3N4\b\tA young samurai from your platoon rushes past, bleeding profusely from several deep wounds. "We're totally surrounded!!" he screams at you before charging madly into the enemy ranks."ZN4N4N4N}5\b\tA pair of warriors under Meigi's command charge past you in a brave, desperate attempt to break through the enemy lines, but are quickly cut down by Matzumu blades."ZN5N5N 6z\b\tOne of the soldiers emits a particularly loud yell, which causes a brief, faint rumble from one of the nearby peaks."ZNY6Nb6YNj6N6Q\b\tA long spear sails right over your head and buries itself in the deep snow."ZN6N6Np7\b\tThe screams of your dying platoon members ring deafeningly in your ears as the arrows continue to fall from the peaks surrounding you."Z7,cI,>  \b\tThe battle rages fiercely. battle The battle is going terribly. You are outnumbered three to one and in a terrible defensive position. It's only a matter of time before your and Meigi's platoons are completely wiped out by the advancing enemy.#YMOavipN8) +You need to get out of here!N69*"FMOavdpNA9You need to get out of here!* \\(  =  platoon> qq\b\tYour platoon is fighting bravely, but it's only a matter of time before the advancing enemy cuts them down. Your men, or what's left of them, are loyal, brave warriors who will follow your commands blindly. They are dressed in black battle armor and are equipped with swords and metal shields.MOvdpiNa:;} Na;~"Attack!" you scream. Your men charge bravely at the enemy lines, but are overwhelmed by sheer numbers and have to retreat.* \Na<OYou just don't have enough numbers to mount an effective attack to the south.* \Na<OYou just don't have enough numbers to mount an effective attack to the south.* \Na=OYou just don't have enough numbers to mount an effective attack to the north.*~ Na=Your men attempt to scale the icy peaks, but they're too steep, and are already held by the enemy. You quickly call a retreat before any more of your men are killed.* Na>Your men attempt to scale the icy peaks, but they're too steep, and are already held by the enemy. You quickly call a retreat before any more of your men are killed.* MNa ?@The mountain is that way. There's nowhere for your men to go.* <Na AYour men seem a bit puzzled at your orders, but they do as you say. Soon your entire platoon is screaming at the top of their lungs. Meigi, guessing what you have in mind, orders his remaining men to do the same. The resounding noise echoes off the surrounding mountain peaks. After a few moments, as you had hoped, you hear a deep rumble from all around you. You've started an avalanche! The Matzumu clan archers and footsoldiers look around in terror at the mammoth walls of snow bearing down on them.NagA"C[!>[&NaA!>d&!>`&!>b&NaB!>a&\e&\f&NaPB^g&*?NaB3The first order you gave seemed to be sufficient.* >]a%CKThere doesn't appear to be anywhere for your men to go in that direction.*6<" NaC{Your men are totally engaged with the enemy at the moment. If they retreat now, they'll be slaughtered where they stand.*NahDWith the Matzumu soldiers distracted by the oncoming avalanche, you order your men to retreat into the safety of the narrow crevasse.!<&\>_&*NaDKNaD?Your men look at you with puzzled expressions on their faces.*U --They're a little preoccupied at the moment. --They're a little preoccupied at the moment.#MOactorioNS E ''This isn't the time for conversation.T --They're a little preoccupied at the moment. \]yyy& \ gap JJIt's a dark, narrow crevasse that opens into the cliff face to the east.^]]]$ Dark crevasse \b\tThis is a deep, dark fissure in the rock, ten feet tall and four feet wide. Dim sunlight filters in from the valley to the west, and the crevasse continues east into the darkness.B\AdMNU>\" NpVThe crevasse seems to continue deep into the mountain. You could probably escape this way, but you would be deserting your platoon.NWYou head deeper into the mountain, shouting at your platoon to follow, as tons of snow roars into the valley from the peaks above. You and your men travel for what seems like hours through the dark fissure, until you finally catch a glimpse of sunlight to the east. With a weary cry of triumph, you and your platoon emerge on the eastern face of the mountain, into a bright...\b j>N2XCkNQX_&& retreating platoon kkYour remaining men are hurrying one by one in an orderly retreat into the safety of the narrow crevasse.#MOavipNHG) YNGLYou'd better just let them finish their retreat before the avalanche hits.*"tMOavdpN1#HLYou'd better just let them finish their retreat before the avalanche hits.* `  & enemy soldiers The soldiers of the Matzumu clan are outfitted in heavy battle armor, painted white to camouflage with the surroundings. They seem determined to kill every last man in your and Meigi's platoons. MO actorNa( MO actorN(wYou've already tried to break through their ranks several times, with no success. You need to think of another plan.{ | MO actorN/)%kMO actorN)LYou scan the enemy lines for a weakness you can exploit, but find nothing. MO actorN_)'MO actorN)Right. \a<<<&C \  mountainsuMN+RThe mountains climb high into the sky to the east and west of the narrow valley. Scattered amidst the peaks, perched precariously on thick ledges of snow, archers and spearthrowers from the Matzumu clan rain death on your and Meigi's platoons.\b\tLooking closely, you notice that there is a small, dark gap in the rock wall to the east."]N),MO actorN2,`MO actorN,AThe peaks are too steep, and are already occupied by the enemy.b&C ledges The thick ledges of snow which the archers are standing on don't look very stable; the soldiers seem to be having some difficulty keeping their balance. \cX&'  bloody snow LLThe snow all around the valley is stained red with the blood of the slain.MO actorN.%MO actorND/You dig around in the bloody snow for a few frantic moments, hoping to find something that will aid in your predicament, but turn up nothing.MO actorNXZ/`MO actorN|/ASnowballs aren't going to help you win this battle, I'm afraid. %&%% \d&C  archers The archers and spearthrowers on the snowy ledges above your position are not particularly good shoots, but your men are sitting ducks at the moment. aeGGG&  avalancheMNKThe massive avalanche is tumbling down from the mountain peaks, swallowing everything in its path. It will reach the valley in a matter of seconds.\b\tIt looks like the only possible way out of here is through the narrow gap in the rock wall to the east."]#MOavipNKK) RNK'LEYou'd better get out of here before the avalanche buries you alive!*"mMOavdpNLEYou'd better get out of here before the avalanche buries you alive!* f& enemy The enemy is in total disarray, trampling each other in their futile attempts to get out of the path of the deadly avalanche.#MOavipNN) RNPNEYou'd better get out of here before the avalanche buries you alive!*"mMOavdpN1NEYou'd better get out of here before the avalanche buries you alive!* g &  platoon ZZMembers of your platoon are rushing in one by one, retreating from the deadly avalanche.#MOavipNI) YNjILYou'd better just let them finish their retreat before the avalanche hits.*"tMOavdpNILYou'd better just let them finish their retreat before the avalanche hits.* hggg& \ swords and shields DDYour troop's equipment is holding up well under the circumstances.#sMOavipNO) ENP8You really need to be focusing on the problem at hand.*"`MOavdpNP8You really need to be focusing on the problem at hand.*i@= Meigi Meigi, your close friend, is a brave, grizzled veteran samurai in his late forties. He is shouting orders to his few remaining men in a desperate attempt to avoid a rout.> BB\b\tYour close friend Meigi is here, shouting orders to his men. \ MO actorN/Q BMO actorNSR#Why would you attack your friend?{ | U **He's a little preoccupied at the moment. **He's a little preoccupied at the moment.#MOactorioN S ''This isn't the time for conversation.T 33He's too busy right now to answer your questions!SMOvdpiNS+He's too busy right now to listen to you!*j$ Snow-covered field GG\b\tThis is a small, snowy field on the eastern face of the mountain. 00You're too exhausted right now to go anywhere.kCCC=  platoon> HHThe tattered remnants of your platoon are here, treating their wounds. Your men are bloody shells of their former selves. Their wounds are grievous; several of them have lost limbs in the fighting. You doubt that many of them will survive the rest of the journey home.T ,,They're in no condition to talk right now.OMN?[<They're in no shape to do anything but rest at the moment.*U <<They're in no shape to do anything but rest at the moment. <<They're in no shape to do anything but rest at the moment.#MOactorioNP \PMOactorioNy-\,They're in no condition to talk right now.MNW]\b\tMeigi staggers out of the cave, flushed and shaking after the narrow escape. Amazingly, he doesn't appear to have suffered any wounds, even though he was in the thick of the fighting. He sits down in the snow next to you.Np]jl&Cl  88Even if you wanted to, you wouldn't have the strength.{ |  jl>   = Meigi Meigi, your close friend, is a brave, grizzled veteran samurai in his late forties. He's sitting beside you in the snow, chin in hand, brow furrowed in contemplation.> &&\b\tYour close friend Meigi is here.U CCHe's lost in thought, and doesn't even acknowledge your offering. CCHe's lost in thought, and doesn't even acknowledge your offering.#MOactorioNc 55He's lost in thought, and doesn't seem to hear you.T ??He's lost in thought, and doesn't seem to hear your question.]MOvdpiNQd5He's lost in thought, and doesn't seem to hear you.* MO actorNd tMO actorN-eUEven if you had the strength to lift your sword, you wouldn't want to attack Meigi.{ | MNk<\b\tAfter several minutes of silence, Meigi turns to you and says, "They knew we were coming." \n\tYou nod slowly, returning his stare. "I was thinking the same thing," you reply. "But how? I planned this route the day before we set out. Only a spirit could have told the enemy that we would be traveling through the Buke pass today." \n\tMeigi nods his head slowly. "Or a spy," he says in a quiet voice. \n\tYour eyes widen in shock. "Not in MY platoon," you protest angrily. "My men are the most loyal, brave..." \n\t "Loyal to YOU? Or to daimyo Shinobu?" Meigi interrupts. "Think about it, Kaneiji. We were set up. This was a suicide mission from the start. And whoever the spy is had to be under orders from the daimyo himself." \n\tYour stomach coils in greasy knots at the sound of Meigi's words. "No," you say, horrified. "Daimyo Shinobu would never... He wouldn't..." \n\t "He would, Kaneiji, and he did," snaps Meigi. He looks pointedly at your armor. "And I think you know why." \n\tYou follow the old samurai's gaze to the fragile white orchid stitched into your breastplate. "Gio..." you whisper. Your mind reels at the implications as your thoughts gradually turn from confusion, to anger, and finally, to revenge.\n\t "Gather your men, Meigi," you say calmly. "We're heading back to the palace..." \b\tWithout warning, the world slowly swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\t>&Nl\AA6>&NNl!  mB  scenery zzOrdinarily, this would be a lovely scene, but the horror you just witnessed has tainted the beauty of your surroundings. jn^& wounds It's a healer's nightmare; missing eyes, severed hands, torn stomachs, fractured skulls, cracked bones, punctured lungs- It's a miracle that any of these men are still alive.#MOavipN`) SN`FYou're not a healer, so you wisely decide to leave the wounds alone.*"nMOavdpNj[aFYou're not a healer, so you wisely decide to leave the wounds alone.* kpkkkB lawn ;;It would be a nice spot to have a picnic, you think idly. qRRRB  dirt path It's an ordinary dirt path. r:&' stage bbIt's a small wooden stage, in very good condition. You wonder what it might have been used for.NMO actorN2/You don't think it would support your weight. sFQMN It's a wooden shrine, about eight feet tall and four feet wide, which is covered in kanji characters. There's a statue inside it.> 6 @N4\b\tThe statue is glowing with a soft amber light. t???& statuedMN$rIt's a lacquered wood statue of a very fat man with a smiling face. He's carrying a huge bag over his shoulder.> 6 N \b\tOddly, you notice that the statue is glowing with a faint amber light, and that the wooden bag over its shoulder has transformed somehow into a real linen bag. Curious, you look inside the bag, and find a tiny wooden model of a gold-filled purse. As you reach in and take your new find, the statue stops glowing, and the bag returns to its solid wood state. Faintly, you hear the sound of joyous laughter in the distance.N. >&NG  sMO actorN^ MO actorN `It's not really a big statue, maybe three feet tall, but it's still too large to carry around.uSSS& bag $$It's just a big bag, made of wood. tvjjj&   biwa player4MNShe's a gorgeous young woman with long black hair, who is playing a biwa with technical expertise and great passion. There's something very captivating about the musician, and you feel a strong need to know more about her. If only you could get her attention somehow...N$"}#MOavipNrf) SNrFShe's too far away. The stage is at least thirty yards to the west.*"nMOavdpN5FShe's too far away. The stage is at least thirty yards to the west.*w___B lawn //The west lawn is a sea of drunken spectators. bxC  puppets rrThe puppets are about three feet tall, and very beautifully made. They are operated by three puppeteers apiece. byrrr&  puppets rrThe puppets are about three feet tall, and very beautifully made. They are operated by three puppeteers apiece.#gMOavipN) 9N ,You don't want to disrupt the performance.*"TMOavdpN &,You don't want to disrupt the performance.* czoooC b  puppeteers 33The Bunraku puppeteers are masters of their craft. Each puppet requires three people to operate it: an omuzukai who moves the head and right arm, a hidarizukai who moves the left arm, and an ashizukai who moves the feet. The puppeteers are all wearing black to blend in with the background on the stage.{x777&  puppeteers 33The Bunraku puppeteers are masters of their craft. Each puppet requires three people to operate it: an omuzukai who moves the head and right arm, a hidarizukai who moves the left arm, and an ashizukai who moves the feet. The puppeteers are all wearing black to blend in with the background on the stage.#hMOavipNjX) :Nj-You don't want to disrupt the performance. *"TMOavdpN,You don't want to disrupt the performance.* c|P&  performers ~~There are two of them beside the stage; a man who is narrating the puppet show and a beautiful young woman playing the biwa.#MOavipN) |NjfYou don't want to disrupt the performance. Besides, you're really only interested in one of them...*N"MOavdpNe fYou don't want to disrupt the performance. Besides, you're really only interested in one of them...* c}C  performersTMNThere are two performers beside the stage; a man who is narrating the puppet show and a beautiful young woman playing the biwa.N3<N\b\tYou don't recall ever seeing the young musician around here before. She certainly is very pretty... Perhaps you should take a closer look...b>v&N b~& v biwa instrument ^^It's a four-stringed instrument made of high quality wood. It has a pleasant, singing tone.#MOavipN>) RNEIt's too far away. The stage is at least thirty yards to the west.*"mMOavdpN" EIt's too far away. The stage is at least thirty yards to the west.*V    =  biwa player >>She's a gorgeous young woman with long black hair, who is playing a biwa with technical expertise and great passion. There's something very captivating about the musician, and you feel a strong need to know more about her. Up this close, she is even more enchanting. If only you could get her attention somehow...:MOvdpiNv!She ignores you.*> WWThere is a very beautiful young biwa player performing here at the side of the stage.UMO actorN!VMOactordobjN7! N7"\b\tYou gently place the !n at the feet of the young woman. She acknowledges the gift with a shy smile and returns to her performance.N7_"&N7"!N7M(zYou lay the orchid at the musician's feet. Her eyes widen at the sight of the beautiful flower, and she surreptitiously snatches it from the ground and places it in her hair in one swift motion, without missing a single note on the biwa. She turns towards you with a bright smile on her face, and her deep brown eyes meet yours. "Thank you," she whispers soundlessly.\n\tYour heart leaps in your chest. "What is your name?" you blurt out without thinking, feeling very much like a lovestruck schoolboy. She hesitates for a moment and avoids your stare, focusing instead on the biwa in her hands. Just when you think she isn't going to reply, she glances at you once more. "Gio," she says softly. Your spirits soar like the golden notes that emanate from the musician's instrument. "Gio..." you say quietly to yourself, savoring the word on your tongue, "such a lovely name..." The young woman blushes and closes her eyes, and plays a beautiful long solo passage on the biwa. You close your eyes as well and let yourself be swept away by the heavenly music. "Gio..." you think as the melody caresses you, "we will be together..." \b\tWithout warning, the world slowly swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\t>&AN7(A6>&N7(! UV#MOactorioN )uMOactorioN5 )QShe's in the middle of a performance. You need to capture her attention first. MO actorN )  You'd rather die!MO actorN * You wouldn't dare![MO actorN; W*\^MO actorN_ *?You sure would like to, but now is definitely not the time...T llShe's too caught up in her performance to answer your questions. You need to get her attention somehow...+MO actorN5 C+,DMO actorNY ]+%I'll pretend you didn't say that...MO actorN +CMO actorN +$She smells like fresh wildflowers. c  orchid wMO actorN/GM>  BN/M%You pick an orchid from the garden.<&")N/Mjk,  an orchidccc$ Garden 11\b\tThis is one of your favorite places in the palace; a private, secluded flower garden tucked in the shadow of the western wall. Hundreds of varieties of brightly-colored flowers surround you, which gives you the sensation that you have just stepped into a rainbow. You can return east to the stage.AcBBB& biwa instrument ^^It's a four-stringed instrument made of high quality wood. It has a pleasant, singing tone.#XMOavipN,) *You don't want to touch it.N4-*"EMOavdpN?-You don't want to touch it.* cC  puppet show {{The show is titled "Men Uri" - it's about a mask peddler and his chatterbox assistant who travel the country, selling their wares with ridiculous song and dance routines. The six puppeteers on the stage move the large puppets expertly, while music and narration is provided by two performers at the side of the stage. The stage itself is about thirty yards away to the west. bz:::&  puppet show <<The show is titled "Men Uri" - it's about a mask peddler and his chatterbox assistant who travel the country, selling their wares with ridiculous song and dance routines. The six puppeteers on the stage move the large puppets expertly, while music and narration is provided by performers at the side of the stage.#gMOavipNnM1) 9Nn1,You don't want to disrupt the performance.*"TMOavdpN1,You don't want to disrupt the performance.* cMMM= crowd The crowd is made up of rowdy young samurai like yourself. Many of them are giving you dirty looks for the way you just shoved to the front of the stage. Luckily, they have respect for you, or there would probably be some trouble...> 77There is a large rowdy crowd here, enjoying the show.T FFNobody's particularly interested in having a conversation right now.U QQThey don't want anything but more sake, and unfortunately you don't have any... AAThey could care less. "Down in front!!" someone shouts at you.#MOactorioNB= ##You are immediately shouted down. MO actorN]>  00You don't feel like picking a fight right now.MO actorN> 00You don't feel like picking a fight right now. cOOO& garden How about typing "LOOK"...? VVVB wall &&It's the western wall of the palace. i i i&  flowers ppIrises, violets, roses, and hundreds of other species in full bloom dazzle the eyes with their vibrant colors. MO actorNBvMO actorNCNYou inhale deeply, reveling in the sweet, heady mixture of natural perfumes.NCMO actorNLCfMO actorNp}CGYou'll have to be more specific. There are hundreds of species here.jMO actorNCkfMO actorNCGYou'll have to be more specific. There are hundreds of species here.0MN#D!</MN@DIt's a lovely !<.MO actorNolDCMO actorNDThe !< smells wonderful! rose tMO actorN-E>  ?N-^E"You pick a rose from the garden.<&")N-Ejk tulip uMO actorN.F>  @N.^F#You pick a tulip from the garden.<&")N.Fjk daisy uMO actorN.G>  @N.^G#You pick a daisy from the garden.<&")N.Gjk  hyacinth xMO actorN1"H>  CN1jH&You pick a hyacinth from the garden.<&")N1Hjk violet vMO actorN/(I>  AN/nI$You pick a violet from the garden.<&")N/Ijk lily tMO actorN-&J>  ?N-jJ"You pick a lily from the garden.<&")N-Jjk iris uMO actorN-$K>  @N-iK#You pick an iris from the garden.<&")N-K,  an irisjk  hibiscus xMO actorN1@L>  CN1L&You pick a hibiscus from the garden.<&")N1Ljk  carnation yMO actorN2jN>  DN2N'You pick a carnation from the garden.<&")N2NjkSSS$ Quiet templePMN\b\tThis tiny, simple one-room wooden temple in the southeast corner of the palace is a perfect spot for quiet contemplation. It's completely unadorned save for the tall shrine at the back of the room, which houses a lacquered wood statue.> 6 AN5\b\tThere's a faint glow emanating from the shrine.6sMNbW\b\tThere's a rubber spider on the floor here, probably left behind by someone's kid.>M&DMOavdpiNh ! E ! aN=You close your eyes and ponder the secrets of the universe.NJf>" E >! TN=You close your eyes and ponder the secrets of the universe.!> 5NYou continue meditating.> 5NYou continue meditating.z> dNk@You continue meditating. You feel yourself starting to relax.N > 5You continue meditating.N> ,You continue meditating.> wN\You have a sudden revelation: Yanni and Carlos Santana are alter egos of the same person!! > 5NYou continue meditating.> 5N> You continue meditating. > N gYou have another revelation: God is love. Love is blind. Ray Charles is blind. Ray Charles is God. > 5You continue meditating.N&  > 5You continue meditating. Nu s> dN *Slowly, you feel yourself falling into a trance. Gradually, the world swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\te>&" N A!N **>< )!)Nr FJ& temple UUIt's just a tiny wooden pagoda, with room enough for one person to stand inside it.vMO actorNtwfMO actorN=You duck your head slightly and enter the small temple.\b\t>MO actorN%[MO actorN6f<You need to be inside the temple before you can search it. f%%%0 m \& & temple hhThe temple itself is rather unremarkable from the inside; it's just a tiny circular room made of wood.MO actorN %9MO actorN You don't find anything.MO actorN _MO actorN-6You duck your head slightly and exit the temple.\b\t> FQMNIt's a wooden shrine, about eight feet tall and four feet wide, which is covered in kanji characters. There's a statue inside it.> 6 @Nd4\b\tThe statue is glowing with a soft amber light. KKK&pMNZIt's a lacquered wood statue of an old man with a long, flowing beard, riding on a stag.> 6 N\b\tOddly, you notice that the statue is glowing with a faint amber light. As you watch, transfixed, the old man riding the stag suddenly transforms from wood to flesh and blood right before your eyes. Smiling, the bearded sage takes a tiny wooden model of a hat from beneath his robes and drops it gently at your feet. As you reach down to take your new find, the old man returns to his solid wood state. Faintly, you hear the sound of a crane hooting in the distance.N>& statueMO actorNMO actorN`It's not really a big statue, maybe three feet tall, but it's still too large to carry around.  & e sound Why don't you try listening?#<MOavipNR~)  Come on.*"2MOavdpN Come on.*& temple hhThe temple itself is rather unremarkable from the inside; it's just a tiny circular room made of wood.MO actorN%9MO actorNYou don't find anything.MO actorN_MO actorNY6You duck your head slightly and exit the temple.\b\tf> e  $  Courtyard \b\tThis is the central courtyard of Shinjuku Palace, a rather unremarkable circular patch of dirt. The palace proper looms far to the north, while other paths lead off in all directions to smaller buildings on the perimeter.6 aa\b\tThe melody that awakened you is coming from somewhere to the south, beyond the palace gate.Gf@MN!b\b\tYou step outside the palace walls, entranced by the plaintive, haunting melody. As you approach the steps, you spy a familiar slim figure far below on the footbridge which spans the moat. Your heart races as you realize that the figure is Gio, the beautiful musician whom you met months ago at the puppet show on the west lawn. You have not seen her since that day, but you have not been able to get her out of your mind. \n\tJoyously, you shout her name and race down the steps towards her. Before you can reach her, however, she turns, laughing, and sprints across the footbridge into the thick forest that surrounds the palace. You follow her into the woods, confident that with your superior strength and speed you will catch up to her quickly.\n\tFor a while it seems like you are gaining on her, but it is soon evident that she is just toying with you. With a breathless laugh, she puts on an incredible burst of speed and vanishes into the trees. Dumbfounded, you rest your hands on your knees to catch your breath. Looking around, you realize with a mild sense of dismay that you are hopelessly...\b> CN!D You can't go that way.C You can't go that way. ..There's no reason to go there at the moment.& temple UUIt's just a tiny wooden pagoda, with room enough for one person to stand inside it.vMO actorNwfMO actorN=You duck your head slightly and enter the small temple.\b\te>MO actorN%%[MO actorN6<You need to be inside the temple before you can search it. fj* * *$ Lost \\\b\tYou are deep in the forest, surrounded by tall trees. The palace is nowhere in sight.C You can't go that way.D You can't go that way.MN %mYou wander in what seems like the right direction, but this patch of woods looks just like every other one.!@4MNN% N%{You follow the sound to the south. However, the notes recede faster than you can keep up, and soon fade away altogether.!}Ns&mYou wander in what seems like the right direction, but this patch of woods looks just like every other one.!F7MN&> N'You follow the sound to the northwest. However, the notes recede faster than you can keep up, and soon fade away altogether.!}N'mYou wander in what seems like the right direction, but this patch of woods looks just like every other one.!A2MN'> N^(zYou follow the sound to the east. However, the notes recede faster than you can keep up, and soon fade away altogether.!}N(mYou wander in what seems like the right direction, but this patch of woods looks just like every other one.!H,MN()> N)eYou follow the sound to the southwest, and make your way through the trees into a small clearing.\bN)>}N1*mYou wander in what seems like the right direction, but this patch of woods looks just like every other one.!2& trees ??They're tall, thick trees of nearly every variety imaginable.MO actorNq+MO actorNx+aYou try to scramble up a nearby tree, but are unable to get high enough to really see anything.MN:,\b\tYou nearly trip over something hard on the ground. Looking down, you see a small bamboo shakuhachi flute lying in the grass at your feet. Perhaps Gio dropped it here...>& C palace bbNo matter how many times you see it, it's still awe-inspiring. You're very proud to serve here. & dirt ]]It's just an ugly patch of dirt. The daimyo plans to build a reflecting pool here someday. - - -0 flute <<It's a nice instrument, made from short lengths of bamboo.MO actorNh#-cMO actorN-DYou might as well hang onto it. Otherwise you'd probably lose it.qMO actorN-rMO actorN).7You tentatively blow a few notes on the wooden flute.>! lN)d.Q\b\tAs if in answer, you hear the biwa respond with a few notes from the south.> N).p\b\tAs if in answer, you hear the biwa respond with a few notes from the northwest, a little closer this time.N)F/-> N)/`\b\tAs if in answer, you hear the biwa respond with a few notes from the east, very close now.N)/> N)!0l\b\tAs if in answer, you hear the biwa respond with a few notes from the southwest, just beyond the trees.N)h0UMO actorN0V:MO actorN0Try "PLAY FLUTE" instead. $  Oak grove \b\tYou are standing in a shady grove deep in the heart of the forest. A young oak tree stands in the center of the clearing, spreading its leafy branches wistfully towards the sky. ,,The trees are too thick in that direction.E ==Try as you might, you can't find the path you entered from.D You can't go that way.C >>It's a pretty small tree, but you might be able to climb it.J   &  oak tree It's a fairly young oak tree, by the looks of it. There's nothing particularly interesting about it, except for the dark shape hidden amongst the leaves above you.MO actorN3MO actorN4^Feeling like a small child, you grab hold of a low- hanging branch and pull yourself up...\bg>CNX4aMN4G\b\tGio closes her eyes and begins to play a soft melody on the biwa." [[[C shape **It looks curiously like a young woman... X  &  oak tree //It's an oak tree. Nothing special about it. goMO actorNfz8p$ MO actorN8>k  2N8#You don't have the carving knife! NPE_ \b\tYou take the carving knife in your hands and begin scraping the bark off of the tree trunk. Gio watches you, curious. "What are you doing?" she asks. Instead of replying, you smile slightly and continue scraping until you have exposed a large section of bare wood. "Keep playing," you say. Smiling, Gio closes her eyes and focuses her attention on her instrument, improvising a wistful, delicate melody. As the soaring, beautiful sounds embrace you, you carefully begin to carve a portrait of Gio into the soft skin of the oak tree. As you work, you let your conciousness drift, and you watch with a sense of detached wonder as the musician's features seem to magically appear in the wood before you. Your hands move with blinding speed, yet somehow manage to capture every detail of the beautiful woman, right down to her fingers' positions on the fretboard. \b\t"It's beautiful..."\b\tYou turn around, startled. In your zen-state, you didn't even notice that Gio had moved behind you. Tears well up in her dark brown eyes as she stares, awe-struck, at your portrait. \b\t"I've dreamed about your face a hundred times..." you whisper. Quickly, without thinking, you plant a light kiss on her lips. She pulls back, startled, but after a second's hesitation she closes her eyes and returns your kiss forcefully and passionately. Time seems to stand still as you embrace each other, and all thought ceases as you lose yourselves in this blissful moment. When the spell finally lifts, the two of you can only stare at each other wordlessly for a long, long time. Finally, you become vaguely aware of a gradual change in the sunlight, and sudden panic overtakes you as you realize that you have completely lost track of time. \b\t"Gio, I'm sorry, I have to go..." you stammer. "I am late for sentry duty!" You hurriedly turn to jump from the tree and then pause, realizing that you still have no idea where the palace is. Gio, laughing, points a slender finger towards the northeast. \b\t"It's that way," she says. You linger for a moment, torn between duty and passion. \b\t"I have to see you again," you say finally. "Are you performing at the palace tonight?" Gio hesitates, and her eyes avoid yours for an instant.\b\t"I... have been hired by daimyo Shinobu as the palace musician," she replies. "I will be living here all summer." Joy fills your heart at her words and you leap out of the tree, feeling as though you could sprout wings and fly through the air like a sparrow. Instead, you land on the ground with a painful 'thud' which completely knocks the wind out of you. Gio climbs gracefully out of the tree after you and kneels next to your prone body. She kisses your cheek softly and whispers, "Meet me by the pond tomorrow, Kaneiji...". Then she stands and, in a flash, vanishes into the forest. \b\t"How did you know my name?..." you ask the empty clearing. \b\tWithout warning, the world slowly swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death- like state you have no idea where or even who you are...\b\tNE>&AANE6>&C! N/F"uMOactorioN JFk WN FHJust "CARVE TREE" will do. You're obviously going to use the knife...(N FNot with that you don't...MO actorNbFZMO actorNWG;You can't climb any higher, and you don't want to anyway.ZZZ=>MNGGGio is here, resting on a nearby branch, a playful smile on her lips.>" PNK\gMO actorNb~KHYou sure would like to, but you don't think she'll let you just yet...+MO actorNK,DMO actorNK%I'll pretend you didn't say that...oMO actorN=KpAMO actorNaL"I think you mean "CARVE TREE"...MO actorNDLCMO actorN_L$She smells like fresh wildflowers.:MOvdpiNLShe ignores you.* gx777&  biwa ^^It's a four-stringed instrument made of high quality wood. It has a pleasant, singing tone.#XMOavipNM) *You don't want to touch it.NN*"EMOavdpN!NYou don't want to touch it.*HHH&  buildings ::They're small, windowless rectangles made of fieldstone.MMO actorNjvMO actorN'wMO actorNlExcept for the one to the southwest, they're solidly boarded up; you can't see any way to get inside them. :&  granary uuIt's a little circular building made of fieldstone, sitting unobtrusively beneath the southwest wall of the palace.vMO actorNw(MO actorN!> uuu& dark passage ??It's a steep stone ramp which slopes downward into the floor. b   0  large jar{MNt);It's a clay jar with the Kanji number "5" carved into it.> "N) It's full of sand.>  It's empty.> .N*" It's three-fifths full of sand.> -Nn*! It's two-fifths full of sand.> %" It's four-fifths full of sand.> ,N* It's one-fifth full of sand.fMO actorN8+;You empty the jar into the pile at the foot of the altar.eMO actorN+:You fill the jar to the top with sand from the sandpile.MO actorN+P#MOactordobjN+ > E> 7N ,(The large jar is already full of sand.k> E> sNr,CYou pour the sand from the smaller jar into the empty larger jar.N,> E> dN)-=You pour the sand from the smaller jar into the larger jar.\> E> nN~->You pour some sand from the smaller jar into the larger jar.N-> E> eN.>You pour some sand from the smaller jar into the larger jar.Q> E> dN.=You pour the sand from the smaller jar into the larger jar.> E> dN/=You pour the sand from the smaller jar into the larger jar.QNb/> E> dN/=You pour the sand from the smaller jar into the larger jar.> E> nN0>You pour some sand from the smaller jar into the larger jar.NS0>> /Nq0#There's no sand in the small jar!7N0+There's no reason to put that in the jar.f6MO actorN0The jars are lidless.ifjh IR  0>  small jarMN1;It's a clay jar with the Kanji number "3" carved into it.> "N 2 It's full of sand.>  It's empty.> -Ny2! It's two-thirds full of sand.> ,N2 It's one-third full of sand.fMO actorN@'3;You empty the jar into the pile at the foot of the altar.eMO actorN3:You fill the jar to the top with sand from the sandpile.PMOactordobjN3 A> E> 7N3(The small jar is already full of sand.> E> sNF4CYou pour the sand from the larger jar into the empty smaller jar.N4\> E> jN4CYou pour the sand from the larger jar into the empty smaller jar.> E> eN5>You pour some sand from the larger jar into the smaller jar.U> E> mN5=You pour the sand from the larger jar into the smaller jar.N'6> E> kNv6DYou pour some sand from the larger jar into the empty smaller jar.E> E> jN7CYou pour the sand from the larger jar into the empty smaller jar.> E> nNi7>You pour some sand from the larger jar into the smaller jar.N75> &#There's no sand in the large jar!7N8+There's no reason to put that in the jar.f6MO actorNA8The jars are lidless.ifjh IFQMN It's a wooden shrine, about eight feet tall and four feet wide, which is covered in kanji characters. There's a statue inside it.> 6 @N4\b\tThe statue is glowing with a soft amber light. !CCC& statuehMNvIt's a lacquered wood statue of a fat man, holding a small mallet over his head, standing on two large bags of rice.> 6 N\b\tOddly, you notice that the statue is glowing with a faint amber light. As you watch, transfixed, the fat man suddenly transforms from wood to flesh and blood right before your eyes. Smiling, the man takes a tiny wooden model from one of his bags and drops it gently at your feet. As you reach down to take your new find, the fat man returns to his solid wood state. Faintly, you hear a sound like wind rushing through tall grass.N>&MO actorNMO actorN`It's not really a big statue, maybe three feet tall, but it's still too large to carry around. @@@&  opening BBIt's a tiny, barely noticeable opening in the base of the altar.MO actorNpPMOactordobjN5{The opening is extremely small, and it appears to slant upward into the altar. There's no way to put anything inside it. I& hole On closer inspection, the hole appears to be funnel-shaped; it gradually tapers down into a tiny, inch-wide opening. The Kanji character representing the number "4" is carved inside the funnel.MO actorNP MOactordobjN > UN1You pour the sand from the larger jar into the hole. You hear some faint clicking sounds as the sand passes through some mechanism within the altar...\b\t...and nothing happens. After a few moments, the sand trickles through the small opening at the base of the altar and joins the pile on the ground.N9> UNK1You pour the sand from the larger jar into the hole. You hear some faint clicking sounds as the sand passes through some mechanism within the altar...\b\t...and nothing happens. After a few moments, the sand trickles through the small opening at the base of the altar and joins the pile on the ground.N2> UN1You pour the sand from the larger jar into the hole. You hear some faint clicking sounds as the sand passes through some mechanism within the altar...\b\t...and nothing happens. After a few moments, the sand trickles through the small opening at the base of the altar and joins the pile on the ground.N> UN1You pour the sand from the larger jar into the hole. You hear some faint clicking sounds as the sand passes through some mechanism within the altar...\b\t...and nothing happens. After a few moments, the sand trickles through the small opening at the base of the altar and joins the pile on the ground.NSn> 8N !You pour the sand from the larger jar into the hole. You hear some faint clicking sounds as the sand passes through some mechanism within the altar...\b\t...Suddenly, the room is filled with the sound of grinding stone as the altar slowly sinks into the floor of the granary, revealing a dark passage beneath. Your curiosity gets the better of you, and the smell of grain assails your nostrils as you make your way towards the opening... \b\tWithout warning, the world slowly swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\tNU!>&" "IN! CN!A&)N"There's no sand in the jar!z CN$"> MNO#2You pour the sand from the smaller jar into the hole. You hear some faint clicking sounds as the sand passes through some mechanism within the altar...\b\t...and nothing happens. After a few moments, the sand trickles through the small opening at the base of the altar and joins the pile on the ground.> MN$2You pour the sand from the smaller jar into the hole. You hear some faint clicking sounds as the sand passes through some mechanism within the altar...\b\t...and nothing happens. After a few moments, the sand trickles through the small opening at the base of the altar and joins the pile on the ground.> MN&2You pour the sand from the smaller jar into the hole. You hear some faint clicking sounds as the sand passes through some mechanism within the altar...\b\t...and nothing happens. After a few moments, the sand trickles through the small opening at the base of the altar and joins the pile on the ground.)N^&There's no sand in the jar!/,There's no reason to put that in the hole. I$ Rice paddy, Yumo provinceMN?\b\tYou are neck-deep in a verdant rice paddy which stretches as far as the eye can see in every direction. Approximately a hundred feet to the north, a narrow dirt road cuts through the emerald plain like a scar. N!@ ! N@ On this road, still several miles away and barely visible beneath the setting sun to the west, a small group of horsemen are slowly making their way towards your ambush site.C You can't go that way.D You can't go that way. ==There's nothing but rice paddy for miles in that direction.? SSThe riders haven't arrived yet, and you don't want to spring your trap too early. o o o = Meigi UUMeigi, your close friend, is a brave, grizzled veteran samurai in his late forties.> SS\b\tYour close friend Meigi is here, tensed in anticipation of the coming battle. MO actorNH BMO actorN*H#Why would you attack your friend?{ | U **He's a little preoccupied at the moment. **He's a little preoccupied at the moment.#MOactorioNI ''This isn't the time for conversation.T 33He's too busy right now to answer your questions!SMOvdpiN[I+He's too busy right now to listen to you!*MNJy\b\tMeigi turns to you and says, "These are experienced warriors we are up against. I hope your force is up to this." CNJMN}K\b\t"What are you implying?", you reply, angered. "My men are well trained, and very disciplined. They are more than ready. How dare you insult their honor and mine by..." CNKMNPM\b\t"I apologize, Kaneiji, I meant no offense," he says quickly. "I have the highest respect for your leadership abilities. You have proven yourself often enough. It's just that lately... your attentions have been... elsewhere. Your men's drills have not been quite as focused as they were a few months ago. Weapons training in particular has been lax. I am worried that they might be losing their edge. " CNMtMNNK\b\tYou feel blood darken your face as hot rage overtakes you, but a part of you realizes that there may be some truth to Meigi's observations. You let out a soft sigh and lower your head. \n\t"Perhaps you are right, my friend," you say. "Maybe I have been neglecting my duties. Maybe I am spending too much time with her..." CNOLMNXP,\b\tMeigi smiles slightly. "I have seen her," he says. "She is very beautiful. I don't blame you for wanting to spend every moment in her presence. If I were a younger man, you might have a rival. Just remember what you are. Your duty to the daimyo should always be foremost in your heart." C|MNP\\b\tYou bow your head. "Of course, Meigi," you say. "I have been foolish. I am sorry." C MN7U\b\t"You are young and you are in love. Of course you are foolish," Meigi laughs. He looks at you thoughtfully for a few moments, and when he speaks again his tone is serious. "Kaneiji," he says. "There is something you should know. " He takes a deep breath before continuing.\n\t"I'm sure you know by now that the daimyo is interested in Gio. You've seen the way he looks at her... I tell you this as a friend, Kaneiji... Let her go. I have heard rumors that he has written her parents to ask for her hand..."\n\t"No!!" you shout, forgetting where you are. Grass-covered helmets pop up everywhere as your men look at you, startled, and you quickly lower your voice again. "Gio is the palace musician, Meigi!" you protest. "The daimyo wouldn't wed below his station..."\n\t"Nevertheless, " Meigi interrupts, "let her go, Kaneiji. If not for your sake, then for hers..." Suddenly he stops, as his eyes focus on the road to the north. "Get ready," he whispers. "They are approaching." !>&>& f%%%0 katana aaIt's a well-crafted, straight-edged katana. Your name is etched in spidery Kanji on the blade.MO actorNc>ZMO actorN>;It wouldn't be wise to drop your katana at this moment... <&> jarshMN'The two jars are made of clay. On closer inspection, it looks like one of the jars is a bit larger than the other; The larger jar has the Kanji character representing the number "5" carved into it, while the smaller one has the Kanji number "3" carved into it.@You can refer to the jars as "five" and "three" if you wish...NF(f6MO actorN~(The jars are lidless.ifjh I  & sand ddThe sand consists mostly of tiny, oval-shaped white stones that resemble miniature grains of rice.MO actorNf9MO actorN9kYou really don't have anywhere to put it, and you don't feel like carrying a bunch of sand around anyway.MO actorNC:%KMO actorNg!:,There's nothing in the sand but more sand.MO actorN:oJust refer to the jars themselves instead of the sand (Ex: "POUR LARGE IN HOLE", "POUR SMALL IN HOLE", etc.).MOactorioNLD;pJust refer to the jars themselves instead of the sand( Ex: "POUR LARGE IN HOLE", "POUR SMALL IN HOLE", etc. ).MOactorioN;kJust refer to the jars instead of the sand (Ex: "FILL LARGE", "EMPTY SMALL", "POUR LARGE IN HOLE", etc.).N <Hint, hint... !ZZZ& pile of sand ;;It's a small pile of white sand at the foot of the altar.MO actorNn<%JMO actorN<+There's nothing in the sandpile but sand.MO actorN@=IMO actorNZ=*You have no reason to take the sandpile. ! w w w =  horsemen NNThe riders are well-armed Matzumu clansmen, mounted on fine black stallions.>kMN[Y\b\tThe bandits are now in range, riding by your position single-file at a slow gallop. MO actorNb\b\t"Attack!!!" you scream as you leap from your concealed position. Arrows and javelins fly as your troops follow your lead. Horses and riders alike fall lifeless to the earth, and a confused chorus of screams erupts from the bandits as they realize what is happening. Several survivors of your initial charge spur their mounts in blind panic, unaware of the worse fate that awaits them; In moments, they appear to vanish into the earth as they plunge headlong into the deep, spike-filled pit your men had dug hours before. The remaining bandits at the rear of the file draw rein and rally protectively around a man riding on an armored white horse. This man, who had somehow escaped your notice until now, is a fearsome giant, clad in black plate mail and wielding a great battle-axe. His size and bearing suggest that he must be the leader of the group. \n\tAs this fact registers in your mind, the giant and his small contingent of bodyguards abruptly charge into the rice paddy on the opposite side of the road, taking your men in that location completely by surprise. Before they can react, the horsemen burst through their positions and race into the rice fields behind them. \n\t"Don't let them escape!" you hear Meigi shouting at you from a distance. Cursing, you charge into the fray and grab the reins of a riderless stallion. In one swift, fluid motion you mount the frightened beast and spur it after the escaping brigands. The horse you took is a swift one; you quickly close the gap between yourself and the horsemen. Though you're outnumbered four to one, you feel no fear as you draw within a sword's reach of the nearest bandit...\b\b\bNb>{ | U ;;Your orders were to kill the bandits, not talk to them... ;;Your orders were to kill the bandits, not talk to them...#MOactorioN<c_MOactorioNeEd;Your orders were to kill the bandits, not talk to them...T ;;Your orders were to kill the bandits, not talk to them...cMOvdpiN d;Your orders were to kill the bandits, not talk to them...* www&C road EEIt's a well-traveled trade route that runs throughout the province. C sun ^^The setting sun is melting into the horizon, slowly dissolving into a bright crimson puddle. j j j& rice NNThe lush plain looks almost surreal in the coppery light of the setting sun.MO actorNyCMO actorNPDoYou absent-mindedly pluck a green ribbon and twist it between your fingers, then drop it after a few minutes.MO actorN1D%xMO actorNUDYYou look around, making sure that all of your men are well concealed in the rice paddy.MO actorN'E(hMO actorNEIYou pluck a stem of grass and chew on it for a while, then spit it out. "C  horsemen They're a small group of Matzumu clan bandits who have been harassing the citizens of the province for weeks. The daimyo has ordered you and Meigi to drive them out. = men Your troops are armed to the teeth with bows, spears, and swords, and have stuffed clumps of grass into their armor and helmets to camouflage themselves.>hMNVV\b\tYour men are here, crouching in the rice paddy, waiting for the order to attack. MO actorN9V CMO actorN]W$Why would you attack your own men?{ | U EEThey're a little preoccupied at the moment, waiting for the ambush. EEThey're a little preoccupied at the moment, waiting for the ambush.#MOactorioNL>X ''This isn't the time for conversation.T TTYou decide to wait until after the battle to have a conversation with your troops.MOvdpiNY} ]NgYMYour men are already in position; the riders aren't in attacking range yet.*@> ! 1NY!The riders aren't in range yet.*  B  weapons KKYour troop's weapons are sharpened and ready to taste the enemies' blood. z999$ BattleMN/gM\b\tYou are deep in the rice paddy, far from the ambush site to the south.   pNgd Directly ahead of you, three bodyguards and and their leader are racing away as fast as they can. ..If you retreat now, the bandits will escape!___&  stallions kkThe bandits are riding gorgeous, jet-black stallions, most likely stolen from some wealthy lord's stable.#`MOavipNe) 2N9f%They're too far away at the moment.*"MMOavdpNNf%They're too far away at the moment.* l , , , =  bodyguards There are three bodyguards, mounted on black stallions, who are following their apparent leader, a giant warrior mounted on a white stallion.>tMNvjb\b\tThe bandits cast frantic glances over their shoulders at you as you slowly close in on them. MO actorN:j MO actorN^3pjYou draw close to the nearest bodyguard and strike out viciously with your sword. He raises a hand in a feeble effort to defend himself, and your swordstroke neatly severs his arm above the elbow. The bandit stares dumbfounded at the bloody stump as he slowly topples from his mount. The remaining bodyguards' faces turn white and they quickly scatter in opposite directions, leaving their leader to fend for himself.\n\tThe giant warrior, noticing his guards' desertion, abruptly halts at the top of a low rise and wheels his mount around towards you. You bring your own horse to a stop a short distance away. The giant regards you insolently, and when he speaks his tone is mocking and full of arrogance. \n\t"I know who you are, pup," he spits. "You're Shinobu's little lapdog, aren't you? You think that just because you've slain a few worthless thieves you're ready to take on a true warrior?" He laughs, raising his great axe skyward. "Come, boy," he yells. "Today you die!" \n\tHe spurs his great warhorse forward and charges you, swinging wildly as he does so. You jerk your mount quickly to one side to avoid being trampled, but the warrior's axe manages to graze your stallion's flank, causing him to rear and buck in fright. You grab the reins tightly in an attempt to regain control, at the same time trying to stay out of the deadly path of the giant's battle-axe.N^\p!>&!&N^p!&N^p&&CN^q{ | U ;;Your orders were to kill the bandits, not talk to them... ;;Your orders were to kill the bandits, not talk to them...#MOactorioNq_MOactorioN er;Your orders were to kill the bandits, not talk to them...T ;;Your orders were to kill the bandits, not talk to them...cMOvdpiN s;Your orders were to kill the bandits, not talk to them...* B  rice paddy ggThe rice paddy is difficult terrain to fight on, swampy underfoot and covered with leg-snaring grass. & leader ``He's a giant warrior in black plate mail, wielding a battle-axe and riding a fine white horse.#MOavipNv) SN wFHe's currently surrounded by three bodyguards; you can't get to him.*"nMOavdpNwFHe's currently surrounded by three bodyguards; you can't get to him.* f f f& bandit horses ooThe bandits are riding black stallions; unfortunately for them, their horses aren't quite as fast as yours...#tMOavipNHt) FNt9It's impossible to do that while the horses are moving.*"aMOavdpNu9It's impossible to do that while the horses are moving.* MO actorNu MO actorNuYou slash at the nearest horse's hindquarters and open a shallow wound. However, the racing horse doesn't even seem to notice it.{ |  &= BBHe's a giant warrior in black plate mail, wielding a battle-axe.>nMNy\The giant warrior is here, slowly swinging his huge axe, looking for an opening to strike.QMNyKNzNgzH\b\tThe giant warrior swings his great axe, nearly severing your head.NpzNxzA\b\tThe warrior swings, grazing you with the edge of his blade.NzxNzN{_\b\tYou manage to duck just in time to avoid a mighty swipe. "Coward!" the warrior screams. N9{NA{N{`\b\tThe giant attempts to ram you, but you somehow manage to get your mount out of harm's way.N{{N{C\b\tThe warrior circles around you, trying to get on your flank. N|"NU ##This is no time for conversation! ##This is no time for conversation!#MOactorioN~|GMOactorioN|#This is no time for conversation!T ##This is no time for conversation! 0MO actorN-K} ! N-}You swing wildly and miss.\b\tYour mount is bucking and jerking uncontrollably. It's nearly impossible to attack the warrior.{N-l~oYou're at a tactical disadvantage; the warrior nearly chops your head off as you attempt a swing at his legs.{ | cMOvdpiNs~;Your orders were to kill the bandits, not talk to them...* &  warhorse TTIt's a huge, muscular beast which is armored, like its rider, in black plate mail. MO actorN> ! NzYour mount is bucking and jerking erratically, making it nearly impossible to get a clean strike at the warrior's horse.dN\b\tYou dash forward and slash one of the warhorse's unprotected forelegs. The meaty tendon snaps and the muscular leg buckles, causing both the horse and warrior to fall heavily to the earth. The giant screams in agony as a thousand pounds of horseflesh lands on his legs, cracking bones and pinning him to the ground. The warrior can only watch, helpless, as you slowly approach him and point the sharp blade of your katana at his throat.\n\t"Finish it..." he croaks, his face contorted in pain. You nod your head in silence and raise your blade to deliver the merciful killing stroke. \n\t"Wait, Kaneiji..." \n\tYou stay your hand as Meigi's voice drifts to you across the field. You turn around to see the old samurai racing towards you on horseback. "Don't kill him!" he shouts, breathless. Reluctantly, you shake the blood from your blade and sheath it as Meigi reaches your position. \n\t"Our orders..." you protest, as the veteran dismounts by your side.\n\t"Daimyo Shinobu will want this one alive," Meigi says. "He's Ryuko Matzumu, one of the clan's chieftains. He will be a most useful negotiating tool."\n\tYou grunt your assent and look into Ryuko's pain- filled eyes. \n\t"Fortune has smiled upon you today, friend," you say. "The daimyo wants to negotiate a peace treaty with your clan. Conduct yourself with honor and you might even get home with all of your limbs intact." \n\tThe wounded giant manages a bitter, blood-filled smile.\n\t"You'll soon wish you'd killed me, Kaneiji," he whispers. \b\tWithout warning, the world slowly swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\tNՇ!>&! NA!>&!>&NH!>I&6>&{ |  kkk& armor ::It's thick steel plate, bearing scars from many battles. XXX& axe ))It's a sharp, double-bladed battle-axe.   &  black horse ooThe black stallion is a beautiful, swift mount. He's coated in a rich lather of sweat from the recent chase.AMO actorN"You're already riding the horse!AMO actorNԉ"You're already riding the horse!yMO actorN/zmMO actorNS1> ! RNSzCYou'd break your neck if you jumped off the horse at this speed!!NS}You leap from the saddle and land gracefully on the ground. Suddenly, the frightened horse bucks and pull the reins from your grasp. Before you can seize them again, the horse bolts away across the field.!<&CNS̋ iMO actorNJIt's probably not a good idea to kill your horse while you're riding it!mMO actorN58> ! RN5CYou'd break your neck if you jumped off the horse at this speed!!N5You leap from the saddle and land gracefully on the ground. Suddenly, the frightened horse bucks and pull the reins from your grasp. Before you can seize them again, the horse bolts away across the field.!<&CN5ԍ ccc0 marble raven --It's a six-inch raven made of black marble. aaa0  marble crow ,,It's a six-inch crow made of black marble. ___0  marble owl ++It's a six-inch owl made of white marble. aaa0  marble dove ,,It's a six-inch dove made of white marble. aaa0  marble swan ,,It's a six-inch swan made of white marble.   red nest VVIt's a wooden nest which has been painted red. It's located at the top of the tree. ;  orange nest qqIt's a wooden nest which has been painted orange. It's located beneath the red nest, near the top of the tree. ;  yellow nest \\It's a wooden nest which has been painted yellow. It's located in the middle of the tree. ;  green nest vvIt's a wooden nest which has been painted green. It's located beneath the yellow nest, near the bottom of the tree. ;  blue nest __It's a wooden nest which has been painted blue. It's located at the very bottom of the tree. ;X$  LibrarywMN*~N+^\b\tSmoke fills your nostrils and stings your eyes as the palace library goes up in flames. Your torch dances among the burning, scroll-filled shelves, setting the words of poets and warriors alike ablaze. You smile as you approach the gingko tree in the middle of the library, knowing that this room is the daimyo's favorite place in the palace.N',"N -\b\tThe library is an inferno; scraps of burning parchment float in the air like lightning bugs around the gingko tree. All around you, thick wooden shelves and paper scrolls blaze like a funeral pyre.N- ;;The smell of smoke, thick and acrid, fills your nostrils. //You can't bring yourself to leave just yet...0  0 torch UUYour torch is burning nicely, perhaps fueled by your rage and thirst for vengeance.IMO actorN=0JMOactordobjN\0 aN0RYou touch your torch to a row of wooden shelves, which catches fire immediately., NK1You set fire to a small pile of scrolls that hasn't yet been entirely consumed by the flames. They erupt in a satisfying pyre. wN2UWith a cold smile on your face, you put the daimyo's gingko tree to the torch. It erupts in a burst of flame that reaches the ceiling, blasting you with an intense wave of searing heat. You back out of the library slowly as it collapses around you, envisioning the daimyo's wizened, treacherous face blackening in the roaring flames.\b\tN 3>That won't burn.MO actorNc=3PMO actorNV31There is a lot more here that you wish to burn. FQMN"It's a wooden shrine, about eight feet tall and four feet wide, which is covered in kanji characters. There's a statue inside it.>= 6 @N4\b\tThe statue is glowing with a soft amber light. ;& statueMNAIt's a lacquered wood statue of an old man with a large forehead, with a tiny crow on one shoulder and a turtle on the other.>= 6 NR \b\tOddly, you notice that the statue is glowing with a faint amber light. As you watch, transfixed, the old man suddenly begins to move. He holds out a wooden hand, and the tiny crow on his shoulder hops onto it. The crow opens its beak and spits a tiny model of a rat into the old man's open palm, which he places on the floor at your feet. As you reach down to take your new find, the old man returns to his solid wood state. Faintly, you hear the sound of a crow cawing in the distance.N >=&"=MO actorN0 MO actorN `It's not really a big statue, maybe three feet tall, but it's still too large to carry around. 206 "Kato" scroll ppIt appears to be a haiku:\b\tI kill an ant, and realize my three children have been watching.\b\t-Shuson Kato MN < 06 "Murakami" scroll wwIt appears to be a haiku:\b\tFirst autumn morning, the mirror I stare into shows my father's face.\b\t-Kijo Murakami MN < 06 "Ryusui" scroll jjIt appears to be a haiku:\b\tIn all this cool, is the moon also sleeping there, in the pool?\b\t-Ryusui MN<  06 "Basho" scroll wwIt appears to be a haiku:\b\tClouds appear and bring men a chance to rest from looking at the moon.\b\t-Matsuo Basho MN< 06 "Takehama" scroll yyIt appears to be a haiku:\b\tWinds that blow- ask them, which leaf on the tree will be next to go.\b\t-Kyoshi Takehama MN< ZZZ06 "Maresuke" scroll It's a poem:\b\tMountain and river, grass and tree, grow more barren\b\tFor ten miles winds smell of blood in the fresh battlefield\b\tConquering horses do not advance nor do men talk; outside Jinzhou Castle, I stand in the setting sun\b\b\t-Nogi Maresuke MN#< ^^^06 "Tsuji" scroll  This one is a bit longer than the others:\b\tRaven, Dove, Owl, Crow and Swan were nesting in a tree;\b\tAt one end of the tree sat a White bird, at the other a Black bird;\b\tRaven was not at the top of the tree, nor was he next to Dove;\b\tOwl was not in the middle of the tree, and the two birds closest to him were different colors from one another;\b\tThe two birds at the bottom of the tree were the same color.\b\b\t-Gio Tsuji\b\t(If this is a poem, something definitely was lost in the translation, you think...)MN<   &  shelves The red cedar shelves are piled high with scrolls. Tiny brass plaques on the shelves have dates written on them ranging from the years 1400 through 1700.MO actorN%MO actorN|It would take you all night to search through all these shelves. Try searching by date instead (Ex: "SEARCH SHELF 1532"). &%'% ;  &  scrolls 88There are hundreds of them, rolled up in wooden cases.MO actorNf`'KMO actorNz,There's no way you could read all of them.MO actorNMO actorN'uYou can't take all of them, obviously. Unless you know exactly what you're looking for you'll never find anything. ;CCC&  figurines ==There are five of them: a raven, crow, owl, dove, and swan.#iMOavipNm) ;Nm`.You have to specify which figurine you mean.*"VMOavdpN.You have to specify which figurine you mean.* ;D& tree It's a gingko tree, all right, with fan-shaped leaves and yellow flowers, and it's approximately six feet tall. It's sprouting from a hole in the middle of the library's floor. There's some writing carved into its bark.MO actorN ,RMO actorN.G3The tree's only six feet tall. What's the point?MO actorN'&MO actorN ;&  writing 66It's in Japanese, unfortunately. You can't read it.MO actorNd3 '#MO actorNM < ;zzzB leaves and flowers 66There's nothing unusual about the leaves or flowers. ;&PMO actorN MO actorN? !eYou pick up the nest, but decide you really don't feel like carrying it around, so you put it back.MO actorNR!PMOactordobjNm! E  E  E  E  ;N",There's no reason to put that in the nest.N"Done.)Paaa&  figurines ccThere are five of them: a red nest, an orange nest, a yellow nest, a green nest, and a blue nest.#eMOavipN") 7N)#*You have to specify which nest you mean.*"RMOavdpNE#*You have to specify which nest you mean.* ;ccc&# shelf0MOlN+'< D xHN+ (9The shelves are dated from the years 1400 through 1700.R N>N+(To your delight, the scrolls on this shelf appear to have been translated into English. You scoop them up and place them in a pile on the library floor.;>&N+#);>&;>&;>&N+j);>&;>&N+);>&"0N+)$There's nothing else on the shelf.ZN+A*NThe scrolls on this shelf are all written in Japanese. You can't read them. ;B clouds IIThe wind sculpts the black, billowing clouds into vague sinister forms. n- - -&  shelves 55The shelves are burning and blackening in the fire.MO actorNc".BMO actorN=.#The shelves are too hot to touch. %K#MOactorioN. v555&  scrolls ==The library scrolls are crisping and crackling in the fire.MO actorNkX5'PMO actorNr51You're not in the mood to read at the moment...MO actorN5\MO actorN  6=There's nothing here that you want to save from the flames.MO actorNk-6BMO actorNH6#The scrolls are too hot to touch. %K#MOactorioN6 &  gingko tree ddIt's the daimyo's favorite in the palace; a short tree with fan- shaped leaves and yellow flowers.K#MOactorioN4 $ Outside libraryMNR;>ANJ>\b\tYou step outside the library just in time; a few moments later the entire structure collapses in a heap of burning timbers. Looking around, you see that your men are setting fires all over the compound without resistance- for some reason, the palace guard is nowhere to be found. You turn northwest, towards the main building, determined to slay the murderous Shinobu and to find your beloved Gio. The orchid she gave you before you left on your ill-fated journey to Buke, long since wilted, is still stitched to the breastplate of your armor. You touch it once, for luck, and start up the brick path. Suddenly, a figure materializes out of the haze of smoke ahead of you. You draw your blade, but quickly sheath it again as you recognize Meigi's weathered face."N>&CN?\b\tYou are standing on the scorched lawn outside the ruins of the palace library. The only structure within the walls which isn't burning is the main building to the northwest. //There's nothing that way but flames and ruin.F Meigi is in your way.B leaves and flowers IIThe beautiful leaves and flowers are slowly wilting in the savage heat. |<<<& fire LLThe flames are steadily devouring the room. You revel in the destruction.#ZMOavipNwZ8) ,The fire is too hot to touch.Nw8*"ZMOavdpN8) ,The fire is too hot to touch.N 9* & smoke 66The black, choking smoke is slowly filling the room.MO actorNb9<MO actorN9It smells vaguely of cedar.#\MOavipN9) .N@:!You're a samurai, not a wizard.*"\MOavdpN*U:) .N*:!You're a samurai, not a wizard.* z9990 guy named Joe  [ [ [ = Meigi RRMeigi's features are black with soot, giving him the appearance of a fire demon.> \b\tMeigi is here. MO actorN@ BMO actorN@#Why would you attack your friend?{ | U "I don't need that," he says. He's not interested.#MOactorioN[A He grunts distractedly.T "Not now, Kaneiji," he says.<MOvdpiNUBMeigi ignores you.*9MN]I\b\tMeigi walks up to you and clasps your hand in greeting. "My men have taken up positions all around the main palace," he says without preamble. "They will storm the building on your orders. All of them are eager to avenge our brothers who were massacred at the Buke pass."\n\tYou nod grimly. "Have you found Gio?" you ask.\n\tThe old samurai shakes his head. "We have seen no one so far," he says. He looks around slowly, peering into the shadows around you. Nothing moves save for the leaping flames and billowing clouds of smoke. "I don't like this, Kaneiji," he says softly. "Where is the palace guard? The gate was wide open when we arrived; it's as if they're expecting us..."\n\t"Nonsense," you reply. "The guard probably deserted when they saw us approaching. And Shinobu is no doubt cowering like a whipped dog underneath his golden throne."\n\t"Perhaps..." Meigi says thoughtfully. "But we should exercise caution, just the same..."\n\t"You're starting to sound like an old man, my friend," you say, smiling. "Spread the word. We will attack at once."\n\tMeigi nods curtly and vanishes into the smoke. Moments later, a shrill horn blast cuts through the air, followed by the sounds of cursing and yelling as the soldiers drag a large battering ram into position in front of the inner gate. You unsheath your katana, watching the firelight play across the sharpened steel. "Soon, my love," you whisper, touching the orchid once more. "Soon..." \b\tWithout warning, the world slowly swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death- like state you have no idea where or even who you are...\b\tNI;>&! !>&NIA6>=&!>&N*J& aaa0  marble dove ,,It's a six-inch dove made of white marble. & ruins ``The library is a spiraling tower of searing flame. It's quite pleasurable to watch it burn...#vMOavipNK) HNVK2The fire is too hot; you can't even get near it.NkK*"vMOavdpNvK) HNK2The fire is too hot; you can't even get near it.NK* TTTB lawn $$It's just a narrow strip of grass. ,& sign ccIt's a large sign, brand new by the looks of it, with writing on it in both English and Japanese. The sign reads as follows: \b\t"The reflecting pools were built in the fourteenth century by the daimyo Shinjuku to celebrate his victory over the Ebu clan. It is said that the pools were stocked with magical fish called 'Chowa', which only appeared beneath a full moon." ,d$$$B  maple trees bbThe maples reach wistfully into the night sky, as if trying to catch the moon in their branches.MO actorN[MO actorN<It's generally not a good idea to climb trees in the dark. ,N   =  yellow fishMNMIt's a small yellow fish<  ON@, swimming in slow, lazy circles around the edges of the pool..T Fish can't talk.U &&The fish happily ignores your offer. The fish could care less.#MOactorioN  The fish could care less. MO actorNy   ""Pick on something your own size!?MOvdpiNr The fish ignores you.*MO actorN  MO actorN. >  N.f The yellow fish is slow and easy to catch, but with nothing to contain it in, it quickly squirms out of your grasp and splashes back into the pool.<  N. uYou don't need to carry the fish around with your bare hands; if you want to PUT the fish somewhere, just say so...8N.K ,Try "PUT YELLOW FISH IN BUCKET" instead...#MOactorioNl 5#MOactorioN MN <  Ni \b\tThe blue fish finally catches up to the yellow fish and devours it messily. In a moment, nothing is left of the yellow fish but a few scraps of white flesh.!<& MO actorN MO actorNxDropping the fish will more than likely kill it. It would be better if you simply "PUT" the fish where you want it...EMO actorNY&This isn't the Seattle fish market!! ,  small pool It's a small reflecting pool, roughly oval in shape, five feet wide and ten feet long. It appears to be no more than a foot deep.MO actorNPMOactordobjN  >  MN\>You need to find a way to properly transport the fish first.N.You put the yellow fish into the large pool.>&>  E >  N As you place the yellow fish into the pool, the blue fish becomes agitated, turns, and begins swimming after the yellow fish.C>  E >  N As you put the yellow fish back into the water, the other two fish calm down and resume swimming in slow circles around the edge of the pool.C^N >  MN>You need to find a way to properly transport the fish first.Nd,You put the blue fish into the small pool.N|>&>  E >  N t As you place the blue fish into the pool, it becomes agitated, turns, and begins swimming after the yellow fish.CNZ >  E >  N ~ As you place the blue fish into the pool, the green fish becomes agitated, turns, and begins swimming after the blue fish.CNC!;NO! >  MN!>You need to find a way to properly transport the fish first.N!+You put the green fish in the small pool.N">&>  E >  N"s As you place the green fish into the pool, it becomes agitated, turns, and begins swimming after the blue fish.CN">  E >  N}# As you put the green fish back into the water, the other two fish calm down and resume swimming in slow circles around the edge of the pool.CN#N#)PvMO actorN{#wAMO actorN$"You don't feel like getting wet. ,J   =  blue fishMNIt's a medium-sized blue fish<  ON?@, swimming in slow, lazy circles around the edges of the pool..T Fish can't talk.U &&The fish happily ignores your offer. The fish could care less.#MOactorioN"G The fish could care less. MO actorN|  ##Pick on something your own size!.?MOvdpiNThe fish ignores you.*MO actorN[MO actorN2u>  N2The blue fish is slow and easy to catch, but with nothing to contain it in, it quickly squirms out of your grasp and splashes back into the pool.<  N2uYou don't need to carry the fish around with your bare hands; if you want to PUT the fish somewhere, just say so...6N2*Try "PUT BLUE FISH IN BUCKET" instead...#MOactorioN5#MOactorioN3MNU<  N\b\tThe green fish finally catches up to the blue fish and devours it messily. In a moment, nothing is left of the blue fish but a few scraps of white flesh.!<& MO actorNRMO actorNxDropping the fish will more than likely kill it. It would be better if you simply "PUT" the fish where you want it...EMO actorN&This isn't the Seattle fish market!! j***=  green fishMNIt's a large green fish<  ON@, swimming in slow, lazy circles around the edges of the pool..T Fish can't talk.U &&The fish happily ignores your offer. The fish could care less.#MOactorioN The fish could care less. MO actorNwq  ##Pick on something your own size!.?MOvdpiNThe fish ignores you.*MO actorN MO actorN->  N-The green fish is slow and easy to catch, but with nothing to contain it in, it quickly squirms out of your grasp and splashes back into the pool.<  N-XuYou don't need to carry the fish around with your bare hands; if you want to PUT the fish somewhere, just say so...7N-+Try "PUT GREEN FISH IN BUCKET" instead...#MOactorioN5#MOactorioNMO actorNMO actorN7dxDropping the fish will more than likely kill it. It would be better if you simply "PUT" the fish where you want it...EMO actorN&This isn't the Seattle fish market!!      large pool It's a large reflecting pool, roughly oval in shape, ten feet wide and twenty feet long. It appears to be no more than a foot deep.MO actorNA%P^MOactordobjN\% T>  MN%>You need to find a way to properly transport the fish first.N%.You put the yellow fish into the large pool.>&>  E >  N& As you place the yellow fish into the pool, the blue fish becomes agitated, turns, and begins swimming after the yellow fish.CN/' Z>  MN'>You need to find a way to properly transport the fish first.N',You put the blue fish into the large pool.N'>&>  E >  N(t As you place the blue fish into the pool, it becomes agitated, turns, and begins swimming after the yellow fish.CN(>  E >  Ni)~ As you place the blue fish into the pool, the green fish becomes agitated, turns, and begins swimming after the blue fish.CN)>  E >  0N, Within moments, all three fish appear to settle into the same lazy, circular pattern you observed them swimming in the smaller pool. Suddenly, the largest fish darts for the center of the pool, towards the fishing line. In an instant the line is pulled taut, and the pole bends sharply towards the water. As the big fish struggles on the hook, you notice a faint amber glow beginning to emanate from the statue of the old fisherman...\b\tWithout warning, the world slowly swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\t!>&,&N,!&3>&ANC-" CKNs-tN}- U>  MN->You need to find a way to properly transport the fish first.N.+You put the green fish in the large pool.N0.>&>  E >  N.s As you place the green fish into the pool, it becomes agitated, turns, and begins swimming after the blue fish.CN/N(/)PvMO actorN? >/wAMO actorNc Y/"You don't feel like getting wet. ,p///&  dead fish ,,It's a large green fish. It's quite dead.MO actorN\;VMO actorN9;7There's no reason to carry around a smelly dead fish.MO actorN;&MO actorN;Phew! & worm BBIt's a fat, bloody nightcrawler, wriggling feebly upon the hook.MO actorNmy?MO actorNh@Look, I'm cutting you some slack here. As I already explained, I didn't want to go through the trouble of making you have to find bait, etc., so here it is. Leave the poor worm alone and we'll just let bygones be bygones, OK? & pools KKThere are two shallow reflecting pools here, a large one and a small one. ,FQMN0It's a wooden shrine, about eight feet tall and four feet wide, which is covered in kanji characters. There's a statue inside it.>< 6 @NJ14\b\tThe statue is glowing with a soft amber light. ,xxx& statueMN2It's a lacquered wood statue of an old man with a fishing pole. The shrine is at the very edge of the larger pool, and the statue's pole protrudes over the water. A line runs from the fishing pole into the pool.N3>< 6 Np5y\b\tOddly, you notice that the statue is glowing with a faint amber light. Suddenly, the statue of the fisherman comes to life before your very eyes. He yanks on his fishing pole, and the line goes taut as something heavy on the other end struggles beneath the water. After a brief battle, the victorious fisherman lifts a large green fish out of the pond. Smiling, the man reaches into the fish's mouth and retrieves a tiny wooden model, which he drops gently at your feet. As you reach down to take your new find, the fisherman returns to his solid wood state. Faintly, you hear the sound of waves splashing in the distance.N5><&"<MO actorN16MO actorN6`It's not really a big statue, maybe three feet tall, but it's still too large to carry around.   & fishing line uuIt's a sturdy length of fishing line that runs from the end of the statue's pole into the middle of the large pool.MO actorN7_MO actorN8@The line is secured firmly to the pole. You can't get it off.MO actorN18(MO actorNU8Standing next to the statue, you reach out and pull the line towards you. After a few moments, you manage to get it onto the shore, revealing a steel hook at its end.,&"> , ;NU-9/ There's a fish on the other end of the line.NU9jMO actorN9KThe line is tied in a complicated fishing knot. You can't get it undone.MO actorN4:uYou saw away at the line with your sword, but incredibly, even the sharp steel of your katana can't cut through it. ,@& hookMN&<> , N<UIt's a stainless steel, barbed hook. On the end of it, a fat worm wriggles feebly.I was really tempted to add another step to this puzzle and have you go through the whole rigamarole of having to dig up a worm, bait the hook, etc., but I eventually decided it was not worth the effort, as it just would have made the game more tedious. You can thank me later.N=6N=*The hook has been swallowed by the fish.MO actorN>\MO actorN*s>=The hook is securely tied to the line and can't be removed.jMO actorN>KThe line is tied in a complicated fishing knot. You can't get it undone. & pole ~~It's actually part of the statue; a four foot length of wood jutting from the fisherman's hands. There's a line tied to it. , [[[B grass **The wet grass is cool beneath your skin. 3 d$$$B  maple trees bbThe maples reach wistfully into the night sky, as if trying to catch the moon in their branches.MO actorN\[MO actorN)]<It's generally not a good idea to climb trees in the dark. 3 & pools KKThere are two shallow reflecting pools here, a large one and a small one. 3 }}}  large pool It's a large reflecting pool, roughly oval in shape, ten feet wide and twenty feet long. It appears to be no more than a foot deep.MO actorN^P,MOactordobjN_Why?vMO actorN &_wAMO actorN1A_"You don't feel like getting wet. 3 {{{  small pool It's a small reflecting pool, roughly oval in shape, five feet wide and ten feet long. It appears to be no more than a foot deep.MO actorNk`P,MOactordobjN`Why?vMO actorN `wAMO actorN/`"You don't feel like getting wet. 3oooB  shadows 66The shadows drape your bodies in sheets of darkness. 34&  scaffolding The scaffolding covers the walls on all four sides of the room from floor to ceiling. It looks like there's a platform of some sort high up on one of the walls.MO actorNMO actorN>  SNDYou can't climb the scaffolding with that big stick in your hands.vN`Heart pounding, with only pale ghost-light to guide you, you climb up the metal scaffolding.\bO> 5ooo& plastic sheeting @@They're huge lengths of white plastic, covering the furniture.MO actorNwMO actorN\You remove the plastic from the furniture, revealing a throne, a table, and a sedan chair.!<&N/5&5&Nm5&5&!&N5&MO actorN}MO actorN>x  NYou saw at the tough sheeting for a few moments, then give up. This sword was obviously designed for cutting flesh, not plastic.With what? Your teeth?MO actorN{eMO actorN=The plastic is too thick and inflexible to tie to anything.N< %&#$  5e e e& 11The plastic sheeting is in a pile on the floor.  plasticMO actorN_/ LMO actorNI -It's really much too bulky to carry around.MO actorN MO actorN >x  N? You saw at the tough sheeting for a few moments, then give up. This sword was obviously designed for cutting flesh, not plastic.With what? Your teeth?MO actorN eMO actorN =The plastic is too thick and inflexible to tie to anything.N  k k k&(  sedan chair ttIt's a long, golden sedan chair, which is completely filled by a gigantic silk pillow. It looks very comfortable. MO actorNQpMO actorNQIt's made of gold. It's far too heavy to move (that's what servants are for!).   [[[& table &&It's a long, low table made of gold. &( mmIt's an enormous throne made of pure gold. It's encrusted with jewels and adorned with intricate carvings. throne yyy&  furniture DDYou can't really see it, since it's covered with plastic sheeting. 5&  furniture There are three large pieces of furniture in the throne room, all apparently made of solid gold; a throne, a table, and a sedan chair. &' pillow jjIt's a huge feather pillow with a silk covering. Judging by the stitching, it appears to be fairly new.MO actorNMO actorNIt takes all your strength to lift the pillow out of its golden frame; it must weigh over a hundred pounds. Exhausted, you dump it unceremoniously on the throne room floor.!<&N5& b! ! !&' pillow jjIt's a huge feather pillow with a silk covering. Judging by the stitching, it appears to be fairly new.MO actorNNMO actorN/You don't have the strength to lift it again.MO actorN<MO actorN5V<N5aYou push the heavy pillow across the room, until it comes to rest beneath the iron scaffolding."N5,)You've had enough exercise for one day.  ZZZ& jewels On closer inspection, it appears that the 'jewels' are actually made of glass. Perhaps the originals were transferred elsewhere.MO actorNuMO actorNVThere's no way to get them out of the throne even if you wanted to, which you don't. |||B  carvings BBThe throne is carved with intricate pictures of various deities. & cracks hhThe walls are covered with cracks and scorch marks; it looks as though there was a fire here recently. 5ooo&  trapdoorMN6>4^NOThe trapdoor is open, and there is a rusty ladder leading down into darkness.JN>The trapdoor is open, revealing a dark opening in the floor.iMO actorNjRMO actorN3You decide that it's really not worth the effort. 5vvvC  platform BBIt's a narrow plank of wood perched high amidst the scaffolding. 5cccB cement 11The cement is dry and stuck fast to the bucket.  cccB cement 11The cement is dry and stuck fast to the bucket. !;;;&'  platform It's a narrow plank of wood, about ten feet long, balanced precariously between two metal pipes. There isn't really anything to hold on to here, and it's a twenty foot drop to the floor below. These Japanese workers must make some serious money...#MOavipN--) ZN--MYou'd better not fool around with the plank while you're standing on it...*"uMOavdpN.MYou'd better not fool around with the plank while you're standing on it...* O"@& crack It's a big crack in the side of the bucket, two inches wide and six inches long, caused by the impact of hitting the throne room floor. ~ @@It's no use. The bucket is broken beyond all hopes of repair.#ppp&  scaffolding WWThe scaffolding covers the walls on all four sides of the room from floor to ceiling.MO actorN5MO actorN5>  SN6DYou can't climb the scaffolding with that big stick in your hands.>Na6(You climb back down the scaffolding.\b5> O%SSS&  wreckage !!The plywood wall lies in ruins. &XXX0   model key %%It's a small wooden model of a key.'t333$  CourtyardMN W ' N \b\t The full moon floats lazily overhead, bathing the courtyard in misty blue light. Pale mist covers the ground, and the large model ship seems to float on top of it, giving the scene a surreal, dreamlike quality.~Nb r\b\tThe courtyard seems to have disappeared. Nothing remains, save for you, the ghost, and the ship in the fog.C You can't go that way.D You can't go that way. BBThe warrior blocks your path, pointing emphatically at the ship.(  & display caseMN> < TTThe glass case contains a parchment, upon which are written three curious symbols. MO actorN  6MO actorN Vandalism won't help.    fMO actorN" h:MO actorNF- The case can't be opened. (),  & musicMN < Three symbols are written on the parchment in black ink: The first one is smudged beyond recognition. The second seems to show a flame with the Kanji numeral 1 beneath it. The third is a gold coin with the Kanji number 4 beneath it.MO actorN3 ' MO actorNW Three symbols are written on the parchment in black ink: The first one is smudged beyond recognition. The second seems to show a flame with the Kanji numeral 1 beneath it. The third is a gold coin with the Kanji number 4 beneath it.MO actorNh TMO actorN 5The parchment is behind glass and can't be removed. (*nnnB path 88They're long and winding paths made of deep red brick. (+X  ,'  tatami mat The woven tatami mat, which is raised up slightly from the floor, takes up most of the shrine, save for the narrow aisle around the edges that you are standing on.PMO actorN5  (NYou're already on the mat!^MO actorN.7You take off your shoes and step onto the tatami mat.>&MO actorN<&MO actorN0<MO actorNaMO actorN~>  VN3You get off the mat and put your shoes back on.\bN< >&$NYou're not on the mat!:MN($You need to get off the mat first.!MN<  (,DDD& statueMN>It's a life-sized statue of a beautiful woman, holding a four- stringed biwa in her hands, sitting cross-legged on the tatami mat.>& 6 qNK\b\tOddly, you notice that the statue is glowing with a faint amber light. You watch, entranced, as the statue slowly transforms from wood to flesh. The goddess closes her eyes and begins to play; you close yours as well as the slow, haunting melody casts a spell over you. After a short time, the song ends. Smiling sadly, the goddess retrieves a tiny model of a key from the folds of her kimono and places it gently at your feet. As you reach down to take your new find, the musician returns to her solid wood state. Faintly, you hear the sound of a biwa playing in the distance.>&&C- +-&gMN= \b\tThe samurai closes his eyes and begins to sing the same melody that the goddess sang moments ago. A cold breeze begins to stir from out of nowhere. He sings the phrase again and the wind grows stronger, stirring up clouds of dust that sting your eyes. The samurai's voice gets louder as he sings the verse a third time, hair whipping in the swelling gale. A fourth time, and you find yourself gripping the statue for support as a sudden gust from the north nearly sweeps you off your feet.\n\tThe samurai sings the refrain once more, ending with a loud shout that is echoed by a tremendous crashing noise to the south. The wind vanishes as abruptly as it arrived, leaving an unnatural stillness in its wake.\n\t"Sakoi!" the warrior commands, and walks off to the south.N'>L&"LN!>:&(>%&>&&N (.& biwaMN<It's quite an astonishing piece; The four strings appear to be made not of wood, but of some softer, more flexible material. There are five frets carved into the fretboard at regular intervals, each one a different symbol; one appears to be a tree, one a flame, another a mountain, one a coin, and another a wave.<1N% You wonder idly if it's playable.qMO actorNrMO actorNYou reach over and strum the strings with your fingers. The sound is terrible, and you stop. You think that you'd probably get a more musical result if you plucked the strings one at a time." ,/hhh&  strings 55There are four of them, varying slightly in length. +0  & first string %%It's the lowest string on the biwa.MO actorNX@MO actorN|[You pluck the first string."CN|1" 6N|*\n\tA pleasant note rings from the biwa.2" N|M*\n\tA pleasant note rings from the biwa.>> yN|m\n\tThe note you just played matches the pitch the ghost is singing, and his voice gets louder in response.3" 6N|+*\n\tA pleasant note rings from the biwa.4" 6N|z*\n\tA pleasant note rings from the biwa.5" 6N|*\n\tA pleasant note rings from the biwa.qrMN ! +1CCC&  tree fret @@It's a carving of a tree, located at the top of the fretboard.MO actorNp0MO actorN0"You press down on the tree fret."N1C!2!5No1!3!4MN1! +2DDD&  fire fret AAIt's a depiction of a small flame, located under the tree fret.MO actorNq2MO actorN2"You press down on the fire fret."N2C!1!5NJ3!3!4MN3! (3III&  water fret DDIt's a picture of a wave, carved into the bottom of the fretboard.MO actorNu48MO actorNN8#You press down on the water fret."N8C!2!5N8!1!4MN&9! +4AAA&  gold fret >>It's a carving of a gold coin, located above the water fret.MO actorNnT6MO actorNn6"You press down on the gold fret."N6C!2!5N7!3!1MNF7! +5KKK&  earth fret FFIt's a symbol of a mountain, located in the middle of the fretboard.MO actorNw}4MO actorN4#You press down on the earth fret."N4C!2!1N45!3!4MNo5! +6Q Q Q& second string ,,It's the second lowest string on the biwa.MO actorN` MO actorN You pluck the second string."N2!C>1" 6N!*\n\tA pleasant note rings from the biwa.>2" 6N!*\n\tA pleasant note rings from the biwa.>3" 6N$"*\n\tA pleasant note rings from the biwa.>4" 6Ns"*\n\tA pleasant note rings from the biwa.>5" 6N"*\n\tA pleasant note rings from the biwa.qrMN#! +74  & third string --It's the second highest string on the biwa.MO actorN`#7MO actorN#You pluck the third string."CN6$>1" 6N$*\n\tA pleasant note rings from the biwa.>2" 6N$*\n\tA pleasant note rings from the biwa.>3" 6N%%*\n\tA pleasant note rings from the biwa.>4" 6Nt%*\n\tA pleasant note rings from the biwa.>5" N%*\n\tA pleasant note rings from the biwa.>) ( N]&\b\tThe spirit responds visibly to the note; it looks as if the ghost is trying to say something, but its voice is too faint to hear.>> ( E >>! NB'\b\tThe spirit responds visibly to the sound, as if awakening from a trance. In a mournful tone, the ghost answers you with a sad note of his own, which matches the pitch you just played.N'>C>qrMN'! +84  & fourth string &&It's the highest string on the biwa.MO actorNZ(1MO actorN~(You pluck the fourth string."N~)C>1" 6N~g)*\n\tA pleasant note rings from the biwa.>2" 6N~)*\n\tA pleasant note rings from the biwa.>3" 6N~**\n\tA pleasant note rings from the biwa.>4" N~V**\n\tA pleasant note rings from the biwa.>> N~*e\n\tThe note you just played matches the pitch the ghost is singing, and his voice rises in volume.>C>N~.\b\tAs if inspired by the notes coming from the biwa, the spirit continues to sing in a mournful tone, his hollow voice becoming louder, gradually rising to a fevered pitch. Suddenly, the ghost begins to sing a different melody, darker and much more dissonant. Bright crimson light fills the shrine as the apparition sings, his voice now edged with malice rather than sadness. The ghost's body, now a blazing blood-red, slowly changes to white as his mournful dirge becomes a scream of rage. Unable to move, you watch with a mixture of awe and horror as the spirit transforms into a towering, howling pillar of ghostly fire, until your senses are overpowered by the whirling chaos of sound and light... \b\tWithout warning, the world swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\tN~/9>&"l!>>&N~J/A>5" 6N~/*\n\tA pleasant note rings from the biwa.qrMN/! +9$ Cell LL\b\tThe six-by-six cell has been your home for three days now. Feeble light seeps in from a single tiny window, barely illuminating the dingy straw mattress which is the sole piece of furniture. A horrible stench wafts from the small hole in the corner, and an occasional cockroach scuttles in from beneath the locked iron door. The smell is horrid.MN< 9 )#The guards are blocking the door.N= 9 dN82You step over the corpses and into the hall.\b\bNE>>C?.N"There's no use trying to escape.JMN>< 9 )#The guards are blocking the door.N>= 9 dNH2You step over the corpses and into the hall.\b\bNU>>C?.N"There's no use trying to escape.C You can't go that way.D You can't go that way.:\\\& > orchid **It's a shriveled, pitiful-looking thing.<NNN=  guards ^^The daimyo's henchmen quiver as they stare, hypnotized, at the shining katana in your hands.>TMNv*B\b\The guards slowly reach for their weapons, as if in a trance. )MO actorNg+\b\tYou lash out at the guard nearest to you, severing his windpipe in a spray of blood and cartilage. A quick thrust to the heart silences the other before he even has a chance to draw his sword. Both bodies slump to the floor silently.N+!<&9>=&{ | MOactorioN*+K ZN*=,KJust "ATTACK GUARDS" will do. You're obviously going to use the sword...(N*,Not with that you don't...U ))They stare at you, paralyzed with fear. ))They stare at you, paralyzed with fear.#MOactorioN95-MMOactorioNbX-)They stare at you, paralyzed with fear.T ))They stare at you, paralyzed with fear.QMOvdpiN.)They stare at you, paralyzed with fear.*=```& bodies **You don't have time to loot the corpses. >l+++$ Palace dungeon \b\tYou are in a dark, narrow hallway beneath the palace. Fading daylight from the tiny windows near the ceiling gives you barely enough light to see by.MN/>G > CN/04You need to do something about your pursuer first.>H > E >I > HN09The warrior steps into your path, blocking your escape.^L > E >I > YN1BYou take one last look at Ryuko's body before setting off again.!>L&>I > ZN1KThe soldiers have you completely surrounded. There's nowhere left to go.N2rYou pick a passage at random, looking back over your shoulder every few seconds to see if you are being pursued.NS2C You can't go that way.D You can't go that way.?J   &,  mattress ]]The moldy straw mattress is about three feet thick and takes up an entire wall of the cell. 9MO actorNn%nMO actorN<NqIdly, you pick through the matted, dirty straw. After digging around for a few minutes, you come across a tiny wooden object buried inside. Curiosity aroused, you extract the object and hold it up to the light."E&NMNAYou poke around in the straw some more but don't find anything.&%MNh\b\tA shadow passes across the window, momentarily plunging the room into darkness. Have the executioners come already?, you wonder idly. You hear a soft scraping noise as something is forced through the tiny opening. As the object drops to the floor, the shadow leaves. You hear soft footsteps running away as weak gray light fills your cell once again.9F&MNg\b\tYou hear the sound of footsteps approaching your cell door. You spare a glance at the window, and the fading daylight confirms the hour: sunset. Your executioners have finally arrived.CNMNh\b\tMuffled voices speak on the other side of the door; it sounds like there are at least two of them.CN^MNa\b\tNo matter. You calmly raise the sword above your head as the heavy outside bolt is lifted.CMN\b\tThe door swings open and two armed guards step into the cramped cell. Shock registers on their faces as their gazes lock onto the glistening steel blade in your hands.9><&N!>C&TMN \b\tYou make your way slowly down the narrow hallway, sword at the ready, eyes straining in the burgeoning darkness. You are unfamiliar with this area of the palace; you let your instincts be your guide as you navigate the twisting passageways of the dungeon, searching for the exit. Suddenly, you hear shouts of alarm from the direction of your cell. "He's escaped!..." Cursing silently, you pick up your pace. The daimyo's soldiers will be everywhere soon...\b\tYou freeze at the sound of a heavy armored footstep directly ahead of you.CNO>G&MN\b\t"Kaneiji..." a deep voice whispers from the shadows. "It's time for your execution..."\n\tA giant warrior steps out of the darkness, spinning a vicious double-headed axe in slow, lazy circles.\n\t"Ryuko," you reply softly. "I see that the daimyo has made his peace with the Matzumu clan at last." You push a lock of hair out of your face and are surprised to note that your hand is trembling slightly. You take a slow, deep breath to steady yourself. "Stand aside, Ryuko," you say evenly. "It will bring me no honor to kill the likes of you."\n\tThe warrior chuckles beneath his black steel mask. "Ah, Kaneiji," he sighs, advancing, "It will be a pleasure to watch you die..." !>G&N`>H& C  MN_\b\tYou hear the sounds of armored troops all around you. They're definitely getting closer.C  MNuh\b\t"This way!" someone shouts. You see bobbing shadows and torchlight approaching around the corner.C N MNq\b\tSuddenly, armored troops appear from both sides of the hallway. "We have him!" the nearest soldier shouts.NY>I&CIMN< MN< @  &  roaches NNThe little creatures have been your sole companions for the past three days.MO actorN|MO actorNYou reach down and snatch a cockroach off the floor. You're amazed that you have the strength and speed to perform even this simple task. After a few moments, the sensation of the squirming bug in your hand becomes unpleasant, and you let it go.MO actorN(MO actorNYou pick up one of the roaches and stuff it in your mouth. You swallow it quickly, nearly gagging on the wretched taste. At least it's nourishment, you reason... 9A{{{& window 66It's a tiny, barred window located near the ceiling.fMO actorNclh|MO actorN]There's nothing to open; the window is little more than a slot in the wall above your head.MO actorN zMO actorN-f[The window is too far above your head; all you can see through it is a patch of gray sky.MO actorNzMO actorN[There's no way you could fit through the window even if you could somehow scale the wall. MO actorNQ#  MO actorNu |You have neither the strength nor the will to attempt to force your way out of here. Besides, you can't reach the window.    }& 9BQQQB sky ""The sky looks cold and uncaring. 9C& door ;;It's a thick, rusty iron door, without handles or hinges.fMO actorNf hEMO actorN &The door is barred from the outside.!MO actorN "lMO actorNN MYou knock on the door wearily, expecting nothing. You aren't disappointed. MO actorNkl  uMO actorN VYou have neither the strength nor the will to attempt to force your way out of here.    oMO actorN*" pBMO actorNN> #This door doesn't have a keyhole. 9DJ  & hole GGIt's your toilet. You don't feel the need to examine it too closely.MO actorNr%MO actorNThe hole is only a few inches around, and empties into a smelly pit beneath the cell floor. There's nothing in there that could possibly interest you.&%}%MO actorNtGMO actorN6(You can smell it quite well from here. 9E0 shipMN$oYou look at the object in the light. It's a model of a takara-bune treasure ship!, you realize with delight. You haven't seen one of these since you were a child... \n\tYou examine the the little ship closely, cradling it in your trembling hands, trying to remember the names of the seven miniature gods crowded on the deck. \b\t"Hotei..." you whisper, looking at the fat man on the bow. "Ebisu, the fisherman... Fukurokuju, Jurojin..." Smiling, you turn the model around and around in your hands, marveling at the incredible detail.\n\t"And the warrior is... Bisho? No. Bishamon! And the other fat one is Daikoku, and the woman..." \n\tYou fall silent, regarding the tiny goddess at the very back of the ship. She is smiling, and carrying a biwa in her wooden hands. \n\t"Benten," you whisper, although your mind is on another musician now. How could she betray you? You've asked yourself the question a thousand times. Tears fill your eyes and your heart grows hot with anger as you regard the tiny ship in your hands. \n\t"This would have been a fitting gift for our child...," you hiss. "My murdered child!!... " \n\tYou let out a pain-filled cry of despair and hurl the ship at the wall, where it shatters into tiny pieces. Sobbing, you fall back on the mattress and put your hands over your eyes, trying in vain not to think of Gio, the aborted child, or anything else.!>E&N$ C? F  0  package 00It's a long, slender package wrapped in cloth. MO actorNd%MO actorN &:You take off the cloth wrapping, revealing your katana. !<&N+&9J&K&C?Nx& MO actorN%& 1MO actorNI&There's no need.fhG   =  shape 11You can make out a large shape in the darkness.>MMN(4;\b\tYou hear the sound of heavy breathing in the shadows. IMO actorNv4*\b\tYou can't see well enough to attack.{ | U It's too far away. It doesn't respond.#MOactorioNJD59MOactorioNsg5It doesn't respond.T It doesn't respond.=MOvdpiN5It doesn't respond.*Hl + + + =   warriorSMNi6<" N6yThe warrior's steel mask is knocked askew on his face, obscuring his vision. He swings wildly, hoping for a lucky hit.N7The giant warrior is clad in black plate mail from head to toe and is wielding a huge battle-axe. He stares at you with icy determination from beneath his steel mask.>MN7<" N]8yThe warrior's steel mask is knocked askew on his face, obscuring his vision. He swings wildly, hoping for a lucky hit.<9The warrior circles you warily, looking for an opening.U --"Take it to the grave with you," he snarls. 00"That will look nice in your tomb!" he shouts.#MOactorioNG9CMOactorioNj9"Shut up and fight, coward!" T "Shut up and fight, coward!" GMOvdpiN}:"Shut up and fight, coward!" *MOactorioNH:K ZN:KJust "ATTACK GUARDS" will do. You're obviously going to use the sword...(N:Not with that you don't... MO actorN{: MO actorN;>G! N;You slash at the giant's midsection, but he manages to jump back, avoiding your blade by inches. He counters with a vicious overhand smash that grazes your shoulder as you spin away.G!>G  N&=A quick upperhand slice nicks the warrior's throat. He yelps in suprise and backs up. As you press forward for the killing stroke, Ryuko catches you in the stomach with the butt of the axe, momentarily knocking the wind out of you.G!u>G N>Still staggering, you manage a feeble thrust that nevertheless manages to graze the warrior's knee. Ryuko counters with a swing at head level that you're barely able to duck.G!>G N>As your balance recovers, you feint, then strike at the giant's face, knocking his mask to one side. Momentarily blinded, the warrior thrashes about wildly, axe clanging against the walls.G"H!NL?>G fNAGWith a cry, you duck a wild swing and leap forward, plunging your katana into the warrior's exposed throat. Hot blood gushes from the wound as the giant falls slackly to his knees. Ryuko's axe clatters to the floor and his hands reach up to claw feebly at the blade lodged in his neck. You stare at him impassively for a few moments, watching the life force ebb from his body. After a time, the futile struggle ends, and the giant's arms finally drop limply to his sides. You lower the heavy corpse gently to the ground and release your weapon from the wound with a quick tug.!<&>>L&(NAYou swing wildly and miss.I=   soldiersMNIKYou count at least ten soldiers in the narrow hallway, all heavily armed.>H > ZNRIN They stand back, watching the fight with amused expressions on their faces.>CMNI1\b\tThe troops are gradually closing in on you. MO actorNLI MO actorNpI<! NpqL\b\tYou raise your bloody blade once more and prepare to charge the troops...\b\tAnd stop.\b\tYou slowly look around at the nervous young faces surrouding you. Most are unfamiliar; perhaps Matzumu clansmen, but some of them are known to you, and a few have even fought by your side in the past. And even though they are here to kill you, you know that they are only acting under their daimyo's orders, as any loyal samurai would. \n\t What would be accomplished by fighting these men?, you wonder. Would it make anything better if you ended several more young lives today? Would your own death be any more honorable?...\b\tSlowly, you lower your blade.NpL(NpLYou've made your decision.{ | U They don't respond. They ignore you.#MOactorioNpM9MOactorioNMThey don't respond.T They don't respond.=MOvdpiNKNThey don't respond.*MNMN< > pNN[\b\tThe soldiers look at you anxiously, as though waiting for you to make the first move.NNJ0 piece of cloth On closer inspection, it appears to be a large square of silk with tiny flowers embroidered on it. It looks as though it may have been cut from a kimono. KIII0 katana It's a well-crafted, straight-edged katana. Your name is etched in spidery Kanji on the blade. The sword appears to have been cleaned and polished recently.MO actorN(?MO actorN) You don't want to put it down. L & body 22The giant's corpse lies motionless on the floor.MO actorN]D%AMO actorN7D"The corpse has nothing you want. MB  windows vvThe windows are little more than tiny slits at ceiling level. What meager daylight they allow in is fading rapidly. >N~~~& armor MMThe warrior's armor is made of black steel and covers him from head to toe. HO& axe ZZIt's a vicious-looking battle-axe that could easily sever your head with one swift blow. HP4& ZZIt's a vicious-looking battle-axe that could easily sever your head with one swift blow. LMO actorN+EKMO actorNEE,It's far too heavy for you, unfortunately.Q& armor **The warrior's armor is covered in blood. LMO actorN^$FKMO actorN>F,It's far too heavy for you, unfortunately.R& mask WWThe mask is carved to resemble a grinning demon. It's splattered with ryuko's blood. LMO actorN/GMO actorNGGently, you remove the mask. Ryuko's lifeless face stares vacantly up at you. You feel a moment of sadness, for some reason. So much death... Sighing, you place the mask back over his face.SI~I~I~IYbIMO actorNGI'm about to show you a full set of instructions -- they're enormous! If you want to capture this information to a file (so that you can print it out, for example), answer NO below, then use the SCRIPT command (just type SCRIPT, then answer the question asking you for a filename), then enter the INSTRUCTIONS command again.NO respN9A\bDo you want to see the instructions now? (Y is affirmative) >NN &N N^N\  \bHOW TO PLAY \b\b In an adventure game, you play by typing commands that describe what you want to do. Unfortunately, the game isn't as smart as you are, so it can't understand nearly as many sentences as a person could. In this section, we'll describe most of the types of commands that you will need to use while playing the game. \b Note that we've tried to design this game so that you won't need to think of any unusual words or phrases that aren't directly mentioned by the game. We've especially tried to avoid making you guess a strange verb or an unusal way of phrasing a command. \b Each time you see the prompt, >, you type a command. Your command should be a simple imperative sentence, or a series of imperatives separated by periods. Press the RETURN (or ENTER) key when you are done typing your command; the game doesn't start interpreting the command until you press RETURN. \b You can use capital or small letters in any mixture. You can use words such as THE and AN when they're appropriate, but you can omit them if you prefer. You can abbreviate any word to six or more letters, but the game will pay attention to all of the letters you type. For example, you could refer to a FLASHLIGHT with the words FLASHL, FLASHLIG, and so forth, but not with FLASHSDF. \bN\b\b TRAVEL \b At any time during the game, you are in a location. The game describes your location when you first enter, and again any time you type LOOK. In a given location, you can reach anything described, so you don't need to type commands to move about within a location. \b You move from place to place in the game by typing the direction you want to go. The game will always tell you the directions that you can go from a location, although it usually doesn't tell you what you will find when you go there. You will probably find it helpful to make a map as you explore the game. The directions the game recognizes are NORTH, SOUTH, EAST, WEST, NORTHEAST, SOUTHEAST, UP, and DOWN. You can abbreviate these to N, S, E, W, NE, SE, NW, SW, U, and D. In some locations you can also use IN and OUT. \b Generally, backtracking will take you back to where you started. For example, if you start off in the kitchen, go north into the living room, then go south, you will be back in the kitchen. \b Most of the time, when the game describes a door or doorway, you don't need to open the door to go through the passage; the game will do this for you. Only when the game explicitly describes a closed door (or other impediment to travel) will you need to type a command to open the door. N \b\b OBJECTS \b In the game, you will find many objects that you can carry or otherwise manipulate. When you want to do something with an object, type a simple command that tells the game what you want to do; be explicit. For example, you could type READ THE BOOK or OPEN THE DRAWER. Most of the objects in the game have fairly obvious uses; you shouldn't have to think of any obscure or unrelated words to manipulate the objects. \b You generally don't have to specify exactly where you want to put an object that you wish to carry; you can just type TAKE (followed by the object's name) to carry an object. We didn't think it was particularly interesting to force you to specify which object you wish to put in your left pocket, which you wish to carry in your right hand, and so forth. However, there is a limit to how many objects you can carry at once, and to how much weight you can handle. You can carry more objects (but not more weight, of course) by putting some items inside containers (for example, you may be able to put several objects into a box, and carry the box), since this reduces the number of objects you actually have to juggle at once. \b Some basic verbs that you will use frequently are TAKE (to pick up an object), DROP (to drop an object), OPEN and CLOSE, and EXAMINE (which you can abbreviate to X). You can PUT an object IN or ON another object when appropriate. The game recognizes many other verbs as well. We tried to make all of the verbs obvious; if you find a knob, you will be able to TURN it, and if you find a button, you will be able to PUSH it. By the same token, you probably won't need to turn the button or push the knob. \b Some examples of commands that the game recognizes are shown below. These aren't necessarily commands that you'll ever type while playing, but they illustrate some of the verbs and sentence formats that you may use. \b \n\t GO NORTH \n\t NORTH \n\t N \n\t UP \n\t TAKE THE BOX \n\t PUT THE FLOPPY DISK INTO THE BOX \n\t CLOSE BOX \n\t LOOK AT DISK \n\t TAKE DISK OUT OF BOX \n\t LOOK IN BOX \n\t WEAR THE CONICAL HAT \n\t TAKE OFF HAT \n\t CLOSE BOX \n\t TURN ON THE LANTERN \n\t LIGHT MATCH \n\t LIGHT CANDLE WITH MATCH \n\t RING BELL \n\t POUR WATER INTO BUCKET \n\t PUSH BUTTON \n\t TURN KNOB \n\t EAT COOKIE \n\t DRINK MILK \n\t THROW KNIFE AT THIEF \n\t KILL TROLL WITH SWORD \n\t READ NEWSPAPER \n\t LOOK THROUGH WINDOW \n\t UNLOCK DOOR WITH KEY \n\t TIE THE ROPE TO THE HOOK \n\t CLIMB UP THE LADDER \n\t TURN THE KNOB \n\t JUMP \n\t TYPE "HELLO" ON THE KEYBOARD \n\t TYPE 1234 ON THE KEYPAD \n\t GET IN THE CAR \n\t GET OUT OF THE CAR \n\t GET ON THE HORSE \n\t GIVE WAND TO WIZARD \n\t ASK WIZARD ABOUT WAND N\b\b OTHER CHARACTERS \b You may encounter other characters in the game. You can interact in certain ways with these characters. For example, you can GIVE things to them, and you could try to attack them (although this is a fairly non-violent game, so you shouldn't expect to solve too many of your problems this way). In addition, you can ask characters about things: \b \t ASK WIZARD ABOUT WAND \b You can also tell characters to do something. To do this, type the character's name, then a comma, then a command that you want the character to perform. You can type several commands for the character all on the same line by separating the commands with periods. For example: \b \t ROBOT, GO NORTH. PUSH BUTTON. GO SOUTH. \b Of course, you shouldn't expect that characters will always follow your instructions; most characters have minds of their own, and won't automatically do what you ask. Nl \b\b TIME \b Time passes only in response to commands you type. Nothing happens while the game is waiting for you to type something. Each turn takes about the same amount of time. If you want to let some game time pass, because you think something is about to happen, you can type WAIT (or just Z). \b\b SCORE \b The game assigns you a score while you play, indicating how close you are to finishing the game. At certain points in the game, you will be awarded points when you solve some puzzle or obtain some item. The score is intended to provide you with a measure of your progress in the game, and increases as you get further in the game; you never lose points once they are earned. N;'\b\b REFERRING TO MULTIPLE OBJECTS \b You can usually use multiple objects in your sentences. You separate the objects by the word AND or a comma. For example: \b \n\t TAKE THE BOX, THE FLOPPY DISK, AND THE ROPE \n\t PUT DISK AND ROPE IN BOX \n\t DROP BOX AND BALL \b You can use the word ALL to refer to everything that is applicable to your command, and you can use EXCEPT (right after the word ALL) to exclude certain objects. \b \n\t TAKE ALL \n\t PUT ALL EXCEPT DISK AND ROPE INTO BOX \n\t TAKE EVERYTHING OUT OF THE BOX \n\t TAKE ALL OFF SHELF \b The word ALL refers to everything that makes sense for your command, excluding things inside containers that are used in the command. For example, if you are carrying a box and a rope, and the box contains a floppy disk, typing DROP ALL will drop only the box and the rope; the floppy disk will remain in the box. \b\b "IT" AND "THEM" \b You an use IT and THEM to refer to the last object or objects that you used in a command. Some examples: \b \n\t TAKE THE BOX \n\t OPEN IT \n\t TAKE THE DISK AND THE ROPE \n\t PUT THEM IN THE BOX \b\b MULTIPLE COMMANDS ON A LINE \b You can put multiple commands on a single input line by separating the commands with periods or the word THEN, or with a comma or the word AND. Each command still counts as a separate turn. For example: \b \n\t TAKE THE DISK AND PUT IT IN THE BOX \n\t TAKE BOX. OPEN IT. \n\t UNLOCK THE DOOR WITH THE KEY. OPEN IT, AND THEN GO NORTH \b If the game doesn't understand one of the commands on the input line, it will tell you what it couldn't understand, and it will ignore the rest of the commands on the line. N.\b\b AMBIGUOUS COMMANDS \b If you type a command that leaves out some important information, the game will try to figure out what you mean anyway. When the game can be reasonably sure about what you mean, because only one object would make sense with the command, the game will make an assumption about the missing information and act as though you had supplied it. For example, \b \n\t >TIE THE ROPE \n\t (to the hook) \n\t The rope is now tied to the hook. The end of the \n\t rope nearly reaches the floor of the pit below. \b If your command is ambiguous enough that the game doesn't feel safe making assumptions about what you meant, the game will ask you for more information. You can answer these questions by typing the missing information. If you decide you didn't want to bother with the command after all, you can just type a new command; the game will ignore the question it asked. For example: \b \n\t >UNLOCK THE DOOR \n\t What do you want to unlock the door with? \b \n\t >THE KEY \n\t Which key do you mean, the gold key, or the silver key? \b \n\t >GOLD \n\t The door is now unlocked. \b\b UNKNOWN WORDS \b The game will sometimes use words in its descriptions that it doesn't understand in your commands. For example, you may see a description such as, "The planet's rings are visible as a thin arc high overhead, glimmering in the sunlight." If the game doesn't know words such as "rings," you can assume that they're not needed to play the game; they're in the descriptions simply to make the story more interesting. For those objects that are important, the game recognizes many synonyms; if the game doesn't understand a word you use, or any of its common synonyms, you are probably trying something that is not necessary to continue the game. N3\b\b SAVING AND RESTORING \b You can store a snapshot of the game's state in a disk file at any time. Later, if you want to go back to a point you were at earlier in the game, you can simply restore the position from the snapshot in the disk file. You can save your position as many times as you like, using different disk files for each position. Saving the game also allows you to play the game over the course of many days, without having to start over from scratch each time you come back to the game. \b To save the game, type SAVE at any prompt. The game will ask you for the name of a disk file to use to store the game state. (You will have to specify a filename suitable for your computer system, and the disk must have enough space to store the game state. The game will tell you if the game was not saved properly for some reason.) You should give the file a name that does not exist on your disk. If you save the game into a file that already exists, the data previously in that file will be destroyed. \b When you wish to restore a game, type RESTORE at the command prompt. The game will ask you for the name of a disk file that you specified with a previous SAVE command. After reading the disk file, the game state will be restored to exactly the position when you saved it. N?m \b\b SPECIAL COMMANDS \b The game understands several special commands that you can use to control the game. You can use these commands at any prompt. \b AGAIN or G: Repeats your last command. If your last input line was composed of several commands, only the last command on the line is repeated. \b CREDITS: Show a list of the people that developed this game. \b INVENTORY or I: Shows the list of items you are carrying. \b LOOK or L: Shows the full description of your location. \b OOPS: Allows you to correct the spelling of a word in the last command. You can use OOPS when the game displays this complaint: "I don't know the word ." Immediately after this message, you can type OOPS followed by the corrected spelling of the misspelled word. You can only type one word after OOPS, so this command doesn't allow you to correct certain types of errors, such as when you run two words together without a space. \b QUIT: Stops the game, and returns you to your operating system. \b RESTART: Starts the game over from the beginning. \b RESTORE: Restores a position previously saved with the SAVE command. \b SAVE: Stores the current state of the game in a disk file, so that you can come back to the same place later (with the RESTORE command). \b SCORE: Shows you your current score, the maximum possible score, and the number of turns you have taken so far. \b SCRIPT: Starts writing everything you see on the screen (your commands and the game's responses) to a disk file. The game will ask you for a filename to be used for the transcript; you should select a filename that does not yet exist on your disk, because if you use an existing filename, data in the file will be destroyed. Use the UNSCRIPT command to stop making the transcript. \b TERSE: Tells the game that you wish to see only short descriptions of locations you have already seen when you enter them. This is the default mode. See also the VERBOSE command. \b UNDO: Take back the last command. This can be used multiple times to take back a series of commands in sequence. The number of commands that you can undo at any given time varies, but you can generally undo over a hundred commands. \b UNSCRIPT: Turns off the transcript being made with the SCRIPT command. \b VERBOSE: Tells the game to show you the full description of every location you enter, whether or not you have seen the description before. By default, the game will show you the full description of a location only when you first enter it, and will show you the short description each time you enter the location thereafter. Of course, you can get a full description at any time by typing LOOK. See also the TERSE command. \b VERSION: Shows you the current version of the game. \b WAIT or Z: Causes game time to pass. When the game is waiting for you to type command, no game time passes; you can use this command to wait for something to happen. NF\b\b COMMAND EDITING AND RECALL \b On most computer systems, the game has a special feature that allows you to use your keyboard's editing keys to modify an input line as you are typing it, and to recall commands that you have previously typed for editing and re-entry. The specific keys you use vary depending on your system, and some systems don't support this feature at all; see the system-specific documentation for more information. \b While you are typing a command, the game allows you to go back and change part of the line without backspacing over the rest of the line to get there. Simply use your left and right cursor-arrow keys to move the cursor to any point in the command line. The BACKSPACE key deletes a character to the left of the cursor, and the DELETE key deletes the character at which the cursor is located. \b You can insert new text at the cursor simply by typing the text. You can press the RETURN (or ENTER) key with the cursor at any point in the line (the cursor need not be at the end of the command line). \b You can recall the previous command that you entered by pressing the up cursor-arrow key; pressing the up-arrow key again recalls the command before that, and so forth. Using the down cursor-arrow key reverses this process, until you get back to the original command that you were typing before you started pressing the up-arrow key. \b Once you have recalled a prior command, you can re-enter it by pressing the RETURN key. In addition, you can edit the command, as described above, before entering the command. \b The exact number of commands the game retains depends on the lengths of the commands, but more than a hundred of the most recent commands are generally retained at any given time. NBM\b\b REVIEW MODE \b Another special feature that the game supports on many computer systems is called "review mode." The game remembers text as it "scrolls" off the screen; by invoking recall mode, you can go back and look at text that is no longer visible on the screen. On most systems, review mode is activated by pressing the function key F1. \b Once in review mode, the status line that is normally at the top of the screen will be replaced by the review mode help line. This line shows the keystrokes you use to view previous screenfuls of text, and also shows you the key that exits review mode and resumes normal game play (this is generally the game key that you used to activate review mode). \b While in review mode, your screen becomes a window onto the text that the game has stored away. When you first activate review mode, you are looking at the very bottom of this text, which is the screenful of text that was just displayed. Use the up and down cursor-arrow keys to move the window up and down. Pressing the up cursor-arrow key moves the window up one line, showing you one line of text that has scrolled off the screen. Most systems also provide keys to move up and down by a full screenful (also called a "page.") \b To resume game play, press the same key that you used to activate review mode. \b The number of screenfuls of text that the game stores away for review depends on how much text is actually on each screen, since the game has a limit on the number of characters it can store, not on the number of lines. Normally, more than twenty of the most recent screens of text are saved and available for review at any given time. NHMV\\\& L orchid **It's a shriveled, pitiful-looking thing.W  & ship AAThe model seems to float on top of the fog as if adrift at sea.MO actorNlOnMO actorNONot likely. The model is about ten feet long and probably weighs half a ton.vMO actorNwMO actorN(You wade through the thick fog (what happened to the pool?, you wonder) and pull yourself over the side of the hull...\b\t...but strangely enough, an invisible force pushes you back before you can enter.N(MO actorN#MO actorNGYou wade through the thick fog (what happened to the pool?, you wonder) and pull yourself over the side of the hull...\b\t...but strangely enough, an invisible force pushes you back before you can enter.MO actorN9PaMOactordobjN]& N]You carefully put the key inside the ship. As you do so, a sudden bright flash of light blinds you momentarily. When your vision clears, you find that the key has vanished.  >&&< N]You carefully put the coat inside the ship. As you do so, a sudden bright flash of light blinds you momentarily. When your vision clears, you find that the coat has vanished.  ><&N]= N]You carefully put the rat inside the ship. As you do so, a sudden bright flash of light blinds you momentarily. When your vision clears, you find that the rat has vanished.  >=&N]x N]5pThat's strange... there seems to be some sort of invisible force preventing you from putting it into the ship.N]|N]pThat's strange... there seems to be some sort of invisible force preventing you from putting it into the ship.><  E >&  E >=  hN]i7\b\tThe fog surrounding you suddenly thickens, enveloping you in a cool shroud of misty blue light. Moon, sky, trees and stars fade away, vanishing one by one, until the ship is all that remains. You hear sounds in the fog, far away; ghostly voices, music, splashing waves, laughter... all of which fade into silence as the takara-bune suddenly begins to glow with a faint amber light. \n\tYou sense movement behind you, and turn around to see the warrior spirit, who smiles and points at the glowing ship. The young samurai puts his hand on your shoulder, and you watch together as the treasure ship grows to more than five times its size. Within moments, it is towering above you. As you watch, open-mouthed with wonder, shadowy forms take shape on the deck above, and a glowing rope ladder is tossed overboard...'Y&N]!<&'Z& 'XbbbB fog 33The fog twists and dances around you as if alive. 'YYYY&  rope ladder aaThe glowing ladder reaches from the bow of the ship to within a foot of where you are standing.MO actorNMO actorN/WHeart racing, you pull yourself up the ladder. The samurai follows close behind.\b\tNT>>L& Z  & ship The takara-bune towers above you. Images of the seven treasures glow all around the hull. You can also make out a small crowd of spectral figures gathered on the bow.MO actorN^MO actorN@?Not likely. The model is now the size of a small battleship.vMO actorN\QwMO actorNWHeart racing, you pull yourself up the ladder. The samurai follows close behind.\b\tN>>L&MO actorNMO actorN=xWHeart racing, you pull yourself up the ladder. The samurai follows close behind.\b\tN=>>L& [cccC crowd 22You can't really make out any details from here. Z\bbbB fog 33The fog twists and dances around you as if alive. ]&  rope ladder QQThe glowing ladder reaches from the bow of the ship to the waiting skiff below.MO actorNI_ MO actorNbYou move towards the rope ladder. Before you can climb down, however, the goddess Benten stops you. "Dozo," she says, placing a tiny object in your palm. Suddenly, you feel a great weight lift from you as most of your worldly possessions vanish. You start to protest, but realize there is no point. Wherever you're going, your material things will undoubtedly serve no purpose...\n\t The other gods gather around you, bowing and smiling. "Sayonara!" they shout, ushering you towards the ladder. Somewhat bewildered, you climb down towards the waiting skiff, while the gods of luck cheer and wave from the deck above. The samurai climbs down after you.\b\t!A>^&NSb_>`&a>&Nba>L&Cb ^  0  paper ship yyIt's a beautiful origami ship. The folded paper resembles a miniature version of the takara-bune you just traveled on.K#MOactorioNc#MOactorioNd#MOactorioN%dfMO actorN%DdhUMO actorNI^d6You try to unfold the paper ship, but are unable to. _l,,,$  Altar room \b\tYou stand in a tiny, ten-foot square chamber. It's cool and dark in here. The cave is filled with detailed carvings, which surround a giant statue that fills a recess in the northern wall. To the east, a small passage leads back outside.A`T katana It's your ancestor Kaneiji's katana. His name is etched in spidery kanji on the steel. It's glowing with faint amber light.MO actorNy:MOactordobjNN aP$ On the skiffrMN8h1You're standing on the deck of the tiny vessel. ! N%i The pilot rows the dragon-ship silently over the dark sea towards the distant, rocky shore. A flickering torch on the stern provides the only light.Njis A flickering torch on the stern provides the only light. You look longingly at the rocky shore a few feet away.MNi> a 7Ni(The pilot shoves you back in the boat.QNLjENothing but water that way, and you STILL don't know how to swim...JMNYj> a 7Nj(The pilot shoves you back in the boat.QNjENothing but water that way, and you STILL don't know how to swim...C You can't go that way.buuu& skiff IIIt's a small, three-man vessel, painted black and shaped like a dragon.`MNk7\b\tThe pilot puts its oar in the water and rows off.CNlMNkmM\b\tAt long last, you reach the shore. The pilot lands the skiff expertly on a stretch of rocky beach. You thank the pilot in broken Japanese and start to disembark...\n\tAbruptly, the pilot shoves you roughly back into the boat. As you stand up again, surprised and angry, the dark figure holds out a skeletal palm towards you.!&!&Nma>&a& acQQQB  ghost ship The ship drifts silently. dQQQB  ghost ship The ship drifts silently. ed. . .= MO actorN+) OMO actorN=G)0Even you're not stupid enough to attack a god.eMOvdpiN)=The deity smiles at you patronizingly, then shoos you away.*U ((The god ignores your pitiful offering. **The deity ignores your pitiful offering.#MOactorioN[*>MOactorioN*The god could care less.T ..The god ignores your insignificant question.>   You can't understand a word. fe  god Ebisu rrEbisu, the old fisherman, sits cross-legged at the bow, occasionally casting his line over the prow of the ship.> //\b\tThe seven gods of luck are gathered here.ge  god Daikoku ffThe portly god Daikoku sits nearby atop two full bags of rice, idly chatting with the other deities.he  god Hotei ccThe fat god of happiness, Hotei, lounges nearby, occasionally chuckling in a deep, throaty voice.ie god Fukurokuju zzThe wise Fukurokuju leans on his staff nearby, occasionally wrinkling his enormous forehead in response to some comment.je  god Jurojin ddJurojin, the ancient god of longevity, sits quietly near the hull, listening to the conversations.ke god Bishamon SSThe god of war, Bishamon, stands at the center of the crowd, telling bawdy jokes.le goddess Benten [[The beautiful goddess Benten stands nearby, plucking a quiet little melody on her guitar.mbbbB fog 33The fog twists and dances around you as if alive. nDB skyMN1>m  BN-23You can't even see the sky through the thick fog.xN2lThe sky is a deep, dark bluish-black, devoid of stars or moon, yet somehow there's enough light to see by. oDB skyMN 3>m  BNX33You can't even see the sky through the thick fog.xN3lThe sky is a deep, dark bluish-black, devoid of stars or moon, yet somehow there's enough light to see by. pbbb& wheel The ship's wheel is nearly six feet in diameter, and it's attached to a thick wooden post. The wheel glows with a faint amber light.MO actorN4/MO actorN4<gN-5/You grasp the heavy wheel and try to turn it.q! 1N?5" Unfortunately, it won't budge.N5G After some initial resistance, the wheel turns freely in your hands.r" UN#69\n\tThe ship slowly gains speed as wind fills the sail.s! E t" QN}6B Unfortunately, the fog is too thick to see where you're headed.>s! E >t! QN7B Unfortunately, the fog is too thick to see where you're headed.C>t! E >s" N7 You steer the ship in a random direction, as there are no stars or landmarks to guide you. Perhaps you'll stumble onto something...>t" E >s" Nr8Z With no other landmarks available, you steer towards the shadowy island on the horizon.CN8"@N 94 Sadly, there's no wind, so the ship goes nowhere.N9You attempt to turn the ship in a different direction. Suddenly, the samurai forces you out of the way and steers the ship back towards the island. "Gio!" he shouts at you, angrily gesturing towards the shadowy shore in the distance.wMN:\b\tThe island gets closer.CNl:u&v&N:!w&!x&{MN<:\b\tThe ship drifts to a halt about a quarter mile from the shore. From out of nowhere, you see a small, black skiff approach. You watch it for a time, trying to get a clear view of the dark, hooded figure piloting the small vessel. Finally, you feel a soft thump as the skiff docks itself alongside the ship.!<&y&Nc<z&>]& q& water symbol ""It's the Kanji symbol for water.MO actorNUHMO actorNyI<NyJYou place your hand over the water symbol. For a few moments, nothing happens... Then a tremendous roaring noise fills your ears, and you nearly lose your balance as you feel the ship being slowly raised off the ground. You rush to the side of the ship and look overboard, and are amazed to see literally tons of water pouring in from every direction. "Incredible," you think. "A ship that provides its own sea..." NyJ"&&>s" E >t" NyKv\n\tThe water level rises quickly, covering the barren plain and gradually transforming the mountain into an island.!>|&Ny L!>}&!>~&!>&NySL>w&>x&#NyLNothing else happens. {r&  wind symbol !!It's the Kanji symbol for wind.MO actorNStMMO actorNwwNYou place your hand over the wind symbol. For a few moments, nothing happens... Then a cool, brisk wind begins to blow across the deck. Suddenly, a mast materializes out of thin air directly behind you, and a giant sail billows itself into existence.&NwN&">q" =NwO1\b\tYou feel motion as the wind fills the sail. {sXXX&  fire symbol !!It's the Kanji symbol for fire.MO actorNSJ?MO actorNwe?<NwAYou place your hand over the fire symbol. For a few moments, nothing happens... Then the sound of thunderclaps fills the air as the sky turns the color of molten iron. The temperature rises dramatically, and you break into a sweat, closing your eyes as the skies rain sheets of fire all around you. Within seconds, the firestorm subsides, and you open your eyes to find that the fog has vanished">q! E >t! NwAV, revealing a featureless, barren plain that stretches endlessly in every direction.|&NwA}&,>q! E >t" NwBh, revealing a dark, barren plain that is totally featureless save for a vast mountain in the distance.>|&NwB>}&~&NwC&e>t" E >q" ONwC/, revealing a shadowy island in the distance.>w&>x&NwC!>\&!>m&#Nw(DNothing else happens. {t|<<<& earth symbol ""It's the Kanji symbol for earth.MO actorNUEMO actorNyE<cNyESYou place your hand over the earth symbol. For a few moments, nothing happens...">s! NygF Then you see something large take shape far away in the fog; an island, perhaps? Before you can identify it, the fog obscures it from view entirely.M>q! NyG...And then a harsh rumbling sound fills the air. In the distance, an enormous mountain springs into existence from the featureless landscape.>~&NyLG>&NyG^ And then suddenly, a miracle; in the distance, an island rises out of the newly-formed sea.NyG>w&>x&#NyHNothing else happens. {uC island The island is definitely closer now; you can make out a barren, rocky shore, a dark forest beyond, and a lonely mountain peak shrouded in mist. vC island The island is definitely closer now; you can make out a barren, rocky shore, a dark forest beyond, and a lonely mountain peak shrouded in mist. wmmmC island ==The island is little more than a dark shape on the horizon. xmmmC island ==The island is little more than a dark shape on the horizon. y^& wheel The ship's wheel is nearly six feet in diameter, and it's attached to a thick wooden post. The wheel glows with a faint amber light.MO actorN=/>MO actorN=The wheel won't turn anymore. z@&C skiff It's a small, three-man vessel, painted black and shaped like a dragon. A dark, cloaked figure stands on its deck, staring up at you.MO actorNZ MO actorN]You move towards the rope ladder. Before you can climb down, however, the goddess Benten stops you. "Dozo," she says, placing a tiny object in your palm. Suddenly, you feel a great weight lift from you as most of your worldly possessions vanish. You start to protest, but realize there is no point. Wherever you're going, your material things will undoubtedly serve no purpose...\n\t The other gods gather around you, bowing and smiling. "Sayonara!" they shout, ushering you towards the ladder. Somewhat bewildered, you climb down towards the waiting skiff, while the gods of luck cheer and wave from the deck above. The samurai climbs down after you.\b\t!A>^&N]_>`&a>&N ^a>L&Cbvw {& post The post is five feet tall and about a foot thick. Looking closely, you notice some familiar Kanji symbols carved into the wood. |C plain [[It's a barren, featureless plain that stretches off into the darkness in every direction. }C plain [[It's a barren, featureless plain that stretches off into the darkness in every direction. ~C  mountain qqThe shadowy mountain reaches into the dark blue sky. You can't really make out any details from this distance. C  mountain qqThe shadowy mountain reaches into the dark blue sky. You can't really make out any details from this distance. jjjC sea ==The dark, rolling sea sprawls endlessly in every direction. jjjC sea ==The dark, rolling sea sprawls endlessly in every direction. v666& mast ~~The mast towers above you, high into the dark sky. You wish there were a crow's nest up there, fond as you are of climbing.MO actorNU`MO actorNUATempting as the thought is, there are no handholds on the mast. N   & sail ``The sail is a massive, colorful stretch of canvas, decorated all over with ornate calligraphy.MO actorNVUMO actorNV6Tempting as the thought is, it's just too dangerous. B  calligraphy PPThe beautiful writing covers the sail. It's a shame you can't read any of it. 4&C cloaked figure The figure is wearing a black cloak that enshrouds its entire frame, and it wields a single long oar. It looks up at you expectantly. z0MO actorN fMO actorN=%f>" N=tf3You get a tremendous shock as you try to pick up !< L. It seems as though you can only carry one of these treasures at a time.N=fTaken.<&"MO actorN$.gMO actorNHHg<  , Dropped.> <&NHg!/NHgYou're not carrying !< !GGG= ^^The dark figure is tall and imposing, wearing a black cloak that covers it from head to toe. pilot MO actorNr MO actorNrAngrily, you charge the dark figure, who promptly bashes you over the head with the oar. You fall back to the deck, stunned.Nr@MOvdpiN[rThe pilot ignores you.*V MOactordobjNs NCt8You place the gold coins in the figure's outstretched palm. The ferryman inspects the coins, nods, and sends you on your way. Making several trips, you transfer all of your belongings to the strange, rocky shore. After you've finished, the dark figure gives a little wave and rows off into the darkness.\b\taANt>>L&Nt!Nt!>&C@NKu4The Dark Ferryman of the Underworld is not amused. 44The Dark Ferryman of the Underworld is not amused.#MOactorioNuBMOactorioNuThe dark figure ignores you.#MOactorioN^1vFMOactorioNSv"The dark figure doesn't respond.T The dark figure ignores you.> GG\b\tThe dark figure looks at you expectantly, its skeletal palm open. qqqC island ??The island draws nearer. Your heart races with anticipation. a = pilot ^^The dark figure is tall and imposing, wearing a black cloak that covers it from head to toe. MO actorNn KMO actorNo,You don't think that would be a good idea.@MOvdpiNIoThe pilot ignores you.*U The pilot ignores you. The pilot ignores you.#MOactorioNo<MOactorioNpThe pilot ignores you.#MOactorioNRp@MOactorioNtpThe pilot doesn't respond.T The pilot ignores you.> GG\b\tThe dark figure stands at the front of the ship, silently rowing. auuuC shore FFThe shore, covered with strange white rocks, is frustratingly close. n--- pile of coins ""It's a small pile of gold coins.MO actorNVZMO actorNz¥|You drop the pile of coins. They sparkle on the ground for a few moments and then fade away as if they had never existed.Nz!<& &$ !!Island of the Dead (Bone shore) **\b\tIt took you a while, but you finally came to the horrifying realization that the strange white rock formations here are actually bones. Thousands upon thousands of human skulls, ribs, spines, and other unidentifiable fragments carpet the shore as far as the eye can see; indeed, the whole island appears to be built upon a grisly foundation of human remains. A dark forest looms to the north; the beach continues towards a small structure to the east and ends at a jagged mountain of bone to the west. The dark ocean fills the view to the south.@ Nope. Still can't swim.B CCA treacherous mountain of bone blocks progress in that direction.A?C  mountain You crane your neck, trying to see the top of the jagged peak. The clouds part for a moment, and you catch a brief glimpse of a structure carved into the mountainside near the top. Interesting... Unfortunately, there doesn't seem to be any way up there. MN8[\b\tThe samurai takes a long look at the distant mountain, then marches off to the north.>L&C"N8"MN9>L > N9q\b\tThe samurai crosses the bridge to the north, barely glancing at the demon, who steps aside to let him pass.!>L& !>L&C sky llThe sky is a deep, dark bluish-black, devoid of stars or moon, yet somehow there's enough light to see by. alllC sea ==The dark, rolling sea sprawls endlessly in every direction. ahhh& oar 99The pilot's oar cleaves through the water effortlessly. hhh& oar 99The pilot holds the oar in his free hand like a weapon. & torch The torch is a long, black metal pole attached to the stern of the ship. The flame flickers, casting strange shadows everywhere.#dMOavipN{) -N0| The torch is too hot to touch.*N]|IMO actorN`|JMOactordobjN=|~ 8N=|)It's still way too soggy to catch fire.t VN=}GYou still need some money to get home. You shouldn't burn all of it.9 N=}qYou put the end of the stick in the flames, but it won't catch fire. It must have been treated with something.N=} YN=.~JFor some reason, the nest won't light. There must be too much mud in it.G aN=d~AWhoosh!! The page goes up in smoke. Hope you read it already...N=~!>&F \N=~MFor some reason, it won't catch fire. Must be too much buck slobber on it.zN=1 WN=HIf you set that on fire, you'd probably end up burning down the ship. ^ N=QYou place the origami ship in the fire, and it immediately bursts into flame. Suddenly, you hear a loud POP!! as the paper ship explodes in a brilliant flash of amber light. The light swirls and coalesces into seven distinct shapes that float to the deck of the ship. Slowly, the light fades, and seven strange items are revealed...N=a&a&a&N=Ya&a&N=a&a&!>^&N=1N=%You don't want to set that on fire.IOJIPJ'MO actorN]V( ""You take a snapshot of the fire.UMO actorNV`MO actorNAYou huff, and you puff, but you just can't seem to blow it out.MO actorN3$(9MO actorNW=This isn't the circus... b0 coat @@It's a luxurious red silk coat, decorated with golden dragons.MO actorNkMO actorNل>" NjYou get a tremendous shock as you try to pick up the coat. It seems as though you can only carry one of these treasures at a time.NTaken.<&"MO actorNrڅMO actorN<  2 Dropped.> <&N?!!+NYou're not carrying the coat!MO actorN_MO actorNB<  .You're not carrying the coat!NBO<"You're already wearing it!(NBcYou put the coat on."MO actorN`MO actorN<  .NYou're not carrying the coat!O<! You're not wearing it!*NCYou take off the coat.!` ddd rat 77It's a beautiful statue of a rat, carved out of jade. H    velvet bag IIIt's a heavy green velvet bag. Fluffy white rice spills over the side.MO actorNzZMO actorNaYou tilt the bag towards the ground. Fine white rice spills everywhere, piling at your feet. After a short time, you stop, and are shocked to note that the bag doesn't seem any lighter; in fact, it looks even fuller than before.> &>  }N\b\tCrows start flocking towards you, attracted by the new food source. Two particularly nasty birds land on your shoulders and squawk loudly in your ears, startling you and causing you to drop the bag. It rolls end over end, finally coming to rest upside down in the briars.Nל&!>&CN#!&&Nk!AMO actorNA"The bag is already full of rice.PfMOactordobjN@There's no room in the bag. It's completely filled with rice.   golden key ''It's an elegantly crafted golden key.yMO actorNXXz:MOactordobjN|tN|ɢ  mallet The mallet is solid gold, with a black leather handle. A carving on the head depicts the god of war waving the mallet triumphantly.MO actorNMO actorNbYou wave the mallet. A shower of golden sparks erupts from the head, and settles into a little pile on the ground. The sparks slowly fade away, transforming into a handful of shiny gold coins!N> >& 0 hat ))It's a simple black hat made from felt.MO actorNSBMO actorNw\>" NwYou get a tremendous shock as you try to pick up the hat. It seems as though you can only carry one of these treasures at a time.NwTaken.<&"MO actorNY\MO actorN}v<  2 Dropped.> <&N}!!*N}You're not carrying the hat!MO actorN&_MO actorN(@<  -You're not carrying the hat!N(X<"You're already wearing it!1N(You put the hat on your head."MO actorN `MO actorN(<  -NuYou're not carrying the hat!N<! You're not wearing it!)NˌYou take off the hat.!`    > purse The purse is completely covered with shining jewels that sparkle in all the colors of the spectrum. It seems to be totally empty.MO actorN+MO actorNE>" N3You get a tremendous shock as you try to pick up !< L. It seems as though you can only carry one of these treasures at a time.N >! E >  NY3You get a tremendous shock as you try to pick up !< L. It seems as though you can only carry one of these treasures at a time.Nԏ,Taken.<&"!N$MO actorN1MO actorNK<  , Dropped.> <&N!/NِYou're not carrying !< !vMO actorN=wMO actorNa*>  E >! Na You open up the purse and attempt to step inside. Before you can, however, one of the trees springs to life, reaches out and slaps the purse out of your hands with its rotting limb.<&NaQ!rNa5You stretch the purse's mouth until it's wide enough to fit into, then, first taking a deep breath to steady your nerves, step inside. You feel a brief falling sensation as the darkness swallows you. There is a moment of panic, which passes as your descent slows and soft amber light fills the room...\b\t> >&!Na>NavwMO actorN%PMOactordobjN@ NYou put the hat into the purse, taking care not to touch it as you do so. The hat seems to vanish; however, the purse itself still looks flat, as if totally empty.\b!N3A"N! NTYou put the coat into the purse, taking care not to touch it as you do so. The coat seems to vanish; however, the purse itself still looks flat, as if totally empty.\b!NA"N̖!NYou put the item into the purse, taking care not to touch it as you do so. The item seems to vanish; however,the purse itself still looks flat, as if totally empty.\b!NA"NMO actorN4 %NMO actorNX ^/You stick your hand in the purse, carefully, and are surprised to watch it vanish up to the elbow. Intrigued, you open the purse a little wider and poke your head inside. It's pitch black and you can see nothing, but you do get the sensation that there's a tremendous amount of space all around you.&% ^^^$ Forest of the Damned \b\tThe silence here is unnerving; not a single birdcall interrupts the stillness of the dark wood. The black skeletal trees reach over you like grasping hands, and you have the uneasy feeling that you are being watched.C You can't go that way.D You can't go that way.MN B>! WNpBHFinding a gap between the trees, you head deeper into the dark forest.N CYou follow a trail, forged by the rampaging rat-creature, that eventually leads you into a different region of the forest.\b\t>$ Inside the purseMN\b\tYou are suspended in midair, floating in a featureless void. You are illuminated by a soft amber light that seems to have no source; it's as if you're glowing in the dark.>" =NG1 The items surrounding you are glowing as well.Nا You seem to be able to move, at least. By making swimming movements with your arms, you can propel yourself in any direction.CBMNYou propel yourself upwards until you feel a sort of gravity pulling on you. The falling sensation takes hold of you again and you see a circle of light rushing towards your feet. Before you have time to prepare yourself you are dumped unmercifully onto the cold hard earth.\b\t> >N,JBMN-You propel yourself upwards until you feel a sort of gravity pulling on you. The falling sensation takes hold of you again and you see a circle of light rushing towards your feet. Before you have time to prepare yourself you are dumped unmercifully onto the cold hard earth.\b\t> >Nw WWYou swim around in the dark for awhile. You wish swimming in water were this easy...J pile of rice ((It's a big mound of fluffy white rice.MO actorN[ԞMO actorN>  9N:"You drop the rice on the ground.<&NdYou drop the rice on the ground. After a while, a light breeze kicks up and scatters it all away.NП!<&(fMO actorNd=GYou eat some of the rice. It needs salt, you think, but it's not bad. $ Foot of the mountainxMN^X\b\tYou are in a clearing in the middle of a large briar patch, in the shadow of a giant mountain to the north. To the southeast, a narrow crawlspace snakes away into the thorns.>  hNX\\b\tThe sky above you is black with crows, who swarm like hornets around the jagged peaks.>  3N9Y'\b\tA sea of crows covers the ground.GD You can't go that way. 00Thick briars prevent travel in that direction.C llThe base of the mountain isn't too steep; you see a ledge above you that you might be able to climb up to.? The mountain is that way.???& rice ^^The bag is spilling tons of rice onto the ground. Crows are flocking to it by the hundreds.#]MOavipN%) /Nu"The crows won't let you near it.*"JMOavdpN"The crows won't let you near it.* *&  mountain The mountain is a steep cone of white rock that stretches skyward into infinity. There's a ledge above you that you could probably scramble up to. MO actorN\MO actorN\>  qN^\b\tYou start to scale the treacherous rock face. Before you can even get a few yards, several dozen crows swoop down at you, screeching and pecking at your face and hands. Cursing, you drop back to the ground, swatting the pesky birds away.>" dNK^X\n\tYou marvel at the fact that these crows can see you even while you're invisible...jN^TWith the crows preoccupied, it's an easy task to climb up to the narrow ledge.\b\t>MN_\b\tRice spills out of the bag at an alarming rate, covering the ground all around you. More and more crows swoop to the ground, until the clearing is teeming with tiny black bodies.>&N_!>&!>& ccc& crows ,,The crows fill the sky like living clouds. & crows yyMost of the crows are in the clearing now, gobbling up the rice. Occasionally one of the birds gives you a dirty look. nnnB light ==You can't figure out what the source of the amber light is. $  East shore \b\tThis is the eastern shore of the bone beach. A large mound composed of human skulls is the only distinguishing feature. The beach continues to the west, and a dark forest lies to the north.B? You head north across the beach. Walking over a low rise, you come across a rushing river that stands between you and the forest.@ Nope. Still can't swim.YYY$ Forest bridge \b\tBlack, twisted trees surround you on all sides, making it difficult to see anything at all. A sinuous river whispers through the undergrowth directly ahead; spanning it is a stone footbridge. A ferocious- looking demon stands atop the bridge, watching your approach warily.@?MNy  >! _N4You attempt to cross the bridge. The demon actually lets you get halfway across before he extracts your spinal column with his razor-sharp claws. \b\b\b***You have died***\b\b\b\b>" -N\t...Here we go again...\b\tC N>  >3N >  N& >fN PWearing the hat of invisibility, you manage to slip past the demon unseen.\b\t>N  >^& dddC forest 22The dark forest carpets the island to the north. C sky llThe sky is a deep, dark bluish-black, devoid of stars or moon, yet somehow there's enough light to see by.^ ^ ^ ^ KKK$ Dark forest (clearing) ii\b\tYou stand in a large clearing ringed by deformed trees. Ahead of you, far to the north, a lone mountain thrusts upwards from the surrounding wilderness, its peak obscured by clouds. Paths enter the woods in every direction. The footbridge is back to the south.\n\tA large, pyramid- shaped burial mound, made of wood, sits in the center of the clearing.@MNe2>  >! 7N,3You cross the bridge, forgetting that you're not wearing the invisiblity hat. The demon smiles as he quickly defenestrates you. \b\b\b***You have died***\b\b\b\b>" !Nl3\t...Doh!...\b\tC >  N3>*>  >N%4fN4PWearing the hat of invisibility, you manage to slip past the demon unseen.\b\t> >N4C You can't go that way.D You can't go that way.iMN(5)You walk into the forbidding woods.\b\t>Nv5>! C!MN5< ^ <  $ North forestMNMn\b\tThe woods thin out here, giving way to sparse stands of skeletal white birches surrounded by prickly underbrush. Thick mist covers the ground, making navigation difficult. Perhaps it's pointless to wander about here; you'd have to be incredibly lucky to find anything in this fog. You see a trail to the south that you think will lead you back to the beach.$" WNNK\b\tThere is a narrow crawlspace through the underbrush to the northwest.@hMNNLYou follow a winding trail that eventually leads back to the clearing.\b\t>FMNO>$?NdO0Thick briars prevent travel in that direction.NOYou crawl through the twisty tunnel for a long, long time, finally emerging in a small clearing at the base of the mountain.\b\tNP>E 00Thick briars prevent travel in that direction.H 00Thick briars prevent travel in that direction.G 00Thick briars prevent travel in that direction.C You can't go that way.D You can't go that way.jMNQ>! oNUQ`You wander around aimlessly for a while, but return before you totally lose your bearings.\b\t>$NSFYou wander around aimlessly for a while, and are about to return when you accidentally trip over a protruding root and fall flat on your face. Luckily, the stumble doesn't hurt you, and you are about to stand up again when you spy something interesting among the trees. You look behind a rotten birch and discover a single white orchid growing in the ashy soil. \n\tThanking your luck, you reach down to pick up the beautiful flower, when suddenly the fog lifts for a moment, revealing a narrow crawlspace through the underbrush to the northwest that you hadn't noticed before.NS>&"$CNGTRNTFYou walk around in the woods some more but don't find anything else.^ aaaC sea 22The dark sea laps the shore like a hungry beast.   & bones ==The dull white bones crunch unsettlingly beneath your feet.MO actorNi%{MO actorN&\Grimacing distastefully, you pick through the remains for a while but don't find anything.MO actorNPMO actorN2lYou pick up a random skull, but quickly decide you don't really want the ghastly thing, and throw it back. Z& mountain of boneMNv<The mountain is a forbidding mound of loosely-packed bone.>" GN ;\b\tA crazy idea occurs to you; maybe you could climb it!MO actorN MO actorNN 1You gather your courage and attempt to scale the treacherous mound. You get halfway up and begin to think you might actually make the summit when a fragile bone snaps beneath your foot. Screaming, you fall backwards and are promptly impaled on a jutting ribcage...\b\b\b\b\b***You have died***\b\b\b\t>" WN H\t...This really isn't the most productive way to spend your time.\b\tN C   N4 >+  >N  Z&, cairnMNQIt's a large cairn, made entirely of skulls, arranged in a loose pyramid shape.>  UN^F You notice a faint amber glow emanating from a spot near the base.2N& There is a small gap near the base.  MN\b\t.....Or have you? You feel a stirring, as if awakening from a deep, dreamless sleep...\b\b\t...Pain. Something hard surrounding you. You open your eyes...\b\tDarkness. No, not quite, light seeps in through cracks in the... rocks? Skulls. You're buried alive beneath a pile of skulls!...\b\tHeart pounding, you frantically claw your way out. Fortunately, you're not buried deeply at all; only a foot or so of bone separates you from the surface. You soon find yourself atop a tall burial mound, not far from the shore where you landed. You look at the bone mountain to the west where you fell and breathe a sigh of relief. Apparently, death works a bit differently here...\b\t "MN< ]]]& crystal skull JJThere's a glowing crystal skull, lodged firmly in the base of the cairn.MO actorN~pMO actorN>! You can't budge it.0NYou work your hands around the edges of the crystal skull and attempt to pry it loose. After several minutes of painstaking effort, the skull pops free, leaving a small gap in the base of the cairn. Perhaps your previous visit loosened it up a bit...!<&&NO& / <& crystal skull GGIt's a glowing crystal skull, lodged firmly in the base of the cairn.MO actorN{+?MO actorN?You work your hands around the edges of the crystal skull and attempt to pry it loose. After several minutes of painstaking effort, the skull pops free, leaving a small gap in the base of the cairn.N'@!<&>&NX@>& / ~===&, cairnMN;OIt's a large cairn, made entirely of wood, arranged in a loose pyramid shape.>  LN;= There's a glowing crystal skull lodged firmly in the base.5NR<) You notice a small gap near the base. MN<< ddMN4L;\b***Uh-oh. Seems like you're REALLY dead this time.***\bNvLNLdddC forest 22The dark forest carpets the island to the north. t& river YYThe river is murky black and over ten feet wide. There's no way you can cross it here.MO actorN\MO actorNsYou cup your hands and swallow a mouthful of the foul- smelling water. Instantly, you double over in pain as your innards slowly dissolve...\b\b\b***You have died***\b\b\b\b>" )N\t...Or perhaps not.\b\tC >  N>*>  NI> Phew. aaaC sea 22The dark sea laps the shore like a hungry beast.   & bones ==The dull white bones crunch unsettlingly beneath your feet.MO actorNi%{MO actorNx\Grimacing distastefully, you pick through the remains for a while but don't find anything.MO actorNMO actorN2 lYou pick up a random skull, but quickly decide you don't really want the ghastly thing, and throw it back. VVV0 crystal skull It's a glowing crystal skull. ggg& gap 44It's a small space about the size of a human head.MO actorN^EPMOactordobjN`KN2You carefully place the skull back into the gap.N>&!>&!<&N&N)AN1)There's no reason to put that in there. \ = The demon appears to be an Oni; it's covered from head to toe with short red fur and has a shaggy mane of darker fur around its head and neck. Its jutting fangs, horns, and talons all seem to be razor-sharp. The Oni watches you warily with three golden, cat-like eyes. demon{ |  MO actorNLx' MO actorNp'>`  /NpJ(Sounding a shrill war cry, you charge the demon, who promptly slices you into ribbons with his sharp claws. \b\b\b***You have died***\b\b\b\b>" $\t...You know the drill.\b\tNp(C >  Np(>*>  >Np7)Np*Brandishing your katana, you step confidently onto the bridge. The demon lunges at you, but you nimbly sidestep the charge and plunge the sword into its black heart. The Oni looks at you mournfully with its three eyes and perishes without a sound.Np]*!<&& #MOactorioN*nMOactorioN *`  < 8N +,That's not a very good choice of a weapon.GMOvdpiNR+The demon just grunts at you.*VxMOactordobjN+u @N+1Sorry, the demon doesn't take American Express. t @N,1Sorry, the demon doesn't take American Express. ~N,You give the coins to the demon. He looks at them skeptically for a moment, then hands them back to you. Then he kills you with several quick swipes of his razor-sharp talons. \b\b\b***You have died***\b\b\b\b>" -NH-\t...You know the drill.\b\tC N->  N->*>  >N .?Nh.3The demon sniffs your offering, then spits on it. The demon could care less.#MOactorioN.<MOactorioN.The demon ignores you.T The demon ignores you.>MNb/>! 7N/(\b\tThe demon watches your every move.2/\b\tThe demon seems unaware of your presence. & forest 11Black. Stunted. Twisted. Rotting. Deformed.MO actorN^!BMO actorN!#You don't think they'd let you... z###& river __The river is murky black and over ten feet wide. The bridge seems to be the only way across.MO actorN"\MO actorNu#You cup your hands and swallow a mouthful of the foul- smelling water. Instantly, you double over in pain as your innards slowly dissolve...\b\b\b***You have died***\b\b\b\b>" )N#\t...Or perhaps not.\b\tC >  N+$>*>  >N|$ Phew. &  footbridgeMN,%3It's a simple arch of stone that spans the river.>  0N%$ A big, nasty demon stands on it. |||&  dead demon BBThe demon is quite dead. Its body is covered with sword wounds. ttt& fangs, horns, and talons **Sharper than knives and twice as deadly! [[[& forest --Black. Stunted. Twisted. Rotting. Deformed.MO actorNZCBMO actorN~C#You don't think they'd let you... !MNiEG\b\tSuddenly, the forest comes to life. The still air is shattered by unearthly screams as shambling corpses materialize all around you. The living dead all appear to be warriors, and one in particular captures your attention; a seven-foot tall giant dressed entirely in black armor and wielding a vicious-looking axe. \n\t>  NHYou feel a sudden burning sensation as the jade rat figurine turns white hot in your hands. Letting out a small cry of surprise, you drop the figurine to the ground, where it undergoes a rapid metamorphosis, transforming into a giant, ten-foot-tall albino rat before your eyes.\n\tThe rat-thing lets out a hideous mewling howl and sinks its sharp teeth into the black-clad warrior, who promptly vanishes in a cloud of foul-smelling gray smoke. The remaining undead warriors shriek in terror and run off into the forest. The giant rat lets out another ear-splitting howl and chases after the fleeing ghosts, leaving a trail of mangled trees in its wake."N^H!>&!N-I"Kaneiji.." it hisses, the word escaping from a jagged, bloody wound in its throat. Before you can flee or even scream, the zombie decaptitates you with a single swift blow of its axe.>" ONIC (Your hat of invisibility doesn't work on ghosts, apparently...)NI>\b\b\b***You have died***\b\b\b\b\t...Or so it seems...\b\t >  N%J>*>  >NvJ#MNJ\b\tYou hear horrible screaming noises from the direction of the bridge. Perhaps some of the ghosts tried to escape that way...N/K!>&>&& forest 11Black. Stunted. Twisted. Rotting. Deformed.MO actorN^o6BMO actorN6#You don't think they'd let you... &  footbridgeMNV:3It's a simple arch of stone that spans the river.>  0N:$ A big, nasty demon stands on it. ccc& gap 33It's a tiny space about the size of a human head.MO actorN]=PMOactordobjN:=KNg=-You carefully place the skull into the gap.N=>&!>&!<&N=N>AN >)There's no reason to put that in there. a TTT0 white orchid It's a perfect white orchid. {{{= JMNLa> > +<%! TNa=\b\tYou see a large white owl slowly circling far overhead.%*<% Na %*<% cNWbL\b\tThe great owl stares at you intently, slowly diving closer and closer.%*<%  %Nb*Nb<% NXc\b\tThe white owl begins to swoop towards you, but is quickly intercepted by a flock of crows, who squawk and beat at it with their wings until it is forced to retreat towards the top of the mountain.%Nc*<%   !%*>  &  birches HHThe white birches look like skeletal fingers rising from their graves. rrrB fog CCThe fog makes it impossible to keep track of where you're headed. qqq& briars 99White, thorny briars carpet the ground like razor wire. qqq& briars 99White, thorny briars carpet the ground like razor wire. l,,,$ Narrow ledge \b\tYou're perched precariously upon a narrow ledge on the side of the rock face, about thirty feet from the ground. West of here, a small opening leads into the mountain. A short climb down will take you back to the clearing below.DB_lll&  carvings 22The carvings depict scenes from the woman's life, most of them featuring a young samurai warrior: there are images of the two of them lying by a pond, sitting on a tree branch, walking in the woods. The largest carving, directly above the statue, shows the woman cradling the dying warrior in her arms. _&'  stone altar A detailed statue of a familiar-looking young woman fills the northern wall of the cave. The woman is kneeling, and her stone face bears an expression of inexpressable sadness. The woman's hands, cupped palms up, jut out from the stonework, forming a sort of altar.MO actorNBiOMOactordobjNfi {NfNj*You place the offering upon the altar.\b!NfqjC&"Nfj!sNfj {*You place the offering upon the altar.\bNf k!Nf8kC&"Nfk! Nfk'You place the purse upon the altar.\bNfk!"NflC&"Nfll^*You place the offering upon the altar.\b!NflC&"&MN m> _ Nn\b\tThe stone hands begin to glow with a soft amber light. The light gradually grows in intensity until it hurts your eyes to look at it. Suddenly, a horrible vision forms within the light: a woman's corpse, chained to the ground beneath a blood-red sky, the young samurai warrior struggling in vain to break the chains that bind her. Then, as quickly as it appeared, the light vanishes< .7N o+, along with all of the altar's contents.A!>  E >" hNp9\b\tThe amber light abruptly vanishes, leaving you floating in the dark. Although your senses are nullified, you have the strange sensation that you are moving at a tremendous rate of speed. Time passes, and the feeling of movement gradually ceases. You squint your eyes as the amber glow returns once again.>&C'N q>  E >" fNaqG\b\tFar away, you hear a mournful woman's voice cry out in anguish...>&Nq _x777$ Yomi (The Underworld) hh\b\tThis is no place for the living. Beneath a blood-red sky, shadowy, nightmarish forms creep at the edges of your vision across a barren wasteland. Shrill screams, occasionally punctuated by demonic cackles, pierce the air, and a foul breeze fills your nostrils with the stench of putrefaction.\b\tA woman's corpse is chained to the earth at your feet.\b ++You nearly gag on the foul odor of decay. 11The bizzare noises could drive one utterly mad. ((This is not the place to go exploring.  & corpse The corpse is a dessicated husk, wearing the tattered remains of a blue kimono. Three separate lengths of black chain run from a collar around the mummy's scrawny neck to metal posts set in the ground.'MNzw>  tNyh\b\tThe corpse suddenly jerks into life and struggles against the chains, letting out a bloodcurdling cry. Horribly, the mummy's leathery eyelids peel open to reveal a pair of beautiful brown eyes. The cadaver looks at you beseechingly, eyes filling with tears. \n\t"Kaneiji..." it whispers in a hollow voice before falling limply to the ground once more.(ZMNy?\b\tThe iron post and the chain attached to it have vanished.Niy)[MNy@\b\tThe steel post and the chain attached to it have vanished.Ny*\MNzA\b\tThe bronze post and the chain attached to it have vanished.Nz+MN{\b\b\tAs the last chain disappears, a remarkable transformation occurs. The corpse begins to blaze with a blinding, blue-white light that flares outward like a miniature sun. You shield your eyes as the light intensifies, washing out the landscape in a tidal wave of blue fire. When at long last you muster the courage to open your eyes again, you find that the light has subsided and your surroundings have changed dramatically...N{>& C, ```C sky 11It's unsettling to look at, like an open wound. vvvB shadowy forms 77You can't bring yourself to look at them too closely. ~~~B  landscape IIThe harsh, pitted landscape stretches into infinity in every direction. ,$ ))Ama-No-Uki-Hashi (The Bridge to Heaven) oo\b\tYou stand on a shore of silver sand at the edge of infinity, at one end of a celestial bridge which spans a vast sea of stars. A pearly mist surrounds you, hiding much of the landscape from view. You gaze in rapt fascination at the swirling galaxies above and below you, wondering how much of this you will remember when it is finally time for you to go home. ,,You will be home soon enough. Be patient. 0 0 0 & bridge The bridge is a massive, ethereal construct that spans the starry void ahead. It appears to go on forever; you can't even see the other end of it from here. ,Y MN \b\tBlinding blue light cuts through the mist behind you. You turn and see a woman-shaped pillar of blue flame walking towards you over the sands. As it gets closer, the flame slowly burns away, revealing a beautiful young woman in a blue silk kimono. She is crying, but the expression on her face is one of pure joy. Joyful tears spring to the warrior's face, as well, as he runs towards the woman with arms open wide.\n\tTheir laughter and sobs fill the air as they embrace, swirling like drunken dancers, kicking up clouds of silver sand that sparkle like fireflies around their heads.\b\tYou watch them for a while, enjoying the feeling of contentedness in your heart, and as their laughter turns to low whispers and tender exchanges you turn your attention to the stars. As you watch, scenes from the distant past take shape in the sky; you see the great samurai Meigi upon a golden throne... The daimyo Shinobu lying on a straw mattress inside a tiny cell... Gio cradling a beautiful baby boy in her arms... You lie back on the soft sand and let out a satisfied sigh, happy that you were able to do your part in helping these troubled spirits find peace at last. \b\tEventually, the lovers begin to make their way to the bridge, hand in hand, walking slowly as if afraid of losing each other again. As they pass you, Gio kneels down and gives you a soft kiss on the cheek. You smile, and place the white orchid you found in her dark hair. She squeezes your hands in gratitude and walks off towards the bridge. Kaneiji grasps your hands in his and bows deeply to you before heading off to join his lover. You stand and wave to the two spirits, feeling a bit foolish, and as you turn away for the last time you hear their voices once more, and to your surprise you can understand the words... \b\t Our love is the sky, eternal and boundless... \b\t\t Our love is the sea, endless and changing... \b\t\t\t Our love is the sun, forever renewed...\b\tWithout warning, the world swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\tN >&A!>&NB   >7! VN @\b\tYou get three bonus points for not using the walkthrough!! ] ] ]& chainsMN!}Three chains run from the collar to metal posts sunk in the earth around the body in a triangular pattern. The chains themselves seem to be made of a dense, black metal- perhaps steel. ! ONo}C\b\tThe iron post and the chain that was attached to it are gone. ! PN~D\b\tThe steel post and the chain that was attached to it are gone. MO actorN"~ KMO actorN>~,There's no way you can break these chains.       t t t&  iron post It's a sturdy iron post, sunk deep into the earth. A chain runs from the post to the collar around the corpses' neck. There's a tiny keyhole set into the post, just above the chain.oMO actorNfpAMO actorN >  You don't have the key!N UYou slip the golden key into the keyhole. It turns effortlessly in the lock. Suddenly, you feel very dizzy, and an uncomfortably familiar sensation overtakes you...\b\tWithout warning, the world swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\t>&N " !AC-N s#MOactorioNTt^MOactorioN}*  <p(N}vThat doesn't fit the lock.MO actorNPdMOactordobjN  <p,N  That won't fit in the keyhole.   &  steel post It's a sturdy steel post, sunk deep into the earth. A chain runs from the post to the collar around the corpses' neck. There's a tiny keyhole set into the post, just above the chain.oMO actorNqpUMO actorN>  You don't have the key!N`You slip the golden key into the keyhole. It turns effortlessly in the lock. Suddenly, you feel very dizzy, and an uncomfortably familiar sensation overtakes you...\b\tWithout warning, the world swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\t>&N" !AC.NN&s#MOactorioNj)t^MOactorioNM  <p(NThat doesn't fit the lock.MO actorNPdMOactordobjNۉ  <p,N0 That won't fit in the keyhole. XXX& collar wwThe thick metal collar is fastened tightly around the corpse's neck. Stout chains run from it to posts in the earth.MO actorNEMO actorN&There's no way to remove the collar.`    $ Outside the herbalist's \b\tCold rain falls from the evening sky, soaking your kimono and chilling you to the bone. Makumura's shop is a few yards to the north, an unassuming wooden cottage surrounded by maple trees.? You've been standing out here for over an hour, trying to gather the courage to enter the shop. You still can't find the strength to do it. EERunning away won't solve the problem. You have to make a decision. o o o &  cottage A fire burns in the hearth inside the cottage, flickering in the tiny windows. Ordinarily, the shop is a cheerful sight, but tonight it seems to lurk in the shadows like a ravenous beast.vMO actorNiwMO actorN"You've been standing out here for over an hour, trying to gather the courage to enter the shop. You still can't find the strength to do it.-MNܝ\b\tThe door to the cottage suddenly opens, startling you. Makumura steps out into the rain and walks over to you, an expression of concern on her face.&CN!MN9\b\tThe old woman puts a hand on your arm. You are surprised by the firmness in her grip, so powerful for such a frail-looking woman.\n\t"Gio," she says softly, "What on earth are doing out here? Come inside, child, and have some tea..." She tugs on you gently but insistently, guiding you towards the warmth of the shop.\b\t"I came here so that you could give me something to stop my pregnancy," you blurt out, not giving yourself a chance to think about the words. "I can't have this baby, Makumura-san, I am to marry the daimyo..." . Tears spill from your eyes at the mention of the child but you force yourself to continue. "It's Kaneiji's child, Makumura-san, Kaneiji's child..." You throw your arms around the old woman, sobbing hysterically. The herbalist holds you tightly, as if trying to squeeze the pain out of you.\n\t"Gods forgive me, Makumura-san, what am I going to do?" Your voice trails off to a whisper as the cold rain washes the tears off your face. "What am I going to do?"\b\tThe old woman releases you and looks you squarely in the eyes. There is strength in her gaze, and when she speaks, her voice is calm. "I cannot advise you here, Gio-san," she says. "You must listen to your heart in matters such as these. Trust what it tells you." She reaches up and strokes your cheek with her tiny hand. "I will do as you ask," she says, "no matter what you decide." \n\tYou turn away from here and turn your face towards the heavens, letting the rains wash over you. Closing your eyes, you let your mind drift, quieting your thoughts until your heart finally tells you the answer that was there all along. \n\t"I'm keeping this baby," you whisper. You open your eyes to see the herbalist smiling at you. Without another word, you run off into the dark forest, your footfalls splashing noisily in the cold waters.\b\tWithout warning, the world swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\t>&! NҦA!>&C(N#> ! E > ! E > ! NqC+ $  Throne room+MN\b\tShinobu's throne room is dark, save for a few small torches near the entrance. The gold furniture reflects the firelight into red and orange spectres that leap and dart among the shadows.  KN*? You watch the door, dreading the daimyo's imminent arrival. HHEvery instinct tells you to flee, but you've already made your choice.N N NB throne yyThe throne is made of gold and adorned with jewels. Intricate carvings of various deities cover it from top to bottom.MO actorNQ3MO actorNlYou wouldn't dare..MNz\b\tYour body tenses at the sound of footsteps outside the door. The moment you have been dreading has arrived. The door opens, and daimyo Shinobu steps into the chamber, accompanied by a small retinue of servants.>&&NĵC11dMN)\b\tShinobu makes a gesture to his servants, who immediately shuffle out of the throne room, shutting the door behind them. He makes his way slowly to his throne and sits down, then beckons you to come closer. Trembling with nervousness, you approach the throne and kneel at the daimyo's feet.!>&>&N\C22 MN \b\t"Your message sounded urgent," the old man says in his deep, raspy voice. "What is so important that you had to disturb me at this hour? An old man needs his rest, Gio." \n\tYou bow your head apologetically. You close your eyes, trying in vain to calm your racing heart. When you finally gather the nerve to speak, your voice is a whisper. "I have news of Kaneiji, daimyo-san." The words taste like poison coming out of your mouth.\n\tShinobu leans forward in his throne, cocking his head quizzically. "Has my hearing failed me, Gio?" he says. You shake your head, fighting back tears. The old man looks in you in the eye. His stare pierces like a cold nail. "It is ill luck to speak of the dead in this place, Gio," he says, voice rising in anger. "Kaneiji was my finest warrior. He died an honorable death in the Buke mountains, defending his lord. His name will not be forgotten. Do not speak it again in my presence."\n\t"He did not die there, daimyo-san," you force yourself to say. "The warrior lives..." \n\t"Stupid girl!" the daimyo spits, striking the ground next to you with his cane. "Why do you waste my time with such childish fantasies? Will you still behave in this manner when we are married? There will be consequences for your..."\n\t"I speak the truth, my lord," you reply softly, holding out the letter you received this morning. "The proof is in my hand."\b\tShinobu angrily snatches the parchment out of your grasp. "What is this..." His voice trails off to a whisper as he reads the letter aloud. You cringe at the sound of Kaneiji's words on the old man's tongue. "My love," he recites, his voice edged with mockery. "I return to the palace three nights from now. The daimyo has betrayed us to our enemies and must be killed. We will leave together and start our lives anew. Our love is the sky, eternal and boundless. Our love is the sea, endless and changing. Our love is the sun, forever renewed..." His dark eyes scan the parchment for a long time in silence, and his demeanor becomes deathly calm. Time passes, until the quiet finally becomes too much for you to bear.\n\t"Promise me you will spare him, Shinobu," you blurt out. "If you love me, promise me that..."\n\tThe old man looks at you, his expression unreadable. "You have my word, Gio," he replies quietly.\b\tWithout warning, the world swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\t>&! AN/!>&!>&C)N~> ! E > ! E > ! NC+   0 letter 99It's Kaneiji's letter, which you received this morning.MO actorNfS'HMO actorNm)You've already read it a hundred times.MO actorNqMO actorNRThe temptation to get rid of it certainly is great, but you manage to resist it./0 s s s&  bronze post It's a sturdy bronze post, sunk deep into the earth. A chain runs from the post to the collar around the corpses' neck. There's a tiny keyhole set into the post, just above the chain.oMO actorNp<MO actorN>  You don't have the key!NYou slip the golden key into the keyhole. It turns effortlessly in the lock. Suddenly, you feel very dizzy, and an uncomfortably familiar sensation overtakes you...\b\tWithout warning, the world swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\t>&Nԍ" !A&N$s#MOactorioNS/t^MOactorioN|S  <p(N|That doesn't fit the lock.MO actorNƎPdMOactordobjN  <p,N6 That won't fit in the keyhole. 6$ Palace dungeon BB\b\tYou are in a dark, narrow hallway beneath the palace. Fading daylight from the tiny windows near the ceiling gives you barely enough light to see by. A few minutes ago, you managed to slip Kaneiji's katana into his cell through the window; the open cell door to the north testifies to your plan's success so far. 77You should make sure Kaneiji's not in his cell first.?C You can't go that way.D You can't go that way.h'''B kimono Your favorite blue silk kimono, with the beautiful embroidered flowers. You cut off a piece of it earlier to wrap Kaneiji's sword.MO actorN`HMO actorN)That wouldn't be appropriate right now.    =  samurai The warrior's young face bears some resemblance to your own, although his bears a few battle scars and is lined with an unspeakable sadness. His armor is scarred, as well, and you notice a frail, dried orchid stitched into the breastplate. > }}\b\tThe warrior is here, on his knees beside the corpse, trying desperately to break the chains that bind it to the ground.%MN{>   \b\tMO actorNDMO actorNё%The samurai shoves you away rudely. % 44You catch a faint scent of orchids and cold earth.'MO actorN>  )NӒYou don't have a camera!uN!iYou take a snapshot of the ghost, knowing full well that these types of things NEVER show up on film... MO actorNrW ,MO actorNs Very funny.VMOvdpiN%The samurai ignores you completely.Nݓ*VVMOactordobjN$x N$͔The samurai's eyes widen and his mouth drops in surprise as you hand him the sword. "Domo origato gozaimas..." he whispers, caressing the blade. He tries using the sword to cut the chains, to no avail.!>x&N$  4 N$The samurai looks at the key in your hand, his face lighting up with gratitude. He starts to take it from you, then his eyes widen in shock as his hand passes right through it. Cursing, he turns away and continues struggling with the chains.(N$?He shoves you rudely away.MO actorNQ%MOactordobjNmx NThe samurai's eyes widen and his mouth drops in surprise as you hand him the sword. "Domo origato gozaimas..." he whispers, caressing the blade.!>x&NP  = N;The samurai looks at the key in your hand, his face lighting up with gratitude. He starts to take it from you, then his eyes widen in shock as his hand passes right through it. Cursing, he turns away and continues struggling with the chains.1N%The warrior doesn't even notice it.#MOactorioNRMOactorioNǘ.You don't speak his language, unfortunately.T The ghost doesn't respond. ^^^=  herbalist The herbalist is a tiny, stooped old woman, about ninety years of age. She is a kind, noble soul, with a warm heart and generous spirit. > NN\b\tThe herbalist stands nearby, watching you with an expression of concern.MO actorNzMO actorN5[You reach out for comfort. The old woman takes your hand in hers and caresses it gently. %[\ 22She smells like the herbs she keeps in her shop. MO actorN- QMO actorNQݬ2Hitting the old woman won't solve your problems.IMOvdpiN*!"Hush, child," she says kindly.*VGMOactordobjNs!She politely refuses the offer.MO actorND<MOactordobjNhѭShe doesn't respond.#MOactorioNEMOactorioN+!"Hush, child," she says kindly.T !!"Hush, child," she says kindly. [[[C sky ,,The sky rains down upon you indifferently. dddB  maple trees ''Even the trees look menacing tonight. `   B kimono ppYour favorite blue silk kimono, with the beautiful embroidered flowers, is sopping wet. It's probably ruined.MO actorN٩`TMO actorN5If you took it off, you'd probably die of exposure. = daimyo Shinobu is a wizened old man, whose features have been hardened by a lifetime of enduring and inflicting cruelties. He's wearing a black silk dressing gown and carrying a cane.> \b\tThe daimyo is here.MO actorNGMO actorN#(You can't bring yourself to touch him. %[\ ##He smells like the old man he is. MO actorNo =MO actorNIf only it were that simple.?MOvdpiN@"Silence!" he shouts.*V^MOactordobjN  Not yet.#NWHe refuses the offer.UV#MOactorioN;MOactorioN""Silence!" he shouts.T "Silence!" he shouts. .B kimono IIYour favorite blue silk kimono, with the beautiful embroidered flowers.MO actorNv[`HMO actorNw)That wouldn't be appropriate right now. &  servants iiThe servants watch the daimyo out of the corners of their eyes, ready to respond to his slightest whim. kkkB  torches 22The torches provide just enough light to see by. rrrB  furniture ==The furniture is a testament to Shinobu's expensive tastes. B doorpMN>  The door is closed.;N/You watch the door with nervous apprehension. d$$$B daimyo's possessions mmThe daimyo treats his possessions well; his ebony cane is impeccably polished and his clothing is spotless.MO actorN>GMO actorNX(You can't bring yourself to touch him.   $ Cell 55\b\tThe six-by-six cell was Kaneiji's home for the past three days. Feeble light seeps in from a single tiny window, barely illuminating the dingy straw mattress which is the sole piece of furniture. A horrible stench wafts from the small hole in the corner, and an occasional cockroach scuttles past you.6]MNl7\b\tYou notice some tiny pieces of wood on the floor.N& The smell is horrid.MN>3ENG6You feel a desire to look around a little bit first.XN2You step over the corpses and into the hall.\b\b>C4JMN>EN6You feel a desire to look around a little bit first.XNY2You step over the corpses and into the hall.\b\b>C4C You can't go that way.D You can't go that way.B  windows vvThe windows are little more than tiny slits at ceiling level. What meager daylight they allow in is fading rapidly. R  0 broken model ship'MN<3NYou bend over and examine the pieces more closely. They appear to be broken fragments of a model ship. Without thinking, you pick up all of the pieces and put them in your robe.Na<&"37N+They're broken fragments of a model ship.MO actorN_MO actorNdYou bend over and examine the pieces more closely. They appear to be broken fragments of a model ship. Without thinking, you pick up all of the pieces and put them in your robe.N<&"3MO actorNt^MO actorN6You feel an urge to hang onto them, for some reason.N= $ Palace dungeon \b\tYou are in a dark, narrow hallway beneath the palace. Fading daylight from the tiny windows near the ceiling gives you barely enough light to see by. MN5>  5N&The soldiers are blocking your path.WNKYou pick a direction at random. Kaneiji has to be down here somewhere...>   !>&C You can't go that way.D You can't go that way.l  &,  mattress ]]The moldy straw mattress is about three feet thick and takes up an entire wall of the cell. MO actorN%_MO actorN7You poke around in the straw but don't find anything.N&%45MN\b\tYou hear two men talking to the south. Your pulse quickens as you recognize Kaneiji's voice. Suddenly, clashing metal takes the place of words. You race towards the sounds of combat, heedless of the risk to yourself. Before you can get there, however, the fighting stops. Approaching the final corner, your heart rises into your throat as, as you imagine your lover's bloody remains on the floor. You round the turn and let out a cry of relief; the body on the ground in front of you is not Kaneiji's.NL&C55MN\\b\t"This way!" a man's voice shouts in the distance. You hear excited movement as the soldiers move in on their quarry. You quicken your pace, following the sounds of clinking armor. At last you see flickering torchlight ahead, and you soon find yourself in a narrow hallway filled with armed guards.\n\t"We have him!" a voice yells up ahead. You run behind the soldiers a short distance down the hall, and nearly crash into one when they abruptly stop in front of you.&C6N!>&6{ MN\b\tThe soldiers in front of you suddenly cry out in shock. In desperation, you throw yourself forward, shoving surprised warriors out of the way. In an instant you break through the wall of men, and stumble upon a scene of unimaginable horror.\n\tKaneiji kneels on the ground, slumped over in a growing pool of his own blood. His katana is sunk to the hilt in his stomach, and his bloodied hands are wrapped tightly around the blade. His eyes flicker open briefly for a moment, unseeing, then he lets out a soft moan as he falls to the floor.\b\t"No!!"\b\tYou tear yourself away from the surrounding warriors and collapse at Kaneiji's side, sobbing hysterically. You gather him in your arms and pull him close to you, as if to prevent his spirit from escaping the dying body. You stroke his cheek, numbly watching your tears falling onto his pale, lifeless face. Suddenly, his eyes open, and his failing gaze meets yours. His mouth struggles to move.\n\t"Why, my love?" the words echo in your ears, but you are not sure if you or Kaneiji spoke them. "Why?" \n\tAnd then it is over. The warrior collapses in your arms soundlessly, eyes rolling back in his head. You sit in silence for a long time, unable to move or speak, feeling Kaneiji's warm blood soaking your kimono. The soldiers depart without a word, leaving the two of you alone in the darkness.\b\tYou notice a faint amber light glowing from among the folds of your kimono. As if in a trance, you move aside the sticky fabric and retrieve a small wooden object. It's a takara-bune, your mind registers, a treasure ship. You peer closely at the glowing model with a sense of detached wonder. The seven gods of luck are represented in great detail; they seem to watch you solemnly from the bow of the tiny ship. Before you realize what you are doing, you whisper a prayer to the miniature gods.\n\t"Make this right, somehow," you say through your tears, as the glowing ship begins to fade away in your hands. "Make this right..."\b\tWithout warning, the world swirls and fades before your eyes, and you drift, bodiless, through a featureless, timeless void that seems to have no end. When you finally emerge from this death-like state you have no idea where or even who you are...\b\t>&! N!>&A!>&NcC*> ! E > ! E > ! $NC+N& window 66It's a tiny, barred window located near the ceiling.fMO actorNcwh|MO actorN]There's nothing to open; the window is little more than a slot in the wall above your head.MO actorN zMO actorN-q[The window is too far above your head; all you can see through it is a patch of gray sky.MO actorNzMO actorN[There's no way you could fit through the window even if you could somehow scale the wall.    }& QQQB sky ""The sky looks cold and uncaring. [ [ [& door ;;It's a thick, rusty iron door, without handles or hinges.fMO actorNfh:MO actorNThe door is already open.    oMO actorN]pBMO actorNy#This door doesn't have a keyhole. F  & hole DDIt's a toilet. You don't feel the need to examine it too closely.MO actorNoX%MO actorNThe hole is only a few inches around, and empties into a smelly pit beneath the cell floor. There's nothing in there that could possibly interest you.&%}%MO actorNqUGMO actorNp(You can smell it quite well from here. & dead warrior nnIt's the corpse of an enormous warrior, dressed entirely in black armor. He has a deep wound in his throat. R= daimyo The armored guards form a column in front of you ten men deep. Their backs are to you; they appear to be watching something further down the hall.> //\b\tThe guards fill the hall in front of you.MO actorNEMO actorN}You reach out to grab the nearest guard. He turns around and rudely shoves you away. "Get out of here, woman!" he snarls. %[\ MO actorN1 =MO actorN!MIf only it were that simple.EMOvdpiNdThe guards are preoccupied.*VCMOactordobjNThe guards are preoccupied.MO actorNCMOactordobjN"The guards are preoccupied.#MOactorioNe`AMOactorioNThe guards are preoccupied.T The guards are preoccupied. & bodies eeThe guards lie motionless in a large pool of blood, fearful expressions frozen on their pale faces.   &  roaches 77The horrid little creatures are everywhere, it seems.MO actorNeMO actorNrYou reach down and snatch a cockroach off the floor. After a few moments, the sensation of the squirming bug in your hand becomes unpleasant, and you let it go.MO actorNQ(5MO actorNuA revolting thought. B  windows vvThe windows are little more than tiny slits at ceiling level. What meager daylight they allow in is fading rapidly. f%%%=  samurai The warrior's young face bears some resemblance to your own, although his bears a few battle scars and a smile that belies a soul at peace. His armor is scarred, as well, and you notice that the dried orchid stitched into the breastplate has disappeared. > //\b\tThe warrior is here, gazing at the stars.MO actorNeAPMO actorN\1The samurai seems to welcome the human contact. % 44You catch a faint scent of orchids and cold earth.'MO actorNI">  )NIjYou don't have a camera!uNIiYou take a snapshot of the ghost, knowing full well that these types of things NEVER show up on film... MO actorN ,MO actorN8  Very funny.^MOvdpiNjz6The samurai is lost in thought, and doesn't respond.*VOMOactordobjNx NuThe samurai's eyes widen and his mouth drops in surprise as you hand him the sword. "Domo origato gozaimas..." he whispers, caressing the blade. He tries using the sword to cut the chains, to no avail.!>x&N  -*He smiles at you and shakes his head no.MO actorN#MOactordobjNGx NGThe samurai's eyes widen and his mouth drops in surprise as you hand him the sword. "Domo origato gozaimas..." he whispers, caressing the blade.!>x&NG  2/The warrior is too busy looking at the stars.#MOactorioNg;RMOactorioN^.You don't speak his language, unfortunately.T The ghost doesn't respond.   $ Shinobu Park entrance 11\b\tYou are at the entrance to the park grounds. Shinobu Palace looms majestically to the north, past a large pond. East and west, raked gravel paths wind into the trees, and a dirt road south heads back to the village. The sun is rising, painting the new day in brilliant reds, oranges, and yellows.? It's time to go home.A It's time to go home.B It's time to go home.@zMNcYou turn your back on the palace and head for home at last.\b\b\b\t\t*****You have won*****\b\b\b ,,The trees are too thick in that direction.C You can't go that way.D You can't go that way.C stars Swirling galaxies and dense, colorful nebulae fill the sky above and beneath you. You could stare at the hypnotic patterns forever. PPP& sand MMThe sand is silver, and sparkles in the starlight like a field of diamonds.MO actorNxMO actorNYou scoop up a handful of sand and watch it trickle through your fingers. It's as soft as talcum powder and cool to the touch.N> eee& mist 55It's a beautiful pearly haze that covers the shore. vvvC sun GGThe sun warms your face. You breathe deeply, grateful for a new day. WWWC palace %%The palace glows in the rising sun. TTTC pond $$The pond sparkles in the sunlight. NNNB paths It's time to go home.  @B trees LLThe Japanese red maples and spruce trees look beautiful in the dawn light.MO actorNxRMO actorN3None of the trees here are suitable for climbing.  YYYYY  walkthruYMO actorN)\b Walkthru for Katana by Matt Rohde (rohdemusic@yahoo.com)\b Part I - The Park\b\b\t Search the garbage and take the jokebook. Head north all the way to the palace gate and grab the walking stick. Then head back south to the park entrance and go west through the pines to the meadow. Once there, go south to the oak grove, drop the stick (you can't climb the tree with the stick in your hands) and climb the tree. Grab the nest (search it if you want), and climb the tree again. Examine the trunk. Take a good look at the portrait; you'll need to remember these details later. Especially examine the flower and the fretboard. Climb the tree again, and shake the branch. Climb all the way back down (don't jump!) and grab the torn-up kite and your stick. Head north to the meadow, and north again to the west shore of the pond. Move the reeds to find the raft. Look in your wallet. You'll find some gum in there. Examine it (note the part about it being sticky underwater). Chew it, and get the wad that you spit out. Stick the wad to the pole (I'll explain why in a minute.) Get in the raft and launch it. Go east under the footbridge. Get the object with the stick. It's a coin; take it. Go east again and land the raft. Search the ashes and get the can of kerosene. Get back in the raft, launch it again, and go west until you get back to the west shore. Land the raft and head south to the meadow.\n\tN) Give the coin you just found to the vendor and she'll hand you a packet of biscuits. Go west. Don't bother trying to give biscuits to the buck just yet; the other deer won't let you. Instead, try to take the book. A page will fall out. Read it. The next thing you should do is find some water. You can go to either the west shore of the pond or the south shore. Fill the nest with water and put the kite in the pond to get it wet (Again, I'll explain in a minute). Then make your way to the rock garden on the east side of the park grounds. If you look at the tomb door at the far east side of the garden you'll see four kanji symbols that represent the four elements. Statues around the corners of the garden represent these elements, with fires near them. Your job is basically to put out the fires using the elements the gods represent. To the northwest of the central island lies Ryujin, the god of water. (Check out the sands by each statue...) Pour the water from the nest onto the fire. Go back to the island and check out the slab; you should see the symbol for water - it's moved from the tomb door to the slab. Next head southwest (you can do these in any order) to the statue of the earth god Onamuji. The sand here is just piled around, so you can take it without messing up any artwork. Get some sand, then pour the handful of sand on the fire. Go back to the island and check the slab again if you want; you should see the symbol for earth there now. The next one is a little trickier; you need to start a fire at the base of the fire god's statue. To do this, head southeast to Fudo's statue and pour the kerosene on the coals. Then head to the northeast corner to Fujin's statue (or whatever fire is still burning), take a check out of your wallet and examine it (nothing else will burn properly). Light it with the fire. Then head quickly back to Fudo's statue and put the burning check on the coals. The fire symbol should now be on the slab as well. Finally, go back to the northeast corner and blow out the fire there. The final symbol should now be remobed from the tomb, and you can enter it. Note: if you screw up and put a fire out the wrong way (e.g. Pouring water on the earth god's fire or putting out all the fires before you start the fire god's fire), you can BLOW ON any of the hot embers to stoke the flame back to life. You still have to put it out again the proper way to make the symbols appear...\n\tN)D}Anyway, you now can get inside the tomb. You'll see a key lying in the dust here, which opens the palace gate. Don't try it just yet though, unless you feel like getting killed. You need something from the cellar of the tomb. Unfortunately, there's a supernatural darkness preventing you from entering! So let's fix that; First, clean the walls with the wet kite. You'll see paintings on three of the walls. Remember the page you read from the textbook? Now you're going to reenact a Japanese myth to get the lights turned on. First, touch the wall with Uzume's painting on it (the south wall). You'll find you're in a different body all of a sudden... To reenact this myth properly, the mirror has to be in the sakaki tree. You can't put it there, but your brother Susanowa can. Give the mirror to him. Next, dance! You need to DANCE a few times to lure Amaterasu out of her cave. Once you do this, you'll find yourself back in the antechamber. Now touch the north wall. You're in Susanowa's body now. Muscle your way past the other gods and put the mirror in the tree. Once you do this, you'll find yourself back in the antechamber again. Finally, touch the east wall. You're in Amaterasu's body now. Move the boulder. Once you do this, the reenactment is complete and you're back in the antechamber once again, and this time the lights are on! Go down into the burial chamber, and open the sarcophagus. You'll see a katana inside. When you take it, you'll be transported again, this time into a scene from your ancestor Kaneiji's life. Once this plays itself out, you'll be back in the burial chamber. Exit the tomb and head to the deer glade at the west end of the park. SCARE the deer away with your newfound sword (or just attack them), and give the biscuits to the buck. He'll cough up the Dillard Index of Japanese Mythology. You'll need this to look up the many deities you're going to encounter in the palace. Now, head up to the palace gate and unlock the gate with the key. The statue will come to life (surprise!) but now that you're armed with the katana you can simply kill him. Open the gate and enter the palace.\b\b\bN)-Part II- The Palace\b\b\t The first thing you see when you enter the courtyard is an enormous model of a takara-bune treasure ship. Look up takara bune (or just "takara" or "bune") in the index and take note of the seven gods and the treasures they carry. This part of the game involves finding these treasures and putting them in the ship. The order you do this in doesn't really matter, so start with an easy one; head to the empty stage to the west and check out the statue. If you read the descriptions of all the gods you should recognize Hotei, the god of laughter and happiness. Read the jokebook you found in the park. Your laughter should bring back some ancient memories here... You'll find yourself in another scene from Kaneiji's life. Examine the performers. You'll find one of them intriguing. Head west to the stage and check out the girl. You really want to talk to her, but can't seem to get her attention. Head west again to the flower garden. Which kind of flower does she like? Remember the carving in the oak tree? Get an orchid, and bring it back to her. When you give it to her you'll have a nice little chat and find yourself back in the present. Examine the statue (it's glowing now!) and get the model. Go east to the courtyard and put the model in the ship. Six more to go!\n\tN)$`Head southwest next until you enter the granary. This puzzle's a little trickier. You'll see two jars on an altar, a small one marked 3 and a large one marked 5. There's a hole in the altar marked with a 4. Read the entry for Daikoku. You'll see a note here mentioning a secret passage that can only be opened with "four handfuls of rice." The goal of the puzzle is to put four pounds of sand into the altar, measuring it using the three pound and five pound jars. There are two ways to do this; I'll just give you the easiest, which is: FILL LARGE. POUR LARGE IN SMALL. EMPTY SMALL. POUR LARGE IN SMALL. The small jar should now be two-thirds full of sand. Next, FILL LARGE again, and POUR LARGE IN SMALL. The large jar should now be four-fifths full of sand. POUR LARGE IN HOLE to trigger the mechanism within the altar. You'll be transported to yet another scene from your ancestor's life, this time in a rice paddy waiting to ambush some bandits. There's not much to do here for a while but wait and talk to your friend Meigi. When the bandits arrive, attack them. You'll find yourself chasing a few of them. Attack the bandits again, then battle the leader, Ryuko Matzumu (look familiar?) You'll have to DISMOUNT your bucking horse, then attack his horse. When the scene concludes, you'll find yourself back in the granary. Examine the statue, get the model bag, and put the model into the ship. Don't worry about the secret passage yet; it's too dark to see anything right now. Instead, go southeast from the courtyard until you enter the temple. Ignore the rubber spider; it's another red herring.\n\tN)'Look up Jurojin in the index. A note here says that the samurai used to meditate in this temple. You should, too. MEDITATE for about twelve turns consecutively and you'll travel back in time once more to Kaneiji's era. Leave the temple northwest, and listen to the biwa melody. Follow it south out of the palace. You'll find yourself lost for a while in the woods; don't worry, it's a fake maze. After about ten turns of wandering you'll stumble across a flute. Pick it up and play it, and follow the directions the answering biwa notes come from. Soon you should find the oak grove. Climb the young tree there, and get the carving knife. Gio will be here, playing her little heart out. CARVE the tree, and you'll be rewarded with a nice little romantic interlude. When it's over, you'll be back in the present. Search the statue in the temple and get the model, and put it in the ship in the courtyard. Four treasures left! \n\tN)U-Next, head east to the samurai barracks. Look up Bishamon in the index. Look up Oni as well; see the thing about treasures under their tongues? Search the demons and you'll find a piece of parchment. Read it. Now you can attempt to LARK the practice dummy. Unfortunately, it doesn't quite work properly... Your sword's dull from hacking up the statue. You can fix this, however. The Bishamon entry mentioned that the samurai sharpened their swords on the battlements. You can, too. Go west until you enter the garden. Then climb the wall. You'll find yourself on the parapet. Circle counter-clockwise through the watchtowers until you're on the east side of the outer wall, above the barracks. Examine the battlements. There should be some little grooves here; this is where the soldiers used to sharpen their weapons. SHARPEN the sword with the groove and return to the barracks. LARK the dummy. You'll find yourself in the midst of a battle. Examine the mountains and you'll see a passage to the east. Don't desert your men- instead, notice what happens here anytime a loud noise happens. YELL. Not loud enough? Type MEN, YELL and you'll start an avalanche. Head east through the pass and talk with Meigi for a while. After this scene you'll find yourself back in the barracks. Examine the statue and get your model. Head west to the courtyard and put the model in the ship. \n\tN):1At this point, you should see some strange things happen. Night will fall, and the spirits will summon a formless ghost (wonder who that could be!) The remaining treasures are on the other side of that stupid plywood wall. Fortunately, the secret passage beneath the granary will take you there, but you need some light. What's the brightest thing around? The ghost! Type GHOST, FOLLOW ME and he should start following you around. Go southwest until you enter the granary, then down. Now you can travel north to the palace proper. First, though, you need to be able to reach the trapdoor. For this you need to push the boulder a few times until it rolls down the passage. Keep following the rock down the passage and pushing it until it's beneath the trap door. Stand on the boulder and open the trap door. You still can't reach it? Try opening the trap door with the stick. A ladder should fall down. Climb it into the throne room. \n\tN)4PThe first thing you need to do here is to get the plastic sheeting. That should reveal some furniture. Next, get the pillow. It's too heavy to carry, but you can PUSH it so it comes to rest beneath the scaffolding. Then, drop the stick (can't climb with it) and climb the scaffolding. You'll see a bucket here. Push the bucket, and it'll fall onto the pillow below. Don't break the bucket- it'll make the game unwinnable! (Gio's ghost cries out in anguish whenever you make the game unwinnable...) Climb back down and grab the bucket. After that, head south until you enter the shrine. The ghost will become enthralled by the statue here and stop following you. Don't mess with the biwa just yet. Our ghost needs to be a little more substantial before it'll do anything worthwhile. You can do the next two puzzles in any order. \n\tN)= For now, head west to the pools. Look up Ebisu, read the sign, then look up chowa in the index. This next puzzle is a variation on the classic "dog, cat, and bird crossing the river" bit. You have to get all three fish into the large pool. Your bucket will only hold one at a time. Put the blue fish in the bucket, then put it into the large pool. Next, put the green fish (or yellow, it doesn't really matter) in the bucket, and put it in the large pool. At this point, the green fish will start chasing the blue one. Quickly put the blue fish back into the bucket, then into the small pool again. Now the blue fish will start chasing the yellow one! Just put the yellow fish in the bucket, then into the large pool. Now all you have to do is put the blue fish in the bucket and then into the large pool, and the fisherman statue will catch the big fish. You'll be transported once more to Kaneiji's time, and another romantic interlude. This one ends a bit tragically. There's not much interactivity in this one; just wait it out and you'll find yourself back at the pools. Examine the statue and grab your prize. Hang on to it for now; there's no way to get back to the courtyard from here (try it, you'll see). \n\t Next, head through the shrine and keep going to the east until you enter the library. Look up Fukurokuju and you should find a date in there. Search shelf 1618 and you'll get a pile of haikus that are translated into English. They're all nice poems by actual haiku masters, but the only one relevant to the game is the one by Tsuji. This is a logic puzzle; the poem is the key to putting the birds in the proper nests. Put the crow in the red nest, the swan in the orange nest, the raven in the yellow nest, the owl in the green nest, and the dove in the blue nest. Nothing happens! At least until you try to leave... As you exit the library, you'll find yourself pulled back in time once more. You're storming the castle, preparing to kill the treacherous daimyo. This scene isn't all that interactive either, but you do have to BURN the tree. After that, Meigi shows up and talks to you, and you'll soon arrive back in the present time. Examine the statue and get your model, and head back to the shrine. \n\tN)DXAt this point, the ghost should be revving up. You need to get him to sing. Remember the oak tree back in the park? Did you write down Gio's positions on the fretboard? It doesn't matter; this is a walkthrough! Press the earth fret and then pluck the third string. The ghost should start singing. To keep him going, you need to hit the next note in the song. Check out the sheet music here; it shows you the next two notes in the sequence. Press the fire fret and then pluck the first string. The ghost should be really inspired now and hit a high note. To finish the song, press the gold fret and pluck the fourth string. You have to do all this pretty quickly. The ghost's song should reach a fevered pitch and you'll be transported again, this time to a nasty cell awaiting your execution for treason. First, search the straw, and you'll find a little object buried in there. Examine it. The little takara-bune will remind you of the child that Gio aborted (so you thought). After a few turns of wallowing in misery, you will see someone toss a package into your cell. Open it. It's your sword! After you do this, the guards will come in a few turns. You're armed now. Kill them. Wander the dungeon a bit until you encounter your old friend Ryuko Matzumu. Kill him, too. It'll take a while, but you'll manage. Soon after that the guards will close in on you. Kill them. Oh, wait, you can't. Instead, show some dignity and kill yourself instead. Gio will show up at the last minute and you'll have a poignant death scene. When it's over, you'll be back once again in the shrine. Examine the statue and get your prize, then head south after the ghost, who should be very recognizable now. The wind has knocked over the wall, so you can reach the ship. Put the final three treasures into it. Congratulations! You've reached the endgame!\b\b\bN)YKPart III- The Endgame\b\b\t The treasure ship should now be life-sized. Climb the rope ladder, and head aft (you can check out the gods if you want) to the steering wheel. You need to do a few things to get moving. Examine the post, and you'll find some familiar looking symbols. You need to touch them to activate the ship. The order doesn't matter, but for simplicity's sake touch the water symbol, then the fire symbol, then the earth symbol, then the wind symbol. Next, turn the wheel. You'll automatically steer for the shadowy island. Wait around a few turns until you get there. A little skiff will approach the treasure ship. Head fore and go down when it arrives. All your material possessions will vanish at this point. Don't worry, Benten has given you all you will need to finish the game. Once on the skiff, the Charon-esque boatman will take you to the island of the dead. Before he'll let you off the boat, though, you've gotta pay him. But you have no money! Don't worry. Take the origami ship that Benten gave you and LIGHT it with the torch on the back of the skiff. It'll transform into the seven treasures of the Shijiki- Fujukin. Problem is, you can only carry one at a time. There's a way around this, though; I'll explain in a minute. What you need to do now is take the mallet and look at it. Do what the god does on the handle and WAVE it. A pile of coins will appear. Take them (drop the mallet first, the coins are a treasure too!) and give them to the pilot. He'll then let you off the boat.\n\tN)TO You're now on the island of the dead. Time to go exploring. First, climb that mountain to the west... Ouch! Luckily, death works differently here. Get up, then check out the cairn you ended up in. See the crystal skull in the base? Take it. Next, head west and pick up the hat and put it on. Head north. Head north again and cross the bridge. That nasty demon won't be able to see you. Put the crystal skull in the gap at the base of the wooden cairn. This will allow you to be reincarnated at the wooden cairn instead of the bone one (If you get killed while the skull is not in a cairn, you die for real). Don't enter the forest yet. There's nasty ghosts in there who will kill you; Instead, head back south. Now to deal with this inventory problem. Remember the description of the treasures in the index? The purse is "inexhaustible". So take the hat off and put it (or throw it) inside. Same with the rest of the treasures. How do I get them back? , you ask. Be patient. Get the purse and head north. \n\tN)U8You need to get yourself killed now; it doesn't matter how. Walk across the bridge and let the Oni do it. Since you already moved the skull you'll be reincarnated in the clearing. Now you need to do something about those ghosts. Luckily, one of your treasures is the ghost-chasing rat. Look in the purse. See how much space is inside? Maybe you could fit in it, as well. Enter the purse, get the rat, and go up. Then enter the forest. After a few turns, the ghosts should come, but the rat will take care of them. Now you can explore some more. Unfortunately, you need to be "lucky" to find anything here. Luckily, one of the other treasures is a "lucky" coat! Go back to the purse, get in it, get the coat, wear it, and return to the northern part of the forest. You'll stumble across an orchid and a path through the briars to the northwest. Almost done! Take off the coat and drop it, go back and get the bag of rice from the purse. Follow that new path into the clearing. The birds won't let you up the mountain! Maybe they're just hungry. Spill the bag. The endless mounds of rice will keep the birds occupied. Return to where you left the purse and get it. Climb up to ledge and enter the altar room to the west. You should find your katana here. Now for a little experiment. Put the katana on the altar. It'll disappear after a few turns. Where did it go? One way to find out. Put the purse on the altar, then get in the purse. When you emerge, you'll be in a nice little place called Yomi (Look it up and read the bit about the magic altars...).\n\tN)jZYomi is the Japanese underworld. It's not a very pleasant place. You'll see Gio's corpse here, chained to three posts in the ground. She's bound here, chained by guilt caused by decisions she made in her life. You can free her, though! Get the key from the purse and unlock the iron post (the order isn't important). You'll find yourself reliving a scene from Gio's life, where she decides to keep her baby. There's no interactivity here; when it plays itself out, you'll be back in hell. Next, unlock the steel post. You'll be transported to the scene in Gio's life where she betrays Kaneiji to the daimyo. Again, no real interactivity required. When you arrive back in hell, unlock the final bronze post. You'll relive the whole dungeon sequence from Gio's point of view. The only thing you have to do here is to get the wooden pieces of the treasure ship from Kaneiji's cell. Then wander the dungeon until you relive Kaneiji's death scene again. When you return, all the chains will be gone, and you'll find yourself at the bridge to heaven. From here, the game is basically over. Enjoy the final scene and exit Shinobu park to the south when it's over. You should have 137 points. Congrats!!!"7N)Z VAFSTy BjjxxQ t bb1      VV 88 /hhH\\..!FFVhVV/^^L<<1 !**g"#88$**% &ff!'"(h7#)\0'*qS'+q',C(-(.||*0**^+1+2,3A0415ff16O373849` 7:7;JIK:<i==bb >>t>?>@|;@Ad@Bba]DCEE::FF^+FGLH& $LIb"$UJ""MUK@@vULYM{ZNj$[O[P[QG\R""^S(bU%dVdc eWteXgYjjkZrk[d#k\Ck] l^fp_$q`fqaj$rb` rcrdb"sev5sfgsg`Sthjptib!tjb! uki1ul\umuunu@voyvp|;ws~=xt\Gxu|;jxv|;xw|;xxV0yyVMyzy{lz|uz}~ {~g{e{gj|j|fI}\}}` ~~=~n- 6@j}xx8my5,|;h~=K\@\cAQ΄S&uz9V??W~>~>C'CqCC|;O{>{{B{ċ{F{Ȍ{J{̍gN{{>V Ґ@-̘m d#֛` f%Bb"nd$f%d#d#d$BTmDDӞ00ZZ٠:jjJ w8ZZ` Yx8.g"h.g.@`.C,. c uU NM %RWzz1CxyB_.j_v!"` $''P'(|<~)@)?*AN*z9*M*6*+>',+-C-S.z:p.i. !/ Y/ z9 0 |;L0 Y0h0]11xw2po4|;H<zz<Y==Z> ?zoAx7ABfFR8GPH H!I"oJ#JK$V_K%|K&z9L'fDL(L)^M*N+N,P- Q.Q/qR0S1S2  :T3aU4^U5$!\6_7\d8 i9Ji:Lj;gj< &l=b!o>\t?w6t@QxA ~B~CgDEFEGg˂H:9Ip-9JbmKLn-M RN "OzPuQ Rz:”Sz:Tz5DU|9V~:W4XY~9Z.Ǘ[g\T)]:^Ţ_YaObBQcXdL e`$fTJgehp ijzGkvȵlEmnaopaqr&stCuvw_Qx K y z{|&}~M0x(uZ>P&dcF65z5.jBB^[ePPPPzyux>SYgPParq>0O|m{VA lT\f*p0kD;@pp(w| ,Sl+^Ot (7 s%&B &hCe}3VVsrCr!n0v54SK7S9;n=>?@R C 9ItNQyQs&RRh/SVS^S^ T`T T\]\]\]\^\)^L^\,`^O`^t`^`^`^`^aV-ax7cTc~#dFeJ fn.h>>:i^j^j^j^jn.k^Hlv6ml^mN m^n^o-o^o ^$p ^Ip ^np ^p ^p^pH2q;sj*uF4vT@wT[xl,vy^z^z^z^{={^)|~>N|P}R~p/ .8!t,"#Be$%m& '(N!)6*vu+^~,-^w.^/F0^β1[2^U3Dz4H5k6n7z8g69`: ;^<Z=Xo>T?f)@A/B^:C^_DEH[F:HIsJ^K^L^CM^hN^O^P^Q^R!S^T4*U^%VL JW^]XY^(Z^M[z9r\^]^^_^`a^b^c^d^e6(f^%gJh^(iMj^)kNl^mBn^oHp>qj) rH< s@K tRuvnwPx|y6"z${R{%|%}l(~ V *YZ77pp>^?^@^@@^e@^@^@P@XAIB]BD;C^QE^vE^E^E^E^ F/FFVGHNHTIZ4JnKd Ldjg} hf%johsBsTtTuZ5uTUgrd$ &0 U  a^^^ ^^f%n^a.f%plN ~UF%t2R|hDBBn..h'&l+x:c,VHlc]kv9  Yo/L Zl,@Y)l+  TS(_",^,^,^,^,^-^A-t$f-&1E3"3U4z-D8x<"=>W?C"lEUF "G  G H HI ^I^J^+J^PJ^uJ^J^JeJPKKuMQNWTP{Rk4TVR,W<X k]^!H_"`#|;ia$J b% e&h'fk(Al)Ho*Feo+Qqr,hr-(8s.t/r2t0w1Zx2x3oz4 5Ɗ6V]7\z8݋9t:J;֍<\\=I~>Λ?@T@eArC DmEFlGG|I=JfKb"L M}OSPCmQRFS|TvUVUWp-XYyZ[r1\( ]y^]u_& ` a<JbcXhdeG_fg [hgi@bjikC#l> m#mq-n^%.pk0qR0r:0sF1t?2uS,6vj6w_8x]9yr:zo;{x7<|P#0]&FT*`+2./0 ]102Z3^i468C::D;f=z#>>a?@cADn-Dv5EHHvM|< NMOz9P [ %QaZZT\\d$^N _,eJ mj*s yp/Fx(@@F [ d$]  } {o4oekj[ܡ>yj,b!Z |lov c c!;]"@#p%S&Xw't3ֲ(),*n+X ,D'-r./h0@1C2Dd3I4A5KG6Q74849:\<N=`D>l+?J @A{BQ-CDJ'EFG  Hl + IJKIL  M N~!O&"P4"Q#R$SI~I!&V\oW pXbzYYB{Z|[c\b]U^_l,̅`TaPbu0cQdQed.\fglhijRklvmb nDsoD}pbqrsXt|<uKvwmۭxmOy^îz@{|}:~˵ujjv6N >R4Gq Tu&n-&Ilh^h<dH)7 ^oJk?*WcHngY^d x^ ^7 ^\ ^ K ^ <^a{ZPZq]<!~=#dd<%d%t&a6((Vs*g*>,4z#57|8t+9[9AAcBTD{`DFrjGqGq[Hl,HlJyKx7SLU`Zvf[~[,h\ 0 [^]htjqoXtau o EwNjs\6֘h'Қ ^[d[` ƪ.k)rd$yR/;lQ[1FR2Jf%fHP ecvWLTN @Z YY` VC INHV WXP#$%$&'0(&%')*X+W,(-.0-10203242526708&9:&;$<=>P?=@YA=BCE&F0GH&GIJHK0%LYMNO'PQ0RSRU0V0WXYZY[\Y]G^T_`abcde%fRghijklm9n:o pYqYrYZsYtuYvYwYxZyZzY{|}~]VUYY#Y['YYYYYYZYYYYYYYYYY YZ^YZ$ YYYYYpYY$_YYY-0Y)))YY0Y$YYYYYYYYYYYYYYY Y Y Y Y YY>YYY&0&Y 0YY !Y"Y#Y$% &Y' (Y)Y*  +0,Y-Y.Y/Y0Y1Y2*32 40 50 60 708Y9Y:Y;3<Y== >&?$@$BYC;DYEC F0GYH$I$J$K$L$M$N$O$PYQYRYSYT&UYVYWYXYYYZZ[Y\$]Y^_YaYb$c$d$e$f$g$hYiEji k0lYmYnYoYpqYrYsYtYuYvjwU& x0yYzv{Y|z}Y~Y|YY$$YYY,0$-YZ$YY&YYYS&.& YYYY&FFFFFFFFFFFFFFFFFFF@&$$$$$@B@&@C@&& 0P 0 & & & & 0$ 0 0 0 =*****$*@IIIIII&$&&&&$&M$$$& M    &BNBMNN&N&N& $!$"$ #('$$%$ &&'%C($ )=*B+,*,$-(*./*/$01*1$23*3$ 4&5$6/B7/&8/B9/B:(&;$ <0 =0 >=?1B@1&ACB/AC(AD$E$F$H=IBJIKDILLIMINdIOEIPFIQRIRSTITUVIVWXIX$YIZ[I[$\KI]^I^$_`I`$aJIbIIcHIdeIe$fgIg$hiIi$jkIk$lmIm$noIo$pBqr0r0>sq&tr0 u0vw&wi&xym&z& {0|}&}&> ~06Bb=0CDL`H0CBBDC&DdRTVLDBEBEBEBEBFCFBFB=&&& 0 0BB[=[C[B[&[= 06& KdCdB& 0P 0DdRTTCVXdBd&$d&BR& &LCT&V=X&X&PXB0 0 UXBKCKBK&J&IBI&&&&&& 0CHBH&H& &LCL&'LC`C`&`&'`C`B`B& =&CB&6&&&B & B@&&& &B^mgeiog&&o&e&&k&&  ^& ^C B ^ m g e i k o mCm&&6&6w&6k&&6o&oC!&?0 $!?&"!&#?& $& %& && '&(*0)$*=+B,B-&.-&/-&0(&12& 203&4=5C6$7B8C9&:9&;9&<&==>&?&@BA &>6C&DCBEBFBGCBI!&'J&K3= L= M0OBP&Q&RQSR&TS& U06VT&WS& X0 Y& Z0[\=\\=]\&^$ _&`\&a\&Cb\&Cc\&'da&C e& f& g&h\&i\=j$kj= l=mjBnk&pBqBr&'sQts&ut& v&wbBxbCyc&zbC{c&|c&}bC~v&c=$c&bCc&c=&B&0$& 0&&Q&e&e&$f&$&C& 0$&Cg&g=&&& &I0I0>!Q&I&I&$= 0I&>!&!& =&CC&C=B$&=B&& = &&&& 0 0 0 0 0;;;;;$ 0;Q& 06 06 06 06 06 06 06;&;&;&;&;&;B&P;&;&# B&&&$B&&0 = 0&,B,&,B=,==, &&,&,Q&,& &,& 3B 3B 3& 3 33B5&5& & &( & &(5& &&' &'&B5&5&5CB B!O&'"&#O& %& &0'$((&)(&*(B+(,',+&-(&.,&/+&0+&1+&2(&3+&4+&5+&6+&7+&8+&9$:>& <= =&>$?9&,@9&A9&B9BC9&D9& E0 F0 G= H= I= J0 K0 L&M>BNH&OH&PL&QL&RL&SYVL&W'&X'B Y& Z&[ZC\B ]& ^0_$ `a$ba&cBdBe=fegeheiejekelemBnBoBp&q{&r{&s{&t{& uC vC wC xC y& z&C{& |C }C ~C C C C & &Bz&C0 =aCa= C $CaCaC&&b& 0     0 >$$ $ &&& &B$$&CC$$C&&&,& &&,C&C& 0 &=&&& &&&&&& 0=&B&&$_&_&'$&CBB$&&&&&$&$B 0&$ B= =CBB =B &BBBB$B 0$&,&B&& & =&&B=$C&&CCCB B Y AFMTSTR Qpyouqyourryou'resyoumtyou'veusveswhavexdoyarezmePREINIT­ REQ hxCMPD ontoontointointoin between inbetweendownindownindownondownonuponuponoutofoutofoffofoffofSPECWORD fOof,and.thenAallA everythingBbothXbutXexceptNonePonesIitIthereTthemMhimRherYanyYeitherVOCak xagainbledgefencechainchain4chainimageimageimageimageclean#clean"crackcrackfieldmfieldflameflameflamexflameflame2flame2flameEflameflame|breakbreakNplaceplaceoceanoceanoceanoceanoceanUpieceqpieceamberamberamber)amberchair~climbthrough~climbout~climbupdebug~climb]climbbirchtablebriefwboardsedanmeigimeigilmeigiimeigi emberemberemberemberember largelargelargelargelargelargelarge*brick?brick6brickbrickspacespaceshakecairncairncairnroach@roachbashokknifekanjikanjikanjikanjiskanjiRkanjirkanjiqkanjitkanjiskanjiQkanjiAkanjikanjikanjikanjikanjikanjikanjikanjizkanjiMleavehandsnhandsflashBscaredrainfangsmaple maplemaplemaplebloodQbloodpatchBpatchpatchtbunchioffofGshapeshapegreengreengreengreengreen+green$greengreengreenmodeldmodelcmodelZmodelWmodel&model&modelEmodel<model<model=model=modelmodelmodelmodelmodelmodelmodelmodelmodelmodelmcarvePlaughshelfshelfpaddypaddyffight[fight coalscoalscoalscoalsvcoalscoalschowaofferofferbskiffzskiffguardIguard=guard<guardmetalmetalmetaldemondemonTdemondemonreedsreedsthickthickthickLgiantHgiantgiantgiantgiant}plain|plainplainaltarIaltarstagestagerstagepeaksepeaksapeaksgrimetearth5earth5earthearthearth ashesashesashesashesashesashesbirdsbirdsbirdshellohelloywheelpwheel!plankQplateNplateplateriderknockatknockonfcloseRclosejewelcloudnlimbsbonesbonesnbones^paperthreekilogramthreeFindexweedsfebisuebisuebisulightlightlightLlight>light)light:light.lightlightlight,lightdrinkVdrinksheetEfires smallsmallsmallsmallsmall4smallsmallsmallsmall{smallsmallsmall@slatehhoteithoteihoteisleepZsleep(glassdaisyJclothFclothclothclothstandupstandstandstandon7thirdbrassspearWspear7robes%robes+robes[aboutcoinsravenfujinfujin|smashscoreebonysteel`steelQsteelNsteelsteelxsteelgnatslayerlayersmellnoisefenemy`enemystick)stickunderenter^entersmoke[crowdcrowdcrowd@fiery8skies5skiesFcovercoverpinespinessandypluckscrub?wankotorchtorchtorchflute grassgrassgrassgrassgrass8grasspaths*paths6pathspathsplughhorsehorsehorsehorsearmorVarmorQarmorNarmor:armorarmorarmor)music}musicsteepsteepshoreshoreshorevshoreushoreshoreshorefrogswhite white white white white whitewhitewhitewhitewhitewhitewhitewhitewhitewhite7white%white*whitewhitedresstastewomanwomanwoman,womanKwomanwomanwomanvwomanwoman&woman%woman*womanwomanrocksrocks}trashhocus<floorfloormoundmoundmoundmuddymuddy treestreestreestreestreestreestreestrees treestreestreestreestreestreestreestreestreestreesptreesCwallsBwallswallswallswallswallswallswallswallswalls#wallswallswallswallswallsAwallswalls water waterwaterwaterwaterwaterwaterwaterwaterwaterwaterwaterwaterwaterwaterwaterwaterwaterqwater3water3water4waterwaterwaterwaterwaterwatertersetouchStouch###glyphglyphglyphzglyphspill_spillmscrew9screwyroughghostghostdghostcghostLghost>ghost)ghostghostvines}untie{severwaves<whirl/stokehintsphintsforms[formsPdoors7toriiriverriverpilotpilotpilot0firstskinsbrownbrownrbrowntmoney9dropssoundnlungsroofsroofsroofsroofsroofsroofsroofs~soggystone stone stone stone stone stonestonestonestonestonestone?stone;stone/stonestonestonestonestonehornsbagbagbagbagubagbagbagpocusskullskullskullskullskull{shinyshiny$northnorthnorthnorthYdummyJdummydirtyroseswoodswoodswoodswoodswoodswoodswoodswoodswoodswoodsBspookscourvaultstars poolspoolsgroupwoundnwoundVmouthshootjoutofjab^press&presscrowscrowstuliptwigsslitsslitstsuji`swordKswordswordswordXswordxswordwsword!stepsstepsstepsstepspursepursepurse7emptyemptystrawstraw?straw?straw%ruinsruinstowertowertowertowertowertoweryoungyoungLyoungKyoungyoungyoungvyoungyoung7can6can}canentryentryentryentryentryentryentryentryentryentryentryentryentryentryentryentryentryentryentrystrip3smount%southsouthsouthsouthshoutat[shoutatshout[shoutcapftroop`trooptrunktrunktrunktrunktrunkthrowthrow\digin\digmummy5rowdyrowdystorm=storm$stormfrotz%uzume>uzume*uzumeuzumelotusfurrygapgap]gapgapdoe-stroppostspostspostsseaseaseaseaseaseaAlid}binLryukoHryukolgodlgodkgodkgodjgodjgodigodigodhgodhgodggodggodfgodfgodegodegod=goddogrageateatvliedowninvliedownonvliedownvlieinvlieonvlieredredred>redred@red&redwredredoakoakoakoakoakoakoakfatfatfatfatfatfatfattfatfatfatfataftoffoffioffotwist twistfogfogmfog\fogXfog +blue-greenmanmanmanmanmanmanmanman}man|mantmanHman=manmanwmanairairwad+wadjarjarhathathatNdipdipjoePaxeOaxeaxeaxeaxegiogioKgiogiooldoldoldoldoldoldoldoldHoldwold~old|old*askXaskmenmenmenmenkmengmen_men\menxkat9dewgetupwgetonwgetintowgetinLgetoffofLgetoffLgetoutofLgetouthgetget`dontheoaroar+mat five-kilogram~tiekoikoikoikoikoikoikoithree-kilogram}hithitjugjugmaxonionionirat=rat4rustyyfixbowkey&keykeygum+gumqgum hothothothothot0fly{cutfurpitsaywetwetbuyusitdownonusitdowninusitdownusitusitinusitonowl 7quik-lite 6quik-litensunlsunjsunhsunfsundsuncsunbsunasun_sun]sun\sunZsunYsunWsunUsunSsunQsunPsunOsunNsunMsunLsunKsunJsunsunsunsunsunsunsunsunsunsunsunsunsunsunsunIsunsunskyskyskyskyskyskynskylskyjskyhskyfskydskycskybskyasky_sky]sky\skyZskyYskyWskyUskySskyQskyPskyOskyNskyMskyLskyKskyJsky2sky0sky.sky-sky+skyskyskyskyskyskyskyskyskyskyskyskyskyskyskyskyskyskyskyskyskyskyskyskyskyoskynskyBsky8sky5skyIsky*skyskyjoutMout(putoutNputputaputdownputdown`putonputon abracadabraxyzzybarbedlagacha characters characters characters characters scharacters Rcharacters Qcharacters Acharacters character character character zcharacter$bearded|garbagedd&eeeepalacepalacepalacepalacepalacepalaceCpalaceBpalacepalacepalacepalacepalaceApalacepalaceFpackagexgwdiagramcrackerscameradetachdetachzibehindsdeactiv 7snow-white "blackness Fcardboard cardboardPbarracksbarracks calligraphypagodapagodapagodapagoda]ladderYladderladder4ladderllintolintollinsidelinsidenibblelbehindlbehindlbeneathlbeneathlunderlunder{lthrulthru{lthroughlthroughtlaroundlaroundtllllonlonllinlin)lat latbirchesleaderleadermneedlesbridgebridgebridgebridgebridgebridgebridgebridge herbalisttakehamaancient<branch3branchbranchbranchbranches<branches3branchesbranchesbranchesbranches$nnnncloakedcloakedcloakedPgiggledecant_decantbeneath`katanaKkatanakatanaXkatanaxkatanabambooYbambooJbamboobamboo+chewedacceptfedora {hidarizukai zhidarizukai reflectiongardenstchecksgarden gardengardengardengardengarden reflectingqqroaches@roacheskaneijikaneijiLkaneiji>kaneiji#scaffoldscaffoldbanditbanditbanditsbanditsbanditshibiscusdigital Cscaffolding Bscaffolding #scaffolding scaffolding Ascaffoldingabrasivehoodedhoodedhoodedbrigandbrigands eavalanchemarblemarblemarblemarblemarblemarbleAmarbleymarblerleathergdaikokudaikokudaikoku%sssseledgesbledgesdeitiesdeitiesGdeities<sakaki3sakakicreeperskbishamonSbishamonbishamondtakaractakaraZtakaraWtakaratakara dtakara-bune ctakara-bune Ztakara-bune Wtakara-bune takara-bunehmeditateht$t necken-swayfarchersdarchersmichikoAcoffinGdarkness"darknessdarkness landscape landscape landscape landscape landscape landscape landscape alandscape landscapeevacuateuu_attachattachgalaxieschainsimageslgoddesskgoddessjgoddessigoddesshgoddessggoddessfgoddesslgoddessegoddessbodiesbodies=bodies =goddesses 4goddesseshandful5handful7arches hconcentratesearch searchbuckleupbuckle_connectconnectcracksFcouches^objectFobjectEobject{objectobjectscragglyww8highestfriendfriendlfriendifriendfmassacre[massacrefriendlyflamesflamesflamesxflamesflamesEflameswflamesflamesthicketsFdillardpacketpackets}attackattackractivate)x xpiecesgoldengoldenforehead carnationhshieldsorchidsorchidVorchid:orchidorchidorchidorchidbuildingPbuildingbuildingbuilding@building buildings Pbuildings buildings buildingshammer beautiful Kbeautiful beautiful beautiful vbeautiful *beautiful$garmentsgiganticcatfish ~paperback~jokebookconcrete &amaterasu amaterasuPchuckleyz firelightdragons parchment )parchment Uparchment lacquered lacquered lacquered lacquered tlacquered SlacqueredFtablesbdragonzdragondragonislandislandvislanduislandxislandwislandislandisland islandtchequesuchequetcheque?boulder;boulder/boulder&boulder#bouldergranarygranaryscreamatscream!launchcreditsremainsremainscanvas6second cementcement battle-axeribbonhyacinthfbattle[battlerubblecastlecastlecastlecastlecastlecastlecastleorange&orange}orangelibrary@library battlements battlements battlementslbenten,bentenbentenbuggerseparateginsidebetweencollar(displaylargeroctagonoctagonoctagonoctagonoctagonoctagon octagon octagonmeadowmeadowmeadowmeadowmeadow apparition apparition Lapparition >apparition )apparition apparitiondisplaysprickersprickersbucketbucketsmaller4puddle embersembersembersembersvembersembersstagnantburialburial^origami^origamigingkogingkohelmetsandpilepassagebiscuitbiscuitbiscuitbiscuitsbiscuitsspacesspacesspacesmalletmalletmalletmallet underbrush underbrushIsoldier+tatami spectators spectatorsmscenerysoldiersIsoldiers<soldiersksoldiersfsoldiersgsoldiers_soldiers\soldiers`soldiers *happinessfearsomeleavesleavesleavesPguffaw disconnect disconnect greetings greetingsscenes cockroaches @cockroaches cockroach @cockroach Vbreastplate :breastplatebrokenbrokenfishing fishermanmediummurakami flagstones flagstones flagstones flagstones flagstones flagstones  flagstones  flagstoneskremnantsremnants specimensgravelgravelgravelcenterfastencottagemarker[figuressheetingsheetingMrubberhimselfHhimselffigurefigurefigure$figure fretboardsingleusingle maplesmaplesmaplespmaplesshijikishijiki_fujukinshijiki-fujukin)examine examine)inspect inspectclothingbriarsbriars{bunrakuzbunraku WspearheadherselfdaimyoHdaimyo=shaggy,shaggycarvingscarvingscarvingsGcarvingscarvingsleopardcarvingkcarvingcarvingshinobushinobushinobushinobushinobushinobushinobushinobuHshinobushinobupurchaseyrepair-sharpenshapes shakuhachiYpillarJpillar=brotherBfrightenshazamtorchesrecess &paintings %paintings $paintings #paintings&painting%painting$painting#paintinghillsidegranitegranitecolorfulcolorfulcolorfulcolorfulcolorfulcolorfulcolorful}trashcan9dewdropsshadowy!platformplatformGshadowshadow figurines figurinesguardsguardsIguards=guards<guardsguardsTdemonswalkingarmoredSarmoredarmoredinsectsshadowsshadowsshadows hcontemplatehollerathollershelvesshelvesMspidernstomachsYtargetJtarget+lavish}rubbish|rubbishtempletempletempletempletemplecovering thunderheadsplaquesfunnel}narrator|narrator Asarcophagus9entrance-entranceplaqueplaqueplaqueplaqueplaquewafershponderunbuckleshiningstallionstallion stallions stallionsridersridersridersshrineshrineshrineshrinesshrineRshrineQshrinesamuraisamuraiLsamuraisamuraisamuraiksamuraigsamurai_samurai\samuraicbloodyopening9opening-openingornate7kerosene6kerosene formation formationrwalletaround inbetween bodyguard bodyguards }musiciansKmusicianmusicianmusicianvmusician}musicianZseveredjewelsjewelsjewelsDjewels1jewels0jewelscloudsclouds$cloudsPweaponOweaponweaponweapontrapdoor'trapdooronamujionamujisneeze walkthru watchtowers watchtower watchtower watchtower watchtower watchtower watchtowercorpses=corpsescorpsecorpsecorpseLcorpse=corpse yasymmetricalkeyholekeyholekeyholekeyhole.guitarguitarguitar~guitarguitar footbridge footbridge footbridge footbridge footbridge footbridge footbridgewoodenwoodendwoodencwoodenZwoodenWwooden&wooden<woodenwooden=woodenwoodenwoodenwoodenwoodenwoodenwoodenYwoodenJwoodenwoodenwoodenwoodenwoodenwoodenwoodenhruminaterattleunlockpearlystandsmattress?mattressplasticplasticmaresukeKplayerplayerplayervplayerevalleyavalley sandstonekimonokimonokimonokimono@kimono&kimono7kimono+kimonokimonocherry cherrytreesuntangledeaddeadhorsemanspearshorsemenhorsemenhorsemen performance performance }performer }performers |performersscrawnyvendorvendor |newspapersttravelerfujukinhremoveremoveservantsscrollsscrollsscrollscrollscrollscrollscrollscrollscrollscrollscrollplatoonkplatoongplatoon_platoon\platoon fspearthrowers dspearthrowersgrayishdogwoodsirisesflowerVflower:flowerflowerflowerflowerflowerflowerflowersflowersflowersflowersflowersflowersflowersswrapper>strange)strangestrangenaturenaturelistentoalisten (extinguishgdownindowninorotate rotate<groundcgroundgroundgroundgroundpatternslettermakumura wastelandthronethroneCthrone glowingglowingglowingglowingglowingglowingglowingglowingbronzebronzebronzebronzebronze(smother northeast northeastnunscrew:unscrewmyselfAmyselftalonstoiletDtoilet@squarepreservepreservepreservetdismount photographundressrestartverboseunfasten|destroydestroythroatspinesspineskwoundedZheadWheadHwizenedblossomsunlightblossomsblossoms sprucepsprucegroovegroovessswitchoffrswitchonpswitchJwrappingwarhorsebaldmassiveforestforestforestforestforestforestvforestuforestforestforestforestforestvioletsvioletvioletjjurojinjurojinjurojin@followtreasuretreasuretreasuretreasuretreasuretreasure`treasuretreasurehorseshorses {ashizukai zashizukaikwarriorsgwarriors_warriors\warriors emountains amountains4amountmountainmountainmountainmountainvmountainumountainmountain~mountain5mountain5mountainmmountainemountainamountainmountainjadejadewarriorwarriorwarriorLwarriorLwarriorHwarrior>warrior)warriorwarriorSwarriorwarriorwarriorunscript zinventoryferryman{silverfootnoteunwindinsertbdownonscriptconsumeconsumecrystalcrystalcrystalvelvetvelvetrsymbolsqsymbolstsymbolsssymbols)symbolsrsymbolqsymboltsymbolssymbolsymbolsymbolsymbolzsymbol!stairsstairsstatuestatue,statuestatuestatuestatuestatuetstatueSstatuestatuewstatuestatuestatuestatuestatuestatuestatuesFtextbooktextbookcypressretinuecane8string7string6string0string/stringspillowpillow{artistszartistsperson&pictures%pictures$pictures#picturesstringedstringed~stringedstringedpicturepicturepicturepicturewindowwindowwindowMwindowAwindow8fourthleafleaf furniture furniture furniture Ffurniture&portrait%portrait$portraitportraitwindowswindowswindowswindowswindowswindowswindowsMwindowsPwindowswindowsleafthruleafthroughversionversion southeast southeastpgrassy!narrow]narrow constructionCrooftopsBrooftopsArooftops=susanowa$susanowasusanowathrough ffootsoldiers `footsoldiers*sister!stairwaystairwayNhidehideahorizon2mirror(mirror$mirror#outline#outlinesbasebasebasebasebasebasebasespiritspiritLspirit>spirit)spiritspiritunplug(caseyellowyellowmfissureskinnystonesstonesstonesstonesstonesstones stonesstones stonesstones |revolting ifukurokuju fukurokuju fukurokujufeelreadYreadEbuttonsEbutton possessionsbagswritingwritingwritingwritingwritingwritingwritingwritingwritingwritingzwritingwriting lake lakelakelakelakelakelakelakelakelakelakelakelakelakelakelakelakelakepageunwrapthornsthorns0lowest {puppeteers zpuppeteerspuppetypuppetxpuppetypuppetsxpuppetsskullsskullsnskullsclanfclan`clanHmatzumumatzumumatzumufmatzumu`matzumu mosquitoeswillows7arch8hangGfootstepmcave>cave9cave-cavevcoalland"landcdoffdoffrestorebarkturtlenwoundsVmouthsharereeddeerfredpeakpeakepeakapeakgategategateryujinryujinswordshswordsdarkdarkdark]dark"darkvcoldslabyslabpalekick northwest northwestmail.biwaKbiwabiwabiwabiwabiwa~biwavbiwabiwaricericericericericericericericeshagboneboneboneGpursuertowers,hairhairsridebitestatusstarry Sinstructions structures structure structure structure .instrument instrument instrument ~instrument instrumentbuckhtaketakectakeofftakeoffpailpailfirefirefirexfirefirefiresfire2fire2firefireEfirezfirezfirefiresandsandsandsandsandsandsandsandsand5sandsandcarpcarpcarpcarpcarpcarpcarpcarpcarproadroadroadgoldgold4gold4goldgoldCgoldFgoldgoldbboatzboatdboatcboatZboatWboatboatboatcoat<coatItroopstroopsabukeQpickchewlgazeintogazeintofillhpickuppickuphazelineroberoberobe@robe7robe+robeblueblueblueblueblue+blue$blueholeholeholeholeholeDholeholeholehole|foodsailscarclayhillhillcoin4coin4coin{coincoin~joke|mixturedhugechugeZhugeWhugehugefuckhelpphelplockselfraindbunecbuneZbuneWbunefivekilogramfiveladycartfishfishfishfishfishfishfishfishfishfishfishfish pilepilepilepilepilepilepilepilepile5pilevpilepilepilepile|pile%plywood:plywoodplywoodulark-honeuntwist southwest southwestfelt{omuzukaizomuzukaisturdyFbookbook~bookflipthruflipthroughgivegiveqflipRmaskNmaskTpair1gems0gems6fuelpineforeinfo}killkilllgodskgodsjgodsigodshgodsggodsfgodsegods=gods4godsdogskitekiterafttalltallpath*pathqpathpathpathpath?path6pathpathqfart&easteasteasteastbodybodyLbodydovedovegirlvgirlparkoakswfudofudokatohartstagstag?rock;rock/rockrockrock rock rockrock&rock#rockrocksavepoke`wearwearribsribsjarsramplongpolepolepolering treetreetreetreetreetree1tree1tree treetreetreetreetreetreetree<tree3treetreetreetreetreetreetreetreetreetreeptreemuckwallwallwallwallwallwallwallwall%wallwall'wall&wall%wall$wallwall:wallwallwallwallwallwall_joinhookryusuisignsign3fret4fret5fret2fret1fretfretbugs pond pondpondpondpondpondpondpondpondpondpondpondpondpondpondrsing+tellWtellvoidrwindtombforklawnwlawnplawnOlawnlawn8lawnlawnsnapNdunkdunkeopen opensilksilksilksilksilkJsilksilksilk7silk+silkgrayBgraygraydirtdirtqdirtOdirtdirt5dirtdirt2full0full.full-full+fullfullfullfullfullfullfull*fullthinthin3wave3wavewavewashhintphintdoordoorCdoorPdoordoordoordoor'doorshipbship^shipdshipcshipZshipWshipEshipship/blowon.blow.blowoutdfrommastDlookupllookoutlookoutllookintolookintollookinsidelookinsidelookbehindlookbehindlookbeneathlookbeneathlookunderlookunder{lookthrulookthru{lookthroughlookthroughywaittlookaroundlookaroundtlooklookllookonlookonllookinlookinadropdrop)lookat lookateyesneyes]ropeYropewroperoof@roofnoteplayplaylplayundoyellat[yellatyell[yellepassapassirisiristrap'trap,burnmovesw movesouthwestmovese movesoutheastmovenw movenorthwestmovene movenortheastmovewmovewestmoveemoveeastmovesmovesouthmovenmovenorthmove moveCironBironironironCiron#ironironAironoshitkplugindowndownkplugplugswanjugsglowglow!glowroserosewoodwood!woodwoodwoodwoodwoodwoodwoodtwoodSwood@wood2moon0moon.moon-moon+moonmoonmoonmoonmoonmoonmoonmoonmoonmoonmoonmoon*moonmoonqburpshoplilynestnestnestnestnestnestnestpool pool poolpoolpoolpoolpoolpoolhmuse1kisshumpgintointoMexitgowncrowcrowbowsviewviewviewviewviewviewviewnprayoverIwith]jumpoffGjumpoff]jumpoverGjumpover]jumpGjumpmistmistmmist\mistXmistroomroomroomroomroomroomroom"moorpullUpullyomi|ruinruinyohodustdustlazyswimbontopushsw pushsouthwestpushse pushsoutheastpushnw pushnorthwestpushne pushnortheastpushwpushwestpushepusheastpushspushsouthpushnpushnorth^push&pushwuglyuglyshowshowshowshowmossbupontypethruquitquit'westwestwestetonstinyAtinytinytinywormFtexttextspotspot~wornpostpostpost{postpostpour_pourmsnowesnowcsnowbsnow7snowsunstosstosssturnoffrturnonoturn turnonyxanhihimeAmeneneatofgoupgodownMgooutgointo^gointogoto^gotogoin^goin gosouthwestgosw gosoutheastgose gonorthwestgonw gonortheastgonegowestgonorthgosouthgoeastinginin^insesebon9toupupnwnwswswbeach"beach`bladeKbladebladeXbladeWbladexblade algae algaealgaealgaealgaealgaealgaealgaealgaealgaealgaealgaealgae<danceblackblackblackblackblackblackblackblackMblack,blackblack,bearduchecktcheckqbelchcedarSYMTAB saycarcdrlength randomizerandsubstrcvtstrcvtnum upper lower caps find getargdatatype setdaemonsetfuse setversionnotifyunnotifyyornremfuse remdaemonincturnquitsaverestorelogginginputsetitaskfilesetscore firstobj!nextobj"isclass#restart $debugTrace%undo&defined'proptype(outhide)runfuses *rundaemons+gettime,getfuse -intersect.inputkey/objwords0addword1delword2getwords3nocaps4skipturn 5clearscreen6firstsc7verbinfo8fopen9fclose:fwrite;fread<fseek=fseekeof>ftell ?outcapture @systemInfo AmorePrompt BparserSetMe CparserGetMe Dg_compass Eg_overlayFg_modeGg_musicHg_pauseIg_effectJg_soundK__reserved_func_0L__reserved_func_2M__reserved_func_3N__reserved_func_4O__reserved_func_5P__reserved_func_6Q__reserved_func_7R__reserved_func_8S__reserved_func_9 not Cif Delse Ewhile Jbreak Kcontinue Qexit Rabort Band Aor Ffunction Greturn Hlocal Iobject Mnil Ntrue Opass Saskdo Taskio XioSynonym YdoSynonym Zexternal [formatstring WcompoundWord specialWords Pclass ]for \do switch case default goto replace modify ^new _deleteself inherited argcountverbnoun adjective prepositionarticlepluraldoAction ioActionsdesc thedesc  ioDefault  doDefault locationvalue roomAction actorActioncontents prepDefaultverActorvalidDovalidIo lookAround roomCheck statusLine locationOK isVisible cantReachisHimisHeraction  validDoList !validIoList#dobjGen"iobjGen$nilPrep%rejectMultiDobj&moveInto 'construct(destruct )validActor*preferredActor +isEquivalent,adesc -multisdesc/anyvalue 0newNumbered2parseUnknownDobj3parseUnknownIobj 4dobjCheck 5iobjCheck dgp_pictureegp_name fgp_defverb ggp_active hgp_hotlistigp_icon jgp_defverb2 kgp_defpreplgp_hotid mgp_overlayngp_hotxogp_hotypfmtYouqfmtYourrfmtYouresfmtYoumtfmtYouveufmtSvfmtEswfmtHavexfmtDoyfmtArezfmtMe checkDoor checkReachitemcntisIndistinguishablesayPrefixCountlistcont  listcontcont  turncount  addweight addbulk incscore darkTravel scoreRank terminate goToSleep initSearch reachableList initRestart_rand {restartingglobal|isopennumObjstrObj }isCarrying~isIn reachableiswornislampislitisListed pluraldesc showcontcont issurface isqsurfacecontentsVisible isqcontainerlistfixedcontcontisfixed scoreStatus turnsofarscoreweightbulk hiddenItem searchLoc searchContunderLoc underCont behindLoc behindCont floatingList floatingItemopenable  visibleList!numbered_cleanup "mainRestore#numberedObjectclean_upnewNumberedPlural num_is_valid$room %nestedroom statusPrep outOfPrep statusRootdispBeginSdesc dispEndSdesc nrmLkAroundroomDrop isdroploc &fixeditem'surface (chairitemischair )inspectVerb*askVerb+tellVerb enterRoomnoexit verDoBoard verDoSitondoBoarddoSitontravelTo verDoLieondoLieon,beditemisbed-thingverGrabGrabisThem itnomdesc itobjdescitisdescdoesdescisdescisntdescldescreaddesccontentsReachable verDoSave verDoRestore verDoScriptverDoSay verDoPush verDoWear verDoTake verifyRemoveisactor .movableActor isopenable isReachabledoTake maxweightmaxbulk verDoDropdoDrop verDoUnwear verIoPutIncircularMessage verDoPutIndoPutIn verIoPutOn verDoPutOndoPutOn verIoTakeOut ioTakeOut doTakeOut verDoTakeOut verIoTakeOff ioTakeOff doTakeOff verDoTakeOff verIoPlugIn verDoPlugInverIoUnplugFromverDoUnplugFrom verDoLookinthrudesc verDoLookthruverDoLookunder verDoInspect doInspect verDoReadverDoLookbehind verDoTurn verDoTurnWith verDoTurnTo verIoTurnTo verDoTurnon verDoTurnoff verIoAskAbout ioAskAbout doAskAbout verDoAskAboutverIoTellAbout ioTellAbout doTellAboutverDoTellAbout verDoUnboard doUnboard fastenitem leaveRoomverDoAttackWithverIoAttackWithverDoEat verDoDrink verDoGiveTodoGiveTo verDoPull verDoThrowAt doThrowAt verIoThrowAt ioThrowAt verDoThrowTo doThrowTo verDoThrowdoThrow verDoShowTodoShowTo verIoShowTo verDoCleanverDoCleanWith  doCleanWith  verDoMove  verDoMoveTo  verIoMoveTo  verDoMoveWith verIoMoveWith verDoTypeOn verDoTouch verDoPoke verDoBreakdoBreak genMoveDir verDoMoveN verDoMoveS verDoMoveE verDoMoveW verDoMoveNE verDoMoveNW verDoMoveSE verDoMoveSW verDoSearch0item 1lightsourcedoTurnonisActive2hider  searchObj !serialSearch"autoTake 3underHider #doLookunder 4behindHider $doLookbehind 5searchHider%doSearch&doLookin6readable'doRead7fooditem(doEat )lastMealTime *foodvalue+eatTime8dialItem ,minsetting -maxsetting.setting/doTurn9toPrep0doTurnTo :switchItem 1verDoSwitch2doSwitch 3doTurnoff4isseen5verbose 6firstseen 7leaveList 8addLeaveList9leaving :dispParagraph;dispBeginLdesc <dispEndLdesc=heredesc >actorDesc?north@southAeastBwestCupDdownEneFnwGseHswIinJout;darkroomKlightsOnLlamplist MisDarkVerb<theFloorNsitlocOioPutOnPioPutIn=Actor >qcontainer QverDoFollow RmyfollowerSaskWordTdisavow UverIoGiveToVioGiveTo WsayLeaving XsayArriving?followerYmyactor Zisfollower[doFollow @followVerbAbasicMe \isobstacle ]destination Bdecoration CdistantItem Ebuttonitem FclothingItem ^checkDrop_doWear`doUnwearGobstacleHdoorwayaisdoorbdoordestcislocked dnoAutoOpen eotherside fverDoOpen gsetIsopenhdoOpen iverDoClosejdoClose kverDoLock lislockablemdoLocknmykeyIwithPrep overDoUnlockpdoUnlock qverDoLockWith rdoLockWithsverDoUnlockWith tdoUnlockWithJlockableDoorwayKvehicle uisvehicle vverDoEnterwdoEnter LgetOutVerbMoutVerbNputVerbOqsurface Pcontainer xiscontainerQtransparentItemRlockable SkeyedLockableUkeyItemyverIoUnlockWith zioUnlockWith {verIoLockWith |ioLockWith VseethruItem }doLookthru WbasicNumObj~doTypeOnioTurnTo XbasicStrObj verDoEnterOn doEnterOn verDoEnterIn doEnterInverDoEnterWith doEnterWithsaveGamedoSave restoreGame doRestorestartScriptingdoScriptdoSayYdeepverbZdarkVerb [aboutPrep\digVerb verIoDigWith ioDigWith verDoDigWith doDigWith]jumpVerb verDoJumpdoJump^pushVerbdoPush _attachVerb verIoAttachTo ioAttachTo verDoAttachTo doAttachTo`wearVerbadropVerbbonPrep cremoveVerbdfromPrepverIoRemoveFrom ioRemoveFromverDoRemoveFrom doRemoveFromeopenVerb fcloseVerbginPrephtakeVerbioffPrepjoutPrep notakeallkplugVerbioPlugIndoPlugIn llookInVerb mscrewVerbverIoScrewWith ioScrewWithverDoScrewWith doScrewWith verDoScrewdoScrew nunscrewVerbverIoUnscrewWith ioUnscrewWithverDoUnscrewWith doUnscrewWith verDoUnscrew doUnscrewoturnVerb verIoTurnWith ioTurnWith doTurnWith pswitchVerbqflipVerb verDoFlipdoFlip rturnOnVerb sturnOffVerbtlookVerbusitVerbvlieVerb wboardVerb xagainVerbywaitVerbziVerb {lookThruVerb |breakVerb }attackVerb ioAttackWith doAttackWith ~climbVerb verDoClimbdoClimbeatVerb drinkVerbdoDrinkgiveVerbpullVerbdoPullreadVerb throwVerbatPrep verIoThrowTo ioThrowTo standOnVerb verDoStandon doStandon standVerb outhideStatus helloVerbshowVerbioShowTo cleanVerbverIoCleanWith ioCleanWithdoCleansayVerbyellVerbmoveVerb ioMoveWith doMoveWithioMoveTodoMoveTodoMove fastenVerb verDoFastendoFasten unfastenVerb verDoUnfasten doUnfasten unplugVerb ioUnplugFrom doUnplugFrom verDoUnplugdoUnplug lookUnderVerblookBehindVerbtypeVerb verIoTypeOnioTypeOnlockVerb unlockVerb detachVerbverIoDetachFrom ioDetachFromverDoDetachFrom doDetachFrom verDoDetachdoDetach sleepVerb cantSleep awakeTime sleepTimepokeVerbdoPoke touchVerbdoTouch moveNVerbdoMoveN moveSVerbdoMoveS moveEVerbdoMoveE moveWVerbdoMoveW moveNEVerbdoMoveNE moveNWVerbdoMoveNW moveSEVerbdoMoveSE moveSWVerbdoMoveSW centerVerb verDoCenterdoCenter searchVerb travelVerb isTravelVerbeVerb travelDirsVerbnVerbwVerbneVerbnwVerbseVerbswVerbinVerb verIoEnterOn ioEnterOn verIoEnterIn ioEnterInverIoEnterWith ioEnterWithdVerbuVerbsysverb issysverbquitVerbquitGame verboseVerb verboseMode terseVerb terseMode scoreVerb showScoresaveVerb restoreVerb scriptVerb unscriptVerb stopScripting restartVerb restartGameinitRestartParam versionVerb showVersionversion debugVerb enterDebuggerundoVerbundoMovePrepofPrep betweenPrepoverPrep aroundPrepthruPrepdirPrep underPrep behindPreparticlesdieinitpardon sleepDaemon eatDaemon commonInit initRestoremaxscore startroompreinitMeintro inPrep@214 eatVerb@215 xyzzyVerb helloVerb@218 frotzVerb verDoFrotzdoFrotz lagachVerb thing@221helpVerbhelptextinfoinfoVerbinfotext takeVerb@225 quitVerb@226 sneezeVerbmeadowpourVerb verDoPourdoPour verIoPourOnioPourOn verDoPourOndoPourOn thing@230 emptyVerb verDoEmptydoEmpty flipThruVerb verDoFlipThru doFlipThru throwVerb@233verIoThrowThru ioThrowThruverDoThrowThru doThrowThru thing@234 fixeditem@235 breakableattackVerb@237  verDoAttack doAttack thing@238outcave2caveoutcave1 samurai bgio wetgio acceptVerbfillVerb verDoFilldoFill verIoFillWith ioFillWith verDoFillWith doFillWith container@244kickVerb verDoKickdoKick thing@246 throneroom untwistVerb verDoUntwist doUntwist insertVerb putVerb@250lookInVerb@251lookBehindVerb@252lookUnderVerb@253 plugVerb@254 wearVerb@255removeVerb@256 undressVerb verDoUndress doUndress dressVerb verDoDressdoDress unwrapVerb verDoUnwrapdoUnwrapattachVerb@260 verDoAttachdoAttachdetachVerb@261 breakVerb@262lookInVerb@263 inspectVerb@265  turnVerb@266  openVerb@267 searchVerb@268  moveVerb@269removeVerb@270  allMessage parseError knockOnVerb !verDoKnockOn "doKnockOn thing@273movableActor@274swimVerb #verDoSwim$doSwimchewVerb %verDoChew&doChew thing@277 shootVerb 'verDoShoot(doShootdistantItem@279cameradecoration@281 thing@282 vaultVerb )verDoVault*doVaultstick thing@285fuckVerb +verDoFuck,doFuck shakeVerb -verDoShake.doShake  thing@288 !launchVerb /verDoLaunch0doLaunch"landVerb 1verDoLand2doLand #cleanVerb@291 $takeVerb@292 3verIoTakeWith 4ioTakeWith 5verDoTakeWith 6doTakeWith %openVerb@293 7verIoOpenWith 8ioOpenWith 9verDoOpenWith :doOpenWith &pushVerb@294 ;verIoPushWith <ioPushWith =verDoPushWith >doPushWith 'moveVerb@295(extinguishVerb?verIoExtinguishWith@ioExtinguishWithAverDoExtinguishWithBdoExtinguishWith )stickVerb CverDoStickDdoStick EverIoStickTo FioStickTo GverDoStickTo HdoStickTo *thing@298+wad ,lightVerbIverIoLightWith JioLightWithKverDoLightWith LdoLightWith -sharpenVerbMverIoSharpenWith NioSharpenWithOverDoSharpenWith PdoSharpenWithQverIoSharpenIn RioSharpenInSverDoSharpenIn TdoSharpenIn .blowOutVerb UverDoBlowOut VdoBlowOut /blowOnVerb WverDoBlowOnXdoBlowOn0flyVerbYverDoFlyZdoFly1kissVerb [verDoKiss\doKiss 2thing@306 3thing@307 4waterpile5sandpile6kero7can8hangVerb ]verDoHang^doHang _verIoHangOn`ioHangOn averDoHangOnbdoHangOn 9screwVerb@313:unscrewVerb@314 ;thing@315 <danceVerb cverDoDanceddoDance=susanowa ehasDanced>uzume?intomb @courtyard AmoveAllCont BscareVerb fverDoScaregdoScare Cthing@323 DlookUpVerb hverDoLookUpidoLookUp Ething@325Ftextbook GjumpVerb@327Htreetop3Itreetop2Jtreetop1Ktrees LfootbridgeMwwallNewallOplatform PlaughVerbQpickVerb jverDoPickkdoPick RcloseVerb@338 StouchVerb@339 TpushVerb@340 UpullVerb@341 VdrinkVerb@342 WtellVerb@343 XaskVerb@344 YreadVerb@345 ZsleepVerb@346lprisoner [yellVerb@347\battle mverDoYellAtndoYellAt ]climbVerb@349 ^inVerb@350 _pourVerb@351 alistenVerb bvisionstage cbackstagedpondwestetemple2 fmedtemple2goldtop hmeditateVerb ithing@361 jthing@362 overDoCarvepdoCarvekknifelplayVerb qverDoPlayrdoPlay mcarveVerbsverIoCarveWith tioCarveWithuverDoCarveWith vdoCarveWithnprayVerboshitVerb phelpVerb@368qfartVerbrsingVerbsrideVerb wverDoRidexdoRide tdismountVerb yverDoDismount zdoDismountularkVerb {verDoLark|doLark vthing@374}isReadwdiagramxkatanayfixVerb~verDoFixdoFix zthing@378{cutVerbverDoCutdoCut |thing@380 }untieVerb verDoUntiedoUntie~tieVerbverDoTiedoTie verIoTieToioTieTo verDoTieTodoTieTo thing@383 pluckVerb verDoPluckdoPluckaftVerb ghostshipdeckforeVerbwaveVerb verDoWavedoWave verIoWaveAtioWaveAt verDoWaveAtdoWaveAt thing@390buyVerbverDoBuydoBuyversionVerb@392 theFloor@393 container@395 readable@396 rooms_visitedindoorsroom@398 check_no_allno_all deepverb@400 dropVerb@401 putVerb@402 takeVerb@403 giveVerb@404 showVerb@405 thing@406 game_overwizardmakeNote thing@409 thing@410 thing@411 fixedfloaterllistdecoration@413isplural not_importantmovableActor@414 smellVerb smelldesc verDoSmelldoSmell listenverb listendesc listentoverb verDoListenTo doListenTo touchVerb@419 thing@420 touchdescroom@421 Actor@422 intangibletakedescinspectVerb@424sightlookBehindVerb@425lookInVerb@426lookThruVerb@427lookUnderVerb@428 lookVerb@429 readVerb@430fnStatehighestbadTriestextfootnote verDoFootnote doFootnotebasicNumObj@434entrydfudodryujindonamuji damaterasudfujindtakarashijikibentenbishamondaikokuebisufukurohoteijurojindsusanoduzumeonichowayomiuberlocisUberinsidedeepcont deeplistcontroom@461nightshipgateeastlawnstagegranary medtemple courtpathisPluralplywall courtpalacepool poolwaternestnewkiteisWet verIoThrowIn ioThrowInpursepic malletpichatpicricepicpurseinshipmallethatricebagghostmoon1moon2moon3moon4moon5gardenmoon8ps26ps27ps28ps29ps30ps31 poolalgaetempleggardenweeds pwallwestvinesswtowerbigwallw0w1w2w3stower1w4stower2w5setowerw6w7stonest0 st1 st2 st3 st4 st5st6towertview verDoLookout doLookout verDoClimbout doClimboutverDoClimbthru doClimbthruv1v2v3v4v5t1t2t3t4battb1b2ebigwallgroovesestone passage!ingrain"tunnel#boulder3$darktunnmoved%cavern&boulder4visiblereach'trap verDoDowndoDown actorDaemondead (shrineroom )fakeghost*moon+moon6,pools-moon7.moon9 /northlawn0moon10 1outlibrary2moon113ponds4ladder 5newthrone6lawnpath7torii8pgrass9dew:plywall2;librarydone<coat=rat>ghost2?libpath@outlibAdpalaceBd1Cd2Dkoipond EshadypathFpinepathseenHshinjukuIpskyJps1Kps2Lps3Mps4Nps5Ops6Pps7Qps8Rpond1Sps9Tpond2Ups10Vpond3Wps11XcampsiteYps12Zps13[glade\ps14]ps15 ^gardenwest_ps16`stepsaps17bps18cps19dps20enwgardenfps21gnegardenhps22isegardenjps23kswgardenlps24mislandnps25otombpenttreesqgumrwalletswrappertchecksucheck isBurningburnFusevcoalswfudoxfire4yslab zfireglyphchanged{coin|garbage}trashcan isSearched~jokebookpostisSeencrowdpalacepalace1palace2palace3palace4palace5palace6pondroadgraveldbridgekoikoi1koi2koi3koi4koi5koi6 lotusblossoms shadepath pathstonescherry_blossoms pathtreespmeadpineneedlesvendorflowerscart cartbiscuitspacketbiscuitkimonopines2demonporchdeergmeadwoodsfencebucktookpage textbook1rafttoPondwemead pondtreesbigpondbucketbrokebigpond1bigpond2bigpond3bigpond4farcoin2bigpond5bigpond6birds pondshorepondRoom verDoSitindoSitintoLandreedsinsects pondreedsstuckwadfarcoin underbridgefish campshorepitrocksashesringkey campwoodstmead grovetreesoakoak1 branchesdecoak2carvingportrait hairflower biwacarving fretcarvingkitetreeviewoak3branchesverDoHitdoHitwallsftstepsbridge bridgepond stepbridgestatuessteps1fargatehillsidegrasswarriorlivewaropengatedoor gatesteps gatetowerssignaxekeyholekeydarkkeydustunlockedliveaxeisAliverubbleisDullisDirtysunFuse palacedoorisStucksandfireemberalgaesand1sand2sand3sand4sand5sand6fire1fujinairglyphember1tombdoorfire2ryujinember2 waterglyphfire3onamujiember3moveinto earthglyph ember4 rgarden wisland  flagstones flag1flag2flag3flag4flag5flag6flag7 farbuildingisland1 fujintext ryujintextfudotext dirtysand onamujitextgoFuse tombbuildingtoisland isGlowingcarving1dust kaneiji !tombstairs"darkness#outlines $northwall %southwall&eastwall'westwall(mirror)godRoom*uzume1+sukimono,subeard-thecave.light/boulder0jewels 1fakejewels 2fakemirror3maple4gods5sky6nowhere7uzkimono8sky29thecave2:light2;boulder2<maple2=gods2>incave?caverock@akimonoAcoffinisOpen verDoLiftdoLiftisTakenCthrone captureFuse Dthronejewels Ethroneflames Ffurniture Gthronecarving verDoSitOndoSitOnIaltarJdummyKgio3Lghost3MspiderOsamlawn PbuildingsQshrineRshrine2 Sbishemon1Tdemons UparchmentVmouthWspear XbloodswordYdummy1Zhead[soldiersyelled\platoon]gap^gaproom_fakemen`enemy amountainsbledgescsnowverDoDigdoDigdarcherseavfavstuffgfakemen2hweaponsimeigi jsnowfieldmFusekwoundedlmeigi2m2Fuse msnowstuffnwounds pstagelawn qstagepathrstage1sshrine1thotei1ubagvfargio wvisionlawn xfarpuppetsypuppets zfarpuppeteers {puppeteers |performers }farperformers~farbiwagioorchidmeadow2nearbiwafarshowshowcrowd2 medgardenmeadwallflowers2flowertyperosetulipdaisyhyacinthvioletlilyirishibiscus carnation medtemple1temple1thinkmnintemple verDoExitdoExitshrine3jurojin1sound intemple2 courtyard2 outtemple2maze fluteFuse mazetrees oldpalace courtdirtblownfluteoldtreeoldoak carveFuseplayingshapeoldoak2gio2oldbiwa gbuildings gbuildingtrapdoorjar5jar3fshrine4daikoku1openinghole ricefieldtalkFusemeigi3ambswordjarswsandwpileriders2wroadwsunriceriders talk2Fuse talk3Fuse talk4Fuse talk5Fuse talk6Fuse talk7Fusewmenwarmor ricebattle stallions bodyguards battlepaddy fakeleader fakehorsesleader leaderhorse ricearmorriceaxemyhorse verDoMountravencrowowldoveswanrnestonestynestgnestbnestsiegetorchshrine5fukuro1katomuraryusuibashotakehmaretsujishelvesscrolls figurinesgingkogwritinggleavestnestnestsshelfclouds burnshelves burnscrollsfiretreefightgleaves2 siegefire siegesmoke invisiblejoefMeigi talkFuse1fakedoveruinspoolawnpoolsign pooltreesyfishspooleatFusebfishofishbigpooldeadfishwormpools2shrine6ebisu1linehookshorepole  pondgrasscrying talk1Fuse pontrees ponds2 bpond spondshadows isClimbed scaffoldingplasticplastic2sedantablthronfurnfurn2pillowpillow2pushed thronjewels throncarvingcrackstrap2distplatcement cement2!plat"bcrack #scaffolding2%wreckage&mkey'shiproom(scase )sparchment *courtpath2+tatami ,shrinestatwallFuse-billy .shrinebiwaplayed/stringz0string1plucked pluckFusepressed1treefret2firefretsing 3waterfret4goldfret 5earthfret6string27string3singFuse8string4 sing4Fuse9cellholdFuse sing2Fuse sing3Fuse :ghostorchid2<guards=bodies>hall ryukoFuse?cellmatt@roach AcellwindowBcellskyCcelldoorDcellholeEtinyship swordFuseFpackage guardFuse guardFuse2 guardFuse3 guardFuse4 battleFuseGryuko1Hryuko2  deathFuse  deathFuse2  deathFuse3IrytroopJwrapping Kcellsword  verDoWrap doWrapLrycorpseMhallwinblindhitNrystuffOryaxePryaxe2Qrystuff2RrymaskAttackedSinstVerb VghostorchidWendshipXfogYshipropeZgship[figures\shipfog ]skiffladder^origami _altarroom`katana2 askiffroom launchFusebnewskiffcgship1dgship2eluckgodfebisugodgdaikgodhhoteigodifukugodjjurogodkbishgodlbentgodmshipfog2nshipskyoshipsky2pwheelsteeredtouched qwaterrunerwindrunesfirerune tearthrune islandFuse island2Fuse ubigisland vbigisland2wsislandxisland2 yfakewheelzskiff{post2|splain}splain2~mountmount2seasea2mastsail calligraphycharontreasuretakenpilot2landFuse skiffislandpilot skiffshorecoinpile rockshorewalkFuse darkmountskiffskyskiffseaoaroar2 torchfiretcoattrattbagtkeytmalletthattpurse verDoRemovedoRemovealteredmorphed darkwoods purseroomfullricepilebirdroomfakebag croweFuse birdmountcrowsdacrows purselight eastbeach trollbridgemarkershforestbskybs1bs2bs3bs4 darkforestbs5 mazeforestbs6boneseabones bonemountaindied deadFusecairncryskull woodskullwcairndie2 shforest2riverbonesea2bones2 cryskull2bonegaptroll trolltreesriver2ftbridge deadtrollfangs !ghostFuse darktrees2 darktrees "walk2Fuse ftbridge2cairngap #demonFuse$foundtorchidloopbirchesmazemistbriarsbriars2 birdroom2%l altcarvingsmaltar&takeFuseendroom'wakeFuse giocorpsebloodskyforms wasteland(tellFuse )tell2Fuse *tell3Fuse+winFuseheaven ,finalFuse skybridge corpsechainironpost steelpostcollardeceit-makaFusecottagebetrayal.shinFuse endthroneletter bronzepost cowardiceckimonoghost4makumuradskydtrees wetkimonoshinobubkimono /verDoBurn0doBurnservants1chatFuse 2chat2Fusetorchesbstuffbdoor daimclothesccellhallwinscship3takedchall 4fightFuse ccellmatt ccellwindowccellsky ccelldoor ccellholedeadguy 5fight2Fuse endguards 6fight3Fusecbodiescroach challwinsghost5winroom7cheatvoidstarsandstarmistendsun winpalaceendpondendroad endtrees  walkthruVerb Me@12928isHurt9testFuse :verDoBlow;hurtFuseSRCx  walkthru.t 8     A # h' , 0 4 < YD rJ N T Y:ClassNameUnicode To ISO-8859-1 Converter:9  9 9InprocServerrel:uconv.shlb?:#: :0:9ComponentTypeapplication/x-mozilla-native:_:?:m:9ContractID@mozilla.org/intl/unicode/encoder;1?charset=ISO-8859-1:: :7:79@mozilla.org/intl/unicode/encoder;1?charset=ISO-8859-1C; ;7>;ZClassID{920307b0-c6e8-11d2-8aa8-00600811a836};c;'k;'C;{920307b0-c6e8-11d2-8aa8-00600811a836};;'>?<f0sourceUnicode<;<;destinationISO-8859-1?<(< < 4< ;{7b8556ac-ec79-11d2-8aac-00600811a836}<_<'[?=ClassNameUnicode To windows-1252 Converter<< "<"<InprocServerrel:uconv.shlb=< <<<ComponentTypeapplication/x-mozilla-nativeY=.==<=<ContractID@mozilla.org/intl/unicode/encoder;1?charset=windows-1252=y= Y=9=9<@mozilla.org/intl/unicode/encoder;1?charset=windows-1252>=9@e>ZClassID{7b8556ac-ec79-11d2-8aac-00600811a836}e>6>'>>'>{7b8556ac-ec79-11d2-8aac-00600811a836}>>'~A?f0sourceUnicode>>>>destinationwindows-1252?> > ? >{7b8556af-ec79-11d2-8aac-00600811a836}[?4?',B@ClassNameUnicode To x-mac-roman Converter?{? !?![?InprocServerrel:uconv.shlb?? ??[?ComponentTypeapplication/x-mozilla-native-@@?@[?ContractID@mozilla.org/intl/unicode/encoder;1?charset=x-mac-roman@M@ -@8X@8[?@mozilla.org/intl/unicode/encoder;1?charset=x-mac-roman@@8C7A5ContractID@mozilla.org/intl/unicode/decoder;1?charset=ISO-8859-3f$ 7/75@mozilla.org/intl/unicode/decoder;1?charset=ISO-8859-37 ZClassID{660d8ca0-f763-11d2-8aad-00600811a836} ''{660d8ca0-f763-11d2-8aad-00600811a836}S,'f0sourceISO-8859-3s z SdestinationUnicode S{660d8ca1-f763-11d2-8aad-00600811a836}'1ClassNameUnicode Decoder-ISO-8859-4E  *InprocServerrel:ucvlatin.shlbe ErComponentTypeapplication/x-mozilla-nativeContractID@mozilla.org/intl/unicode/decoder;1?charset=ISO-8859-41 77@mozilla.org/intl/unicode/decoder;1?charset=ISO-8859-4Q7SZClassID{660d8ca1-f763-11d2-8aad-00600811a836}''{660d8ca1-f763-11d2-8aad-00600811a836}'f0sourceISO-8859-4P> E destinationUnicodep P|{660d8ca2-f763-11d2-8aad-00600811a836}'ClassNameUnicode Decoder-ISO-8859-5 InprocServerrel:ucvlatin.shlbO0 =ComponentTypeapplication/x-mozilla-nativeoO}ContractID@mozilla.org/intl/unicode/decoder;1?charset=ISO-8859-5 77@mozilla.org/intl/unicode/decoder;1?charset=ISO-8859-5S7ZClassID{660d8ca2-f763-11d2-8aad-00600811a836}s'{'S{660d8ca2-f763-11d2-8aad-00600811a836}'Of0sourceISO-8859-5   destinationUnicodeO; G{660d8ca3-f763-11d2-8aad-00600811a836}o'aClassNameUnicode Decoder-ISO-8859-6 InprocServerrel:ucvlatin.shlb ComponentTypeapplication/x-mozilla-nativee:HContractI endgame.txA3N}xA*+m WyD:m-w[[ 4R R0o1m;-w*#lXli. _7JX/`_s:eq7v}'IISiGQ|FWP=t;Rr)SO ?h9Q AJ~1O S>g8:M,LNr   E  D<` S~.u #h  $'V2 W 6b7r<u~ 1<lk}* 0{2yt`4EnQtXn#G2]p{   6  50ddf15ef07}K$'RpClassNameThe Finger Protocol Handlerk uKInprocServerrel:Necko2.shlb΍ KComponentTypeapplication/x-mozilla-native΍KContractID@mozilla.org/network/protocol;1?name=fingerp9 ,D,K@mozilla.org/network/protocol;1?name=finger,ɐ ZClassID{76d6d5d8-1dd2-11b2-b361-850ddf15ef07} ܎''{aa27d2a0-b71b-11d3-a1a0-0050041caf44}R+'_{ClassNameThe DateTime Protocol Handlerr |RInprocServerrel:Necko2.shlb׏ ǏRComponentTypeapplication/x-mozilla-native"׏RContractID@mozilla.org/network/protocol;1?name=datetime{B ".M.R@mozilla.org/network/protocol;1?name=datetimeɐ.ޒZClassID{aa27d2a0-b71b-11d3-a1a0-0050041caf44}''ɐ{9c7ec5d1-23f9-11d5-aea8-8fcc0793e97f}_8'ޓClassNameThe ViewSource Protocol Handler   _InprocServerrel:Necko2.shlbɑ ֑_ComponentTypeapplication/x-mozilla-native1_ContractID@mozilla.org/network/protocol;1?name=view-sourceQ 11\1_@mozilla.org/network/protocol;1?name=view-sourceޒ1O-ZClassID{9c7ec5d1-23f9-11d5-aea8-8fcc0793e97f}-''ޒLastModTimeStamp~PfM^ҊFileSize闓 fҊ{0a6ae8e6-f550-11d3-a563-0060b0fc04b7}ޓ'ClassName4xAB Upgrader ޓInprocServerrel:nsAB4xUpgrader.shlb[6 CޓComponentTypeapplication/x-mozilla-native{[ޓContractID@mozilla.org/addressbook/services/4xUpgrader;1Ɣ /є/ޓ@mozilla.org/addressbook/services/4xUpgrader;1O /ZClassID{0a6ae8e6-f550-11d3-a563-0060b0fc04b7}o'w'Orel:nsAB4xUpgrader.shlb֕t/ComponentsCount ֕LastModTimeStamp~tC* ;֕FileSizedtc Cl֕{c8e518c1-47ae-11d3-91cd-00105aa3f7dc}'ؗClassNamensLocaleService componentۖ \ship.tLVLxLLLLLLLLL%L1L:LLLLLL$L^LjLwLLLLLLLLLLLHLLLLLLLLL L9LeLxLLyLLL\ L L L0 LY ','C'*W{WWW7WW2WVWHWsWWaW4WGWW+WWWRW YYY'ZZZkZZZ(ZLZ9,5 .:8 6e(eLeeoen&n<n|o&o<o|pppp<pkpp#pppp pp\papppp3yysbsssNsssbsssstdttttt\trttqdqqqIqq q-qMrbrrrzzzz]]]m]^^^^4^X(L`3Wa/avaaaaaOaeabwbbbF)Fr4Ei*r(SfA_+lBfzA-Q1b(h7j oAnLp[o 5H)G*> C g $PjIsge35G```^^^ContractID@mozilla.org/autocompleteSession;1?type=addrbookU__ ^1$_1^@mozilla.org/autocompleteSession;1?type=addrbook_u_1a_ZClassID{138de9bd-362b-11d3-988e-001083010e9b}__'_'_{fe04c8e6-501e-11d3-a527-0060b0fc04b7}<``']braClassNameAddress Book Address Collector`\` f`<`InprocServerrel:MsgAddrbook.shlb`` ``<`ComponentTypeapplication/x-mozilla-nativea```<`ContractID@mozilla.org/addressbook/services/addressCollecter;1ra2a a5=a5<`@mozilla.org/addressbook/services/addressCollecter;1aa5cbZClassID{fe04c8e6-501e-11d3-a527-0060b0fc04b7}ba'a'a{ff04c8e6-501e-11d3-a527-0060b0fc0444}]b6b'mdcClassNameThe addbook URL Interfaceb}b b]bInprocServerrel:MsgAddrbook.shlbbb bb]bComponentTypeapplication/x-mozilla-native.ccbc]bContractID@mozilla.org/addressbook/services/addbookurl;1cNc .c/Yc/]b@mozilla.org/addressbook/services/addbookurl;1cc/e&dZClassID{ff04c8e6-501e-11d3-a527-0060b0fc0444}&dc'c'c{ff04c8e6-501e-11d3-ffcc-0060b0fc0444}mdFd'|feClassNameThe addbook Protocol Handlerdd dmdInprocServerrel:MsgAddrbook.shlbdd ddmdComponentTypeapplication/x-mozilla-nativeAeed$emdContractID@mozilla.org/network/protocol;1?name=addbookeae Ae-le-md@mozilla.org/network/protocol;1?name=addbookee-h5fZClassID{ff04c8e6-501e-11d3-ffcc-0060b0fc0444}5ff'f'e{f8b212f2-742b-4a48-b7a0-4c44d4ddb121}|fUf'hgClassNameThe directory factory service interfaceff (f(|fInprocServerrel:MsgAddrbook.shlbgf ff|fComponentTypeapplication/x-mozilla-native[g0gg>g|fContractID@mozilla.org/addressbook/directory-factory-service;1g{g [g5g5|f@mozilla.org/addressbook/directory-factory-service;1hg5Vj_hZClassID{f8b212f2-742b-4a48-b7a0-4c44d4ddb121}_h0h'8h'h{e1cb9c8a-722d-43e4-9d7b-7ccae4b0338a}hh'jiClassNameThe MDB directory factory interfacehh $h$hInprocServerrel:MsgAddrbook.shlb6ii h!ihComponentTypeapplication/x-mozilla-nativeiVi6idinst.tS(SySSSSSS'S;SV S]SSSO$So+S0S<Q<<M<v<>>>D>> >a>GeGG^GGH6HHHHHHHHHHHIHHHHHHH}HH LlLPPQmQRRI=III[III7ICIIIbIII i(3i(>h@mozilla.org/embedcomp/window-watcher;1i{i(kiZClassID{a21bfa01-f349-4394-a84c-8de5cf0737d0}ii'i'i{57cf9383-3405-11d5-be5b-aa20fa2cf37c}9jj'lBkClassNameFindhjYj cj9jInprocServerrel:EmbedComponents.shlbjj hjj9jComponentTypeapplication/x-mozilla-nativejjjj9jContractID@mozilla.org/embedcomp/find;1Bkk j$k9j@mozilla.org/embedcomp/find;1kbkmkZClassID{57cf9383-3405-11d5-be5b-aa20fa2cf37c}kk'k'k{1f59b001-02c9-11d5-ae76-cc92f7db9e03}lk'n=mClassNameAppStartup NotifierTl6l @llInprocServerrel:EmbedComponents.shlbltl TlllComponentTypeapplication/x-mozilla-nativelllllContractID@mozilla.org/embedcomp/appstartup-notifier;1=mm l-m-l@mozilla.org/embedcomp/appstartup-notifier;1m]m-omZClassID{1f59b001-02c9-11d5-ae76-cc92f7db9e03}mm'm'mLastModTimeStamp~v`nmc ncFileSizeDCn2n n;nc{4aa267a0-f81d-11d2-8067-00600811a9c3}ncn'poClassNameMozilla Find Componentnn nnInprocServerrel:FindComponent.shlbon nnnComponentTypeapplication/x-mozilla-nativeZo/oo=onContractID@mozilla.org/appshell/component/find;1ozo Zo'o'n@mozilla.org/appshell/component/find;1oo'GrBpZClassID{4aa267a0-f81d-11d2-8067-00600811a9c3}Bpp'p'orel:FindComponent.shlbypbpus/ComponentsCountpppyp{5060b803-340e-11d5-be5b-b3e063ec6a3c}pp'GsClassNameicon decoder   InprocServerrel:icondecoder.shlb]; HComponentTypeapplication/x-mozilla-native}]ContractID@mozilla.org/image/decoder;2?type=image/iconȁ -Ӂ-@mozilla.org/image/decoder;2?type=image/iconM -ZClassID{ffc08380-256c-11d5-9905-001083010e9b}m'u'Mrel:icondecoder.shlbтy/ComponentsCountт{d0f9db12-249c-11d5-9905-001083010e9b}L%'rClassNameIcon Protocol Handlerl vLInprocServerrel:icondecoder.shlb΃ LComponentTypeapplication/x-mozilla-native΃LContractID@mozilla.org/network/protocol;1?name=moz-iconr9 .D.L@mozilla.org/network/protocol;1?name=moz-icon.)ZClassID{d0f9db12-249c-11d5-9905-001083010e9b}''LastModTimeStamp~NPH/@тFileSize_)yh Hqт{5871a422-1dd2-11b2-ab3f-e2e56be5da9c}'܆ClassNameppm decoder   InprocServerrel:jpegdecoder2.shlb9 #ComponentTypeapplication/x-mozilla-nativeY9gContractID@mozilla.org/image/decoder;2?type=image/jpeg܆ --@mozilla.org/image/decoder;2?type=image/jpeg)-މxZClassID{5871a422shrine.t()(((f(((0((b(((((((T(4(U(i((/(((1(U)()B)f)w)+++=+++++1+n+++,),--1-L-q.'.u..0g00000^00!0a06o6666"6a66617o7777!7`7777778i88888[888c838V8u811111#22222$55555+4}4444!33333))))7)M)t))&)))$)))>)g>9>]>9>O>v>>(>>> >>>>C>>>5>ew;1?type=text/javascript; x-view-type=view-sourceg )``0@mozilla.org/content-viewer-factory/view-source;1?type=text/javascript; x-view-type=view-sourcee@mozilla.org/content-viewer-factory/view;1?type=application/x-javascript; x-view-type=view-sourceK  b  ZClassID{fc886801-e768-11d4-9885-00c04fa0cf4b} k 's 'K application/x-javascript; x-view-type=view-source@mozilla.org/content-viewer-factory/view;1?type=application/x-javascript; x-view-type=view-sourceN  2g i&i0@mozilla.org/content-viewer-factory/view-source;1?type=text/html n A  ZClassID{fc886801-e768-11d4-9885-00c04fa0cf4b}  ' ' @mozilla.org/content-viewer-factory/view-source;1?type=text/html@mozilla.org/content-viewer-factory/view-source;1?type=text/plain _ B  ZClassID{fc886801-e768-11d4-9885-00c04fa0cf4b}  ' ' @mozilla.org/content-viewer-factory/view-source;1?type=text/plain@mozilla.org/content-viewer-factory/view-source;1?type=text/css R @ ZClassID{fc886801-e768-11d4-9885-00c04fa0cf4b}  ' ' @mozilla.org/content-viewer-factory/view-source;1?type=text/css@mozilla.org/content-viewer-factory/view-source;1?type=text/javascriptAGZClassID{fc886801-e768-11d4-9885-00c04fa0cf4b}''@mozilla.org/content-viewer-factory/view-source;1?type=text/javascript@mozilla.org/content-viewer-factory/view-source;1?type=application/x-javascript>PZClassID{fc886801-e768-11d4-9885-00c04fa0cf4b}''@mozilla.org/content-viewer-factory/view-source;1?type=application/x-javascript@mozilla.org/content-viewer-factory/view-source;1?type=text/html; x-view-type=view-sourceMZZClassID{fc886801-e768-11d4-9885-00c04fa0cf4b}''@mozilla.org/content-viewer-factory/view-source;1?type=text/html; x-view-type=view-source@mozilla.org/content-viewer-factory/view-source;1?type=text/plain; x-view-type=view-sourcep[ZClassID{fc886801-e768-11d4-9885-00c04fa0cf4b}''@mozilla.org/content-viewer-factory/view-source;1?type=text/plain; x-view-type=view-source@mozilla.org/content-viewer-factory/view-source;1?type=text/css; x-view-type=view-sourceY=ZClassID{fc886801-e768-11d4-9885-00c04fa0cf4b}=''@mozilla.org/content-viewer-factory/view-source;1?type=text/css; x-view-type=view-source@mozilla.org/content-viewer-factory/view-source;1?type=text/javascript; x-view-type=view-source`eZClassID{fc886801-e768-11d4-9885-00c04fa0cf4b}e6'>'@mozilla.org/content-viewer-factory/view-source;1?type=text/javascript; x-view-type=view-source@mozilla.org/content-viewer-factory/view-source;1?type=mozilla.application/cached-xultype=view-source@mozilla.org/content-viewer-factory/view-source;1?type=application/x-javascript; x-view-type=view-sourceNiZClassID{fc886801-e768-11d4-9885-00c04fa0cf4b}''@mozilla.org/content-viewer-factory/view-source;1?type=application/x-javascript; x-view-type=view-source@mozilla.org/content-viewer-factory/view;1?type=text/xml kthroneroom.t555555Yo5]nM DU+>!O .OLz4. ;fyS~?T t   a m   .  . c w   , !D!W!@R7#####ame=localsearch@mozilla.org/rdf/datasource;1?name=localsearch :9/ <X:ZClassID{e638d760-8687-11d2-b530-000000000002}X:):'1:' :{6bd1d807-1c67-11d3-9820-ed1b357eb3c4}:x:'s=;ClassNameInternet Search:: ::InprocServerrel:appcomps.shlb;: :;:ComponentTypeapplication/x-mozilla-nativec;8;;F;:ContractID@mozilla.org/browser/internetsearch-service;1;; c;2y<2:@mozilla.org/browser/internetsearch-service;1 <;.<Y<ZClassID{6bd1d807-1c67-11d3-9820-ed1b357eb3c4}Y<*<'2<' <@mozilla.org/rdf/datasource;1?name=internetsearch@mozilla.org/rdf/datasource;1?name=internetsearch<<2>,=ZClassID{6bd1d807-1c67-11d3-9820-ed1b357eb3c4},=<'='<{8bb4fb61-1cac-11d3-bdf9-000064657374}s=L='h?>ClassNameRelated Links Handler== =s=InprocServerrel:appcomps.shlb== ==s=ComponentTypeapplication/x-mozilla-native=>>= >s=ContractID@mozilla.org/related-links-handler;1>]> =>%h>%s=@mozilla.org/related-links-handler;1>>%@!?ZClassID{8bb4fb61-1cac-11d3-bdf9-000064657374}!?>'>'>{141917dc-e1c3-11d3-ac71-00c04fa0d26b}h?A?'?Aq@ClassNameNetscape TimeBomb?? ?h?InprocServerrel:appcomps.shlb?? ??h?ComponentTypeapplication/x-mozilla-native.@@?@h?ContractID@mozilla.org/timebomb;1q@N@ .@Y@h?@mozilla.org/timebomb;1@@B@ZClassID{141917dc-e1c3-11d3-ac71-00c04fa0d26b}@@4e23-a5e7-12f837fbbd9c}''@mozilla.org/layout/contentserializer;1?mimetype=application/xml@mozilla.org/layout/contentserializer;1?mimetype=application/xml}A ZClassID{4aef38b7-6364-4e23-a5e7-12f837fbbd9c} ''@mozilla.org/layout/contentserializer;1?mimetype=application/xhtml+xml@mozilla.org/layout/contentserializer;1?mimetype=application/xhtml+xmltG ZClassID{4aef38b7-6364-4e23-a5e7-12f837fbbd9c} ''{9d3f70da-86e9-11d4-95ec-00b0d03e37b7}Q*'ClassNameHTML content serializerq {QInprocServerrel:content.shlb QComponentTypeapplication/x-mozilla-nativeQContractID@mozilla.org/layout/contentserializer;1?mimetype=text/html< ;G;Q@mozilla.org/layout/contentserializer;1?mimetype=text/html;,ZClassID{9d3f70da-86e9-11d4-95ec-00b0d03e37b7},''@mozilla.org/layout/contentserializer;1?mimetype=application/vnd.mozilla.xul+xml@mozilla.org/layout/contentserializer;1?mimetype=application/vnd.mozilla.xul+xmlQ=ZClassID{4aef38b7-6364-4e23-a5e7-12f837fbbd9c}=''{6030f7ef-32ed-46a7-9a63-6a5d3f90445f}]'@ClassNameplaintext sinknt serializer InprocServerrel:content.shlb ComponentTypeapplication/x-mozilla-nativeT) 7ContractID@mozilla.org/layout/plaintextsink;1r;1?mimetype=text/plaint T<$@mozilla.org/layout/contentserializer;1?mimetype=text/plainpools.t,3, ,W,,,.]3=S0),`6AW0&-[1<R"FZk3~o*6VWc\Vv$mm,a ' N r )  @d5nk'=9|KKKK%KJKKKKCKSKKKKsKKKK"KrKKKK8KKK+KOKKKKPK K KKK      @    >EHҥ`EHҥ`EHҥ`EHDԥ`EHxzե`EHd Ҁl`NEHsҀn`NEH졈g4ӘEHL%ҥ`EHFҀw`NEHү-EHҕdestEH죐&Ӣ&cEHӢ&cEHSնn_'EHďӢ&cEH잰ө&cEHmҀe`NEH츰iҀe`NEH|Ҁi`NEH쵤Ҁp`NEH.org 0p@Pd-HLׂ;\{@t&b5rIyVl.@@%;LB@V27xb@l9,bMOt@T1$d I3qyK@ƬR FGn @\曏AN:!vF@lV⭨F1Ժ<@Œ;X4Bla6Xqˀ@du9@rLӧ¸ @Bu=s*N>w3\g*>r7.rzz!qAT2E]o 8 2nJҷ_@mailnews.shlbas@g$LY_A@ʄmailnews.shlb@L KҀi`N@4mailnews.shlb-8@ĜDA՞Ҁj`N@mailnews.shlb@?PMҷ_@Dmailnews.shlb@҇nP,ҷ_@Tmailnews.shlb@Tu@ʹmailnews.shlbic@'wfH&K"R@0{F_r0Ap@7(BlH%x@L՝(0@$MsgCompose.shlb@m"+F҂Clas @G0 L`llayout.shlb`1$d 쾸`Llayout.shlb`؈R(`layout.shlb`昕\`layout.shlb`ۼV⭨좐`layout.shlb`x;X`layout.shlb`,u90`^^쿨``ޠj .죔`s=`ΰ Ux8`X줘`libjar.shlb`u&8H0 granary.t2ay!U!!!!-!!!X!k!!:!j!!'!H!k!!L!!!!!!)!J)vI*I)KJq    = U   T), u&@OZ<c7^. O-^ @GW1Rv`o}<4@drG^'> oZ Hl`&Py" )Im < 4+cGS(1<Q-3Nt>bvDXI( L0 prefm.shlb prefm.shlb  l p  7   D*5 HP ` QFA.shlb-mo QFA.shlb     R>]      0ꈐ 4Jy8 H \l`0    Psmime.shlb Hsmime.shlbs  :h  w@ strres.shlb pstrres.shlb $( 86&< }xD_ wx tHi:xH 8 uconv.shlb @uconv.shlb  ؞  Xucvcn.shlb' ucvcn.shlb  (, hucvibm.shlb ucvibm.shlb dh xƍ|@ ucvja.shlba ucvja.shlba   zx ucvko.shlb.  ucvko.shlbm    p x< ucvtw.shlb pucvtw.shlb9 |    Xucvtw2.shlb `ucvtw2.shlb  @6X T X   -v  4x vcard.shlb `vcard.shlb lp c* view.shlb  view.shlb    -ar8 Wallet.shlb Wallet.shlb    V$p D{H P \?~` ꉀ  xfer.shlb xfer.shlbb2   }a| P ,ꉰ ˽i 0 $( < LܣP ( t x0  ` Q8h 0   -0]Pt~YLG$T~ZnT\ ~Y=~YD|~Ym4~Y` l4~Y<~ZKPtx \~TZ<~(\,~l07.~Vэ<~V&x~w-yC8~y0kd~[h|~KM@ꉘ~q>P~8)BLDHxtemple.t1!E/8BZ4 N:1+pi+!E Ng<tw8/gg:uH q    0qw; 3MqLp,EHlEH(,EHlNetscape 6ComsDgƠ |ƀE ,SpellCheck.shlb)V̀9P 4 9P8̰9P 6SpellCheck.shlb)V̀9P 4 9P8̰9P 6m 4shlbMOZZt--TEXTMOSSdmEHlEH,EHlNetscape 6ComsDgƠ |ƀE , strres.shlbV̀9P 4 9P 8̰9P 6 strres.shlbV̀9P 4 9P 8̰9P 6 4ڪmshlbMOZZ-]-]mTEXTMOSSEHlEH,EHlNetscape 6ComsDgƠ |ƀE ,TextServices.shlbV̀9P 4 9P8̰9P 6TextServices.shlbV̀9P 4 9P8̰9P 6 4bmshlbMOZZq 0- {- {mTEXTMOSSDEHlEH,EHlNetscape 6ComsDgƠ |ƀE ,transformiix.shlbV̀9P 4 9P8̰9P 6transformiix.shlbV̀9P 4 9P8̰9P 6m 4shlbMOZZkK-S-STEXTMOSSmEHlEHEHlNetscape 6ComsDgƠ |ƀE , uconv.shlbwV̀9P 4 9P 8̰9P 6 uconv.shlbwV̀9P 4 9PUS10U Equifax Secure Inc.1&0$UEquifax Secure eBusiness CA-1y50O1 0 UUS10U Equifax1.0,U %Equifax Premium Certificate Authoritymy50O1 0 UUS10U Equifax1.0,U %Equifax Premium Certificate Authorityy50O1 0 UUS10U Equifax1.0,U %Equifax Premium Certificate Authorityy}mmyk0Ipv6_to_Ipv4 layermLDrvDmTmpDmSysDm,DeskmDTrshm\StrtmtExtsmꂌFntsmꂤPrfsmꂼDocsmHomemnsComponentManagerm4ponentsdponent Registry|0N@8Ԍ`w]`ҒWTAbSyncMj.shlbmꆬAbSyncMj.shlbmAbSyncSvc.shlbmAbSyncSvc.shlbmdaccessible.shlbaccessible.shlbꄄActivation.shlb\Activation.shlbꇄappcomps.shlbmꃬappcomps.shlbmꄴAppShell.shlbmT<R<R@V>TAW9P8̰9P 6 4 mTEXTNSInmTEXTMOSS EHlEH!,EHlNetscape 6ComsDgƠ |ƀE ,nsLDAPPrefsService.js̀9P 4 9P8̰9P 6nsLDAPPrefsService.js̀9P 4 9P8̰9P 6 4 mTEXTNSInJmTEXTMOSS <EHlEH ,EHlNetscape 6ComsDgƠ |ƀE ,nsProxyAutoConfig.js̀9P 4 9P8̰9P 6nsProxyAutoConfig.js̀9P 4 9P8̰9P 6m 4 TEXTNSIn8<TEXTMOSSmEHlEH,EHlNetscape 6ComsDgƠ |ƀE , nsSidebar.jsV̀9P 4 9P 8̰9P 6 nsSidebar.jsV̀9P 4 9P 8̰9P 6 4:mTEXTNSInTA mTEXTMOSSdEHlEH,EHlNetscape 6ComsDgƠ |ƀE ,nsXmlRpcClient.jsV̀9P 4 9P8̰9P 6nsXmlRpcClient.jsV̀9P 4 9P8̰9P 6 4mTEXTNSInO͖mTEXTMOSSdEHlEH ,EHlNetscape 6ComsDgƠ |ƀE ,nsCloseAllWindows.js̀9P 4 9P8̰9P 6nsCloseAllWindows.js̀9P 4 9P8̰9P 6 4mTEXTNSInl mTEXTMOSSEHlEH,EHlNetscape 6ComsDgƠ |ƀE ,nsHelperAppDlg.jsV̀9P 4 9P8̰9P 6nsHelperAppDlg.jsV̀9P 4 9P8̰9P 6m 4bTEXTNSIn\TEXTMOSSmEHlEHEHlNetscape 6ComsDgƠ |ƀE , jsurl.shlbxV̀9P 4 9P 8̰9P 6 jsurl.shlbxV̀9P 4 9P 8̰9P 6 4mshlbMOZZW&--mTEXTMOSSEHlEH,EHlNetscape 6ComsDgƠ |ƀE ,uriloader.shlbV̀9P 4 9P8̰9P 6uriloader.shlbV̀9P 4 9P8̰9P 6 4m eastlawn.t,HmPPPPRRS)SSS TTT&V0VVV Vw*ww$wHJJJJJJJ,JHJgJJJJEJJJJ7YYY%Y8\;\\S\x\\\\6\\\\Q\e\\\\^\\\V\\\\` `-```n`a6aaacccgcZ/[[@[[[d[[[[3[?[H[[[[[[[[Y[e[n[[[[[{[[[[[\x\\\\\J\\\!\*\L\m\\\\`\\ \ \g ___Hggg,e,ebeuefffHhhhi>ibii^^ ^^2^Kkykdkkknn nllhllldl l SS胼ylmEHlEH,EHlNetscape 6ComsDgƠ |ƀE , docshell.shlbV̀9P 4 9P 8̰9P 6 docshell.shlbV̀9P 4 9P 8̰9P 6 4mshlbMOZZ!- y- ymTEXTMOSSEHlEHEHlNetscape 6ComsDgƠ |ƀE ,dom.shlbsPV̀9P 4 9P8̰9P 6dom.shlbsPV̀9P 4 9P8̰9P 6 4脺mshlbMOZZw -1-1mTEXTMOSSEHlEH,EHlNetscape 6ComsDgƠ |ƀE ,EditorCore.shlbV̀9P 4 9P8̰9P 6EditorCore.shlbV̀9P 4 9P8̰9P 6m 4rshlbMOZZi - c- cTEXTMOSSmEHlEH,EHlNetscape 6ComsDgƠ |ƀE ,EditorTxmgr.shlbV̀9P 4 9P8̰9P 6EditorTxmgr.shlbV̀9P 4 9P8̰9P 6 4*mshlbMOZZXWZ- l- lmTEXTMOSS芜,EHlEH ,EHlNetscape 6ComsDgƠ |ƀE ,EmbedComponents.shlb̀9P 4 9P8̰9P 6EmbedComponents.shlb̀9P 4 9P8̰9P 6 4mshlbMOZZ`D- |- |mTEXTMOSSEHlEH,EHlNetscape 6ComsDgƠ |ƀE ,FindComponent.shlbV̀9P 4 9P8̰9P 6FindComponent.shlbV̀9P 4 9P8̰9P 6m 4苚shlbMOZZ^G- 2- 2TEXTMOSS 芜mEHlEHEHlNetscape 6ComsDgƠ |ƀE , gfx2.shlbsV̀9P 4 9P 8̰9P 6 gfx2.shlbsV̀9P 4 9P 8̰9P 6 4RmshlbMOZZ -۸-mTEXTMOSS芜EHlEH,EHlNetscape 6ComsDgƠ |ƀE ,gifdecoder2.shlbV̀9P 4 9P8̰9P 6gifdecoder2.shlbV̀9P 4 9P8vendor.t"ER^kw GS\ $0=IVbo{Py(1^jsBNw ;Gu  M Y      % 1 b n       8 D j v          B f   A)M-q#R%m9SwLpҖ`VSҖ`V#Җ`VSҖ`V(^ JӚPlږklB:@ݱH#mӳ\<2j(ӧHO<-QѨ'@(ɽWG }`Ө>Z4%rt9ԷzKA=ҍ`N-QѨ'@(-QѨ'@(-QѨ'@(`IaѨ'@(`IbѨ'@(`IcѨ'@(ɦϑғ._2j /[`I`Ѩ'@('RѨ*@([ GUJx`IdѨ'@(6xҨF@([{QҨH@( -іӊZ`ӻo2>|0HgԨVZ4eKҍ`N5Iҍ`NWqKҍ`N A8 A@8 ATL` AͶh||玠玨现玘玸L`8/}ITԇ^C{9ҙ8kȠӯp$0ӰW$Y˃Ҏb e| AXnullnull AϦ绐珰珸 A Aϸxph`XX`PH@80( nullnull A罈 A罐罜(x hX`琸琰琨琠琀琘琐 A ( A0<瑀xp`hXPH@80珸 A,羄 A羌羘瑸x瑰phX`PH@80( 瑘瑐瑈瑠瑨 A@$璀xphX`PH@80(  At翰 AЀ翸翰 Ab環璸璨S` vdzto2xltsz3p${uyq<vr|zLa$cppLwr,xnDg<OdQ$vmToS2w,0qz$h|m,e\UF 4tomb.t?.?B??C??>???5?~?!(!;!!3Dm<WLu##$T$x$$$$$3[/////g/((((G(k(H(l((/333393L33333?3^33333=3I3t*(***'*;****443444444454A4J4444^4j4s4444C44474[44444P4y444b444 4A %-%Q%i%G%j%#v;;2222&2J== =n====1=====?=<'<r<<< <W<<< <4<G<<<<F<Y<< ====&=2=;====[=g=p====]=i=r==%=I=======S=|===D=o&;&_&r&S&2b?????o???'A4AA3AWAhAAAA2ADABApAA.A`x/xExxxTxqxxxx)x5x^xqxxxFx8xDxxxxxxx$ x9 .B C0CTCCCK Ci H/H-HXHkHHHKHvHHH5H^HHwH/AAU64 . 1 J]3> 5x7;:iŖ|K=?ABiEp$HU6K=OL9Rխ*)Vw ZeP^mb[lg  FkZ߹!prH#8ux$zJ4&oِ(&)+/-://1 4,6~8;zą>"@LL%tJ1'yZ')i*y{,w v.eo0 Si3>b5%)Z72S:?L<MD?\-<BlG2E|a)H{s KhaOIN R*:V  'Z^":b/^f<2zkKLQpYf(ui~zy2acBuk#dz7Qt>nC9*ghu`LpY HR.6JHBb=5:}m1g`f(C*H )Eq .~ < 5?a `%F x2 qO? &%N( u]4z ld }0|( i Yy4qA`; LMv qI: &@J& e : C zn~4 Y3M 7_gj / 8?|c `tB&K*" :gD "p\D Ti M{ Hvo zg SG Q"# E#Vx> D%Aھn L&TGa([^*uՊ{) ,[ӤLjGF.UѪ:0fϙ|2mk<= 4-qIb"u7.݊?#9[o'%<7e#*'I>ض|) AI*DY .+0,GK8P.J9w}0N@! O3 QAH 5TUeʫE )U7Y2K :1].Cb "1<KGL*UK kNcQrUtBY\E]Ya{`!e!"jj~$ o)%tXC0C0CGOCG OphGŀfg@ffgffXfPffxfpfHff[0YhYPssYtYZYDZ #garden.ty#^i|sJb8K V2E%Z i c y   pDo$u 0Qqk/r(@%8f(@%1D"n"E(x>xxxxx6xLx_xxxx)x<xxxxxxxxOxj .   m/mmqmmmzy)yyyyy5yKyyyyy=ya)1e)n[w)ww>ww7v(vWvEvivvvvvEvTvhvvv vvlvuvvvv) s44E4444T4j444[44444:444444g44555555O5s515U5"5N5y3Iz*aooooooooIooto/Y}%Y 7rļ 7[ި޸ްļ 7~,8wԂҊZ` 7d 7ldx 7ŀŔ@PH(0xd 7d 7d 7,ߐߨߠ߈phX߀xߘ 7d 7ldx 7ƀƔ߸߰x 7H 71XPH 7a 7m$0 7T8Tph`80( T@x0 7 7 7{ipщ[`-щ[` 7l 7tlȀ 7ȈȜHXP`80( @Ȁ 7 7 7$0x 7X 7lxhp 7'ɠɬhpxp(  77 78 7: 7< 78 7: 7<  park.t.ppqqqqq6qqqswss+r+++ +2+V+z+)t=ttbtttttttSt|tu:uJuuu6uuu"uuuuuuu;uXuu;uZrrrQr|rrrrrrrJrSr_rrrr|||||T|x|||||#|g}}}v}}}&~~~~(~Y~n~w~~~~!~-~6~~~~~~~P~\~e~~~~)~5~>~~~~~~~Q~]~f~~~~F~R~[~ ~~~~~~ ~{~~o ~ ~ ~ ~D 6u0C?pr7['(LbS) 1> "}6MIu.[-[[[^QjB#L! }Im Xk 6  Q u       :   2   ?j},UxAoBf0T~? |      9    $    z>cFFFmd:dNd$d:d5d;o R9Y~k~\~ @ k ~   5 w   t   6 a   9 d 0Tkc1X|-=IThE[)=dz$c fy O s    V    D   Ids#GT:T[yMu2u|4Jqc^`qn66666A666J6u6666666"6K6W6666666F6j667:7w7777(7P7\7777777$707Y7e7777777[777DnKK0.RhENbJJ JaJjJ}JJ,@Jav1=fr:F 1U'AhI2IoIIIpHHHJH]HtHe?c+A  4'?2't6N3g|Hd D/@Dh|-(LbevY'N_.[ o:s<t0~ 5(Sh/M palace.t@,@-@@@!muAFqE 5'<Nr   T `  !EN1rqMM,B 4X*N#7#7#7#7/,>":"### # #e#####9#j#####O######&&&&+&u&&&$$?$i$$$$$$cq<`  2+<P|%%A%w% %%%3'q'''''' '3'E4x4797]::!:m:11117&"%T%\%d%l%t%|%%%%%%%%%%<%L" " !  `   !"# $%#"z"###"D"`"|"##################"$$$$$$$$$$$$$$$$$$$$$$0########(()))(|((())))))(''')( ( ))))),)))))( ')'''')'d&&&''''''''''''''&'&'''')&hCDATA[#,L,,,,,(,H,h,,,++++*+++++ +p.x../h../X/h/h/h/h/h/h/h/h/h..p/h.p.p.p.p/h.0------------------x--x-----43p33333333333333333h33h3h3h3h33(2`22222222222222222X22X222228889t779 9t9t9t9t9t9 9t9t9t789t89t9t9t9t8L777H77X666744595<5<99959999995<49444494|=$=D=d=====================<<8<<=>>>>>=>>><<0><0<0<0<0>;:::;;;;;;;;p:;;;;;:|;:|;;;;:<@$@$>>?l??@@$? ?\CTCtCCCCCCCCCCCCCCCCLCCLCLCLCLCC BPBpBBBBBBBBBBBBBBBBHBBHBBBBBBEEEFFFFFFFFFFFFFFEFEEEEFEhFFFFFFFDDDEEEEEEEEEEEEEEDEDEEEEDlGGGGGFFFGGGGGGLLMMM<M<M<MMMMMMMMM<M<LMLLLLMLM<MM<MlMHM<M<KKKKKKJKKKKKKKKKKKKKKKKKJJKKIIII$I$I$I$I$I$I$IHI$I$I$I$I$II$II$I$I$I$ILDLDHLDIK`KKLDI4IHK8HXHtLDLDLDLDLDKHIIHKLDKKKKLDKIJpJLDLDIK(OTOTNNpOTNXN`NhOTNNOTOTOTOTOTOTOTOTOTOTO0PPOPPPPPtPPPPPPPPPPPPPPPPPPPP<QQRRRdQQQQSSSSSSSSSSSSShSSSSSSSSSSSSSSUVTTTVVVVU,U|VVVVVVVUUVUVVVVU[[[[[[[[[[[[[[[[[[[[[[[[[ZZZh[X[X[X[X[X[X[X[X[X[X[X[X[X[X[[X[[[[[X[\|\\\\\\\\\\\\\\\\\\\\\\\\$$$$$$$$$$%% %%%$%,%4 " !  `   !"# $%#_Dz_D___^_ _(_D___________________PaLaLa`a`a`a`a`a`a`a`a`a`aLaXa`aXa`a`a`a`a```t```````\e|e|eeee(eDe`e|eeeee +funcs.tA-AAAUAqAA*=Vjv$8GZg{+?Zo6I9M]qy errors -- terminating output. XI# HTML 4.0 Strict-DTD validation (enabled); [Should use Transitional?]. HTMLHEADLINKstylesheetreltext/csstyperesource:/res/viewsource.csshrefBODYPREclasserrorSPAN<!>CTokenDeallocatornsDequeFunctornsHTMLTokenizernsISupportsnsITokenizerDOCTYPEELEMENTATTLISTENTITYNOTATIONnsExpatTokenizernsISupportsnsITokenizernsHTMLTokenizerdtd/UTF-16chrome://communicator/locale/layout/xmlparser.propertiesXMLParsingError -^ExpectedchromeUTF-8>xmlns<!----><!DOCTYPE nsParserServicensISupportsnsIParserServiceParserWell formed DTDNavigator HTML DTDOTHER DTDTransitional DTDViewSource DTDParserServicensParserModuleL,d&8Ԁh\&Ā` , & `p d\X&& ' ؀X0'F!Ȁ "$"`%D(& HX)p(',X,-xLH/x'3<X3h3(L4@80@9Ā@;((<(b@h(tD8t(FGLHH(Jt@8KHND0O$<O`HO<O0P 0Q0SȀ8Vp(V W0X8|X Yl(Yx(] h]t^|^-?"(!"#$$(|#/*`#*!*m^!(#*#)=(*@) $# !?(% l! $"$&!?#$P$1P$,b@#$ @?????_L@!*3"4!?4! #`(!(#")"!!(!?-T5-{?"*'!#$ #|=?.9,m^"9+";.9*=ÿ#=*#`=.@`=*#=",,%;l?_!4 ? "!! ">fw)  "!" R ,(') !"#$% $&"' R ,)#4z4h4@d,$,$,,DDxDPT   LLLLL@<44)(CDATA[# K ,, l   00<<d0T d((((((((((((LH$$$$$$$$$$$$$@$@@@@$4\HHHHHTl@88t@@@@@@@@8d@d@@@@XX$$t$PPPPPentry.t(FHIKGMQHJIGLaGIJGEGF!!4!d! !!8!!<!d! !!<!@!l x @@! "!!!T!! !!8!!0!0! "!! $00! !!8#!D!D! "!!!d!d! !!<# !!! !!<# !d!d! !!<# (!X!%(<<%H%0!(!!L!` \\` !d!d! !!<# 0$P! !!@!!h!h! !!<# X!D!t!f!!!^!!%f%n %f%~%f(%f%f%<%f% %f$$%L!fpX @ %v%~%@@%%8%h %Dt%t%%%% %0<%xx%"!%% h!"!!!L!!l#,!H!!`#"\#!D! ,\!P!P! !!8!!L!L! "!#0!8!!2!!!*#""!%*!2!@p !4T`ttLh`!%h%`((%h@@%`t%h%`x%h!`!!8!<,l\l(!X!X!!!%  !& `D!<#!,!! !!<!0!0! !!<#!,!,! !!X#T8!X!X!.!h!h!"#tx!!88"!!X#$! !!<! !X!X! "!!!H!H! !!X!#L!H!H! !!X!#L!0!0@<<4HH(\XHX0XX!!LL HXZR@%JhP%B\%:%B%J%R!Z! <lt!X!X!!t!!$!!<!!@#D!P#!0 02@\*l"*28!"!!8!8! "!!H#L%XX$l!!!H!!# !0 0 HHfTTZ``N!"B!%.%r!B!!8!<D0\LB8!!! !!H#`!"!#! "   DDhh@8! H00T8L`  TTTlxT  \\|T800HX8hh@ TTxx@PPpp( !@ ` ,`X ,0 8TTTTT 48`T |,`,  !!!n!!!f!!!^!!%V%N,,%F<<%NP`%Vpp%^%f!n! 8 `4 4 48!@@ZLLNXXBhh6"!H# lx P ( # p#%Z44%RDD%Z%b%jxx%r,%Ph%z$%%((%88!!$ LdX4   4 p$%X<L%`%h%`%x,<%tt%%%%%%0% T!!|(!X!X! "!!P#! !!H!P$! !!p!0#T!  < DDN\\B:.!B#T%Z``!B!!8!," !!"!\!"# !<!"B !t!t!!!%,T!!!@!@!!!!!%X!&!THH!l!l!X!x!x!L!!%@8%pLp%h%`h%hxx%p%h!p T$T X!"!"!(!X!X!!p!!!!8!!<# d`!\!\!.!!!:!!%Bdd%J%V``%^!j!!#|!#!#\!#|!#!|#|!#0!X!X!!!!!!@#|!D#@!!%<<%(%0\\!<!!#|!#!p#|!#8!l!l!!!%$%,PP!8!!|#!p#!X#|!d# !<!! !!<!!l < !%P%xp%h%`%X%`%h%`%h,,%p<H%xXX%hh!!p,h Dp <!h!h! !!<!0!4!|!>#$%60P%.hh%6t%.%6!>!pL D D0!@!@!6!P!P!.!l!l!6!!"6!%6HH%6!6!!@#,!h# !8!8$HHdd$$!@#,!T#(!D!`!#L! D LL@\\llldxx\!T#|%L%T%\%d!l!!P! \, !`!`! !!H#!\!h! !!<!!T!T! "!!!P!P! "!!!P!P! "!!!P!P! "!!!P!P! " footnote.t%D^qW(WLWpWW$WAWMWWXiv|DhPOmtoooo|qqp<r%rrryutel8ٜل݆`:, ߜ!!!!|"" """$",("4"<"D"L"Th"\"d8"l"t"|"n"""""""""""""""## ###$#,#4#<#D#L#T#\#d#lf#tP#|}######8##^##J###|Ҥd$$ $$$$%lϜ0 ΜD\LͰ$@tHɀ0ȔȸhƠHt@8xP|HH\l ,@dxL $lHT(8P\ 0D|T8#)B"/!(! #`ߜ !##ANY"ID#yes"no"rP^r,r4r<r@qqq<p] YlXX8WVVpSȀQPOOO`O$ND3<3,)h!ȀԀ؀Ȁ\ ` , $ĀhԀ,L!# <   8((hxP(HPpxDtXXX 8xPԀddDl`XTh 8,ffgg ffffff,f$d(%\hh%T%\,,%d<<%lLL!t!!L! \,Pl$!h!h! !!<!@$,,! !!<# `!\!\! "!!(!P!!$"%0%$XH!$D L! !!D!$%<t! !dp| $0!  8DDZNFN!f# %NL|%%%%~ !r hph( N!8"#8T88$ !!"N!0!0! "!!H$%!!!8!!#H!!! !!\#8$ l! !!8!(!!! !!D# !<!!*"%"d%*%2!*!d< 0#L! !!<!!t!! !!8!!t 8 F>%6  %.00%6@@%>LL!F! 4 <,(!H!H!!l!!~!!!v#%n$$%fHH%^XX%fhh%ntt%v%~%%""%~  !! 4 <,x ,  H4~(!!!2!!!*!!%"%* 0!2!@ hT!0!0<<hh#d!88:DD.tth!X#\h0hh#d!<!l! !!8!!0!0! !!X#d!8!8HHXX#d!<!<!0!T!T!(!p!p!0"%(D%0!0D! !hh#d$t<%$%%, !$!!4!4! !!X#d!8!8HHXX#d! hh#d!4!4! !!X#d!8!8HHXX#d(!!%88%|! @0\\xx !H#!8!8! !!h#d !<!< (hh h#d0!@!@ (xx x#d$,<! !!X!(!4!! !!8! #X! !!<!(!8!! !!8!!4!4! !!X#d!8!8HHXX#d!4!4! !!X#d!8!8HHXX#d!4!4! !!X#d!8!8HHXX#d!4!4! !!X#d!8!8HHXX#d!4!4! !!X#d!8!8HHXX#d!8!8! !!X#d!0!0! !!X#d!<!<! !!X#d!P!P! "!!!D!D! "!! #! !!@!!X!X! "!!h!$#(!`!`!#l!hphD0dd>2*"!2 8pD(``hphD(hh:j%b%j8%b%N8%rTT%bhh!j!!D!!X#,!@! H,xsenses.t5c68-(-L-h----=D0n8 x6 L Ѐ| L7   x7<dp$h7,, X8\L0<7>ĀDD 7P@7b 7t 77d|778܀d @L `!7&P'8d'|()81ЀX2(X2h2l93TX394\$4`4 5Ād6(8x<9:t;`|;܀\<89?:rAtDÀBLBLCH:DH:EX:Eh,EpFF GxH`IdLl:LM0N:P\PP8Pt;0TX4@U VDHW`YЀ8([((\0((]Xt^(^<h^ ^Ā ^H_,;B_`0a,(b,d;Tb`bpc`fHhd;ji\pìx jD;j0kԀ l;m@;pT<@q XqxLq8>lL>̀d?0`@FA(<AdHA<AtB\<B8CFDFEPFFFFFGFHGIH\IhJ ,J88JpGM4MXNPGPTQXQpGSSTHT`HTĀTU$TUx0UTU@V<@0X|YZT[D(\t\]\H_(`Ā,8b db`b4c` cx dH(eL4eLs̀{ĀP}p}HЀp@D8\0((` l(th884`P<,8h 0D TxH̀XHdXth`T8DT0dHdp<܀ X|ԀxT htd؀(܀X4Xƌtdd|(8ЀtDXʜ(˄Xz_std.t</<?<WP(Pv6(6<6q Ev5kT,DQ(CS_7FYuY4YXa4aXN4NXh4hX4X4X-Iv!I':N)*8oBk*8FP\s )5  o #5XGYgz->->->+EZgB!BwBBBBBBBB.B<BFBO.2.j;!@ 8`HT|}PT`AT`=@ 8`H8}|`u@}8L||H K( A@88 T`:|.|N ;|@@ 8`H|u@Ĉ,]@8|@@ 8`H|u@,>@88`(H;|@@ 8`Hx}|`u@}8L||H Ka, @;8`H<88`H,|P,@ 8`H;H|P,@ 8`H;H|P,@ 8`H;Hȓ8`H;H}|`u@}8L||H K( A87T`:|.|N |P,@8`Hl;HT|P,@8`HL;H4|P,@8`H,;H8`H;|@@L8`X8!P|N A||#x;;|@;c;!@ 8`H||`u@|8L|{H K8(A8b8T:|c.|iN 8b"8|c|.pTc8|T:T|.|0|`9@8`H;H|P,@ 8`H8`H|P,@ 8`Hԓ8`H|P,@ 8`H8`H8`H||`u@|8L|{H K8(AP8b8LT:|c.|iN 8|TT8|.p|T:|.| 0|`9@8`H;H|P,@ 8`H8`H|P,@ 8`Hܓ8`H|P,@ 8`H8`H;Hl||`u@|8L|{H K, A @, @0H ,A$H88`HP8`HD;|@@8`H088`H 8`H;B#|@@p8`X8!PA|N |;;|@;;!A}|`u@}8L||H K,@ ,@8`H|;Hh}|`u@}8L||H K,@,AH ,@H 88` H 8`H;|@@8`X8!P|N |;;|@;;!AԈ}|`u@(,x@8|888KH|`u@}8L||H K,A8`Ht;H`}|`u@}8L||H Ku,A0@ ,AH88` H 8`H;|@@8`X8!P|N A||#x;;|@;c;!@ 8`H0||`u@|8L|{H K8(A8b9xT:|c.|iN 8b"8|c|.pTc8|T:T|.|0|`9@8`H;H|P,@ 8`H8`H|P,@ 8`Hl8`H`|P,@ 8`HL8`H@8{888KH(8`H||`u@|8L|{H K8(A8b9T:|c.|iN 8|TT8|.p|T:|.| 0|`9@8`H;H|P,@ 8`H|8`Hp|P,@ 8`H\8`HP|P,@ 8`@^؀`_8d_`P@`atpabh`bȀ|cD@c0fDghkx0ltmp(o (p\q<pq@q@rd8r*.7/602133(3L;(;S8;m'n'C(CS<5<k<<YB4E(ELD6i(iL](P5Q3QeQrf''^'''+'*''(( ~'''a6j(jLv(vLl3lelrm4o4(q4r4s3t7uOz(zLy2|(|L{2(L}4~:(L4344(L&J2(AH(,)AH8`H8`H |+xHH8!@|N a|;,;c;;;!AT@,A@4,@H,AH8`H8`H8`Hx8x88H%A,A8`HD8x88HA,A8`H8{8HX8!Pa|N |,8!A@(,AH8`H8`H |+xHH8!@|N |,8!A@(,AH8`H8`H |+xHQH8!@|N |,8!A8@,AH8,AH,8`H,8`H8`H |+xH݀H8!@|N |,8!A8@,@H(,@ H 8`H8`H |+xHyH8!@|N a|;d;;;;8(!A08bT:|c.|iN 8`H Dx8}8T<|HA,A8`HDx8P8T<|HA,A8`HDx8f8T<|HIA,A8`HlDx88T<|H A,A48`H08`H(8`3H 8`H88HX8!Pa|N |, !@ 8`0HHH8!@|N |,9!A@,AX@p,ATHd,"A$@X,!@HL8`HPh(A<88`H48`H,(@8`H}CxKH }CxH H8!@|N |,8!A8@,AH8,AH,8`H,8`H8`H |+xHH8!@|N |,8!A@(,AH8`H8`H |+xHAH8!@|N a|;,;c;;;!A(@,AH,AxH8`H8x88HA,A8`HT8x88HYA,A$8`H 8` H8{8H]X8!Pa|N |,8!A@(,AH8`H8` H |+xHH8!@|N |,8!A@(,AH8`H8` H |+xHH8!@|N |;,;8!A(@,AHp,@hH08`Hh ,A H8`4HD8|;x8|xHـA,A8`H8~8HH8!@|N |,8!A@(,AH8`H8` H |+xHH8!@|N a|;,;c;;;!A(@,AH,AxH8`H8x88H݀A,A|8`HT8x88HA,A$x8`H 8` H8{8HX8!Pa|N |,8!A@(,AH8`H|8` H |+xHQH8!@|N |,8!A@(,AH8`H8` H |+xHH8!@|N |,8!A@(,AH8`Ht8` H |+xHH8!@|N a|;,;c;;;!A@,AHt8`Hx8x88HA,Ap8`HD8x88HŀA,Al8`H8{8H ـX8!Pa|N |,8!A@(,AH8`Hh8`H |+xH }H8!@|N |,8!A@(,AH8`H8`H |+xH %H8!@|N |,8!Aintro.tN8a8t$(KI`8z8K98a8HA8`x8!p|N a||{x;;;;!T(A8<8a8cc(A HeA{T888HB`,@$8{888K<`N;H,(A$(A8{8888\KAX8a<8|XHAH <`;@h8!`xa|N ||~y;!A(8~8HA5@xHAH8!@x|N |;;x;8!`|8|hlpK!`8~8hKA`}t8$T}t}tHԀ8}t| | P|pW<}t|* 88t}t8fgBx8KT`;A xH\Ha\|dP|cp|c|a`@ 8a`H8a\aW<|H |a|@@,a8|88`HA(@Ā\|P\\,AdHH a||@@,a8|88`HA(@Ā|a\|P|p||Аdd|@ 8a\H8adaT<|\|P\\,Aht|@@$8~8h88KU`(@xKc`|xt88t t8!|N |888!K̀H8!@|N N |`|#y\bX|ux;B|+x!8|#xdDA~xKYT`<|H8a888u( HAAaa(A4uH=`,ADT`:|v.HeAa|xTH}A8a8HuA$8a(8K`:;;H;(acCA~xKQT`<|H8a888u( HـAA|wyaAv;#|@Ap |@@d#xHuA88| ;8ܐ8АԐ؄deB|P|p|Ha|dP|cp|c|a@ 8aH8a#aW <|H a|@@,a888`HA(@Ā|P,AdHH a|@@,a888`HQA(@Āa|P|p||А|@ 8aH8aaT<||P,Ah8| 88܄deBH܀aԀ|dP|cp|c|a@ 8aH8a#aW <|H А܀a܀|@@,a888`H1A(@Ā|P,AdHH Ԑ܀a܀|@@,a888`HH8 H80H8@HX8!P|N !|;;c80!8a|"|(@|+xN |||x;;!(@d(@ 8`H8`@8HA|(@ 8`H8@8 8} KY8|8HxKA;88H<xK,A||c.H(@|;CH;Z|WY:|.(@(@ 8`HT| |@@8T<8wHA|yy@ 8`H;W;;`H`||c.(AHcKqC8H(@ 8wH8c9std.t M^!2CVp:M`/;DM:M`5(IF[(IF[/;DM:M`5(IF[IF[F[8atH+e|@@8XH3AH |,AxHh,@8,@,h( A H3uA,@ 8`H(8(@,8q8P8 H*|(@ 8`H(AhD#x8||0PH0ɀd | (@ 8`H|H(A 8y88H0ud|(@ 8`HP|aT(A!T H2EAH(AaP(ApP H1AH@x0xH1݀A,A8H8y88H/}|zy@ 8`Hh,AXat88 H(||(@ 8`H4|@A8|H|H8|H|,Ap8y88H.|zy@ 8`H8q88 H(a||(@ 8`H|@A8|H|H8 T(A8w88H.Is(@ 8`H,ܐHx888H0AA,@ 8`H(ApD~x8||0PH-|zy@ 8`HCxH U_ ܐH,(AhaH(AXD~x8||0PH-q(@ 8`H\|fxH H/qA~xH*=HaL(A@aH(A08LHH/A~xH)HX,A@ , AH8` H8`H8`HD(A888HA88888KU(@HPa<aD|@Ad(A,a@T<DcH%A@dH aD8 8` H%]A(@ 8`H؀a<8c|HH|c,|@ 8`H8,H|c,,@ 8`Ht8|H,A,@ ,2@D#x8||0PH+1|dy@ 8`H8q8H$|zy|@ 8` H|uA 8` H(A88Hq,ALH,2@ 8` Ha8(A\;888p H,A,@8`HX,@Ѐ,@,h( A H,aA,@ 8`H8D(A888H Hp, Ah@, @HX,@PH(888H ,@08`H888H ,@ 8`H|D(AH,A@@,@, @,H ,*A ,1A888H 탡x888H+IA|{xK8!й|N !;#|;D;;e;;;x!C~8888H*ـA8a8(A8bT:|c.|iN D(A8y8fxH (A|8`H̀D(A#x8ExH H#x8ExH ,@8`H#x8ExH ,@\8`H`88`HP(A\8`H<8`H4(A\8`H 8`H8` HA8]Kh8!`!|N !;#|;D;; ;̐8!888Hc a@ AD8<ỳT<d;8H))A|gxH8y889 Km@x8!p!|N cN |;;!H,AH,@0 |P|p|A( @ 8  ;|@@xH&,@;,A 8H 888 ,@ 8`H8`X8!P|N ;|;;::;;];=0!;aD8~888HH'A8(+A8bT:|c.|iN 8`Hx|@@ H8`Hx|@@8`Hx,8~8H'MA,@x|@@8`HD,@0, @( | P|p|A( A8DH`|uy@x|@@8`H;:Hlx :|@@xH$,@:,A 8Hx 8|.8 ,@ 8`Hx;:|AH\H8x88H!(@@8`H@D|H,@(x |P|p|A ( Ax :|@@xH$,@:,AWadv.t9"%7Hmz"?Ksk0Dh|,5>N]%Mau"6]w '@Qfz6Tjs0DXj} & : N ` s /   ; U - A S e x  6 J \ n "3Fl+O+:h| 3 B S b   0 S k t !!""%"A"N"Z"t""""#"#?#f######## #/#O######%3%C%W%d%{%%%%%%%6%O%^%s((s(((((((*((((( ((H(Q(u((((((%,W,,Pr "2ESjz 0GWiw<+:MZm (CTc|))M#Jn  , > R ^  ' 4 e r    X d m    . F  ; H Y f &>Sq#,Pe 7[2@iz%9M^(9EY FWi.KWh/Kg1ZHl6Z/S9b ;_Jp;_t / t !R!v!!! "-"_""""""# #2#V#####$$<$X$m$$$$$%$%M%b%%%%%%&)&>&j&v&&&&&&&'7'h'q''''(=(f(((()M)q))))*J*s**+@+d++++,2,v,,,,-C-l----..-.<.S.1B1Y1h1w111111 2(2~2222222-262O2i2z22222222202A2b2v22222222+2L2Z2i303T3f33404T4f44505T5f5555555,5;5THo.W)T(LZq7(797]7}777898L888 88@8i8|88888808<8j8s8888:(:L:_::::::::0:@:d:::::::;:J:q0i0@a1BVh{^m{/;DRf,:KT]s )7H_}1Om;6;F;S;f;z;;;;;;;; ;H;d;;;;;;;;;!;1;@;^;u;;;;;;;;;!;.;7r "4Xi&>`p!Cc(JZp|-\=IRn?ct.:^l},W??A??????B?U??????A&AAAA2AUAdAwAAAAAAAAAA A)ALA]AAAM` 0WuE(FF+FTFcFlFFFFFFFF$F0FYFgFsFFFFFFFF+F7FYFhFtFFFFFF!F*FNFFFFFFFF+F?FKFoFFFFFF H#H3HFH_HnH~HHHHHHH"H+HOH_HHHHHHHH)H=HLHpHHHHHH HHAHRHuHHHHHH HH-H9HEHiHzHHHHHHHH H,HUHeHHHHHHHCHlHHHHHHHHH0HPHbHHHHHH HH(HMHdHtHHHHHKKLKxKKKKKKFKOKsKKKK,K9KPKxKKKKK:K|KKKKKK%K.'!'5'e'q''''''+'O'i''1R0^j)J9]p)QZ~&PY}$AZ~R(R8RQR]RiRRRRRRR.R:RNR]RfRRRRRRR*R:R[RRRRRS.S:S^SjSSSSSSS S,SQSzSSSSSU(USUhUUUV(VLQQ6QWQQQQQQQ7Q[QjQ~QQQQQ7QrQ#SX!XIXqXX:X^XrXXXXXXXXX X0XTXhXXXXXXX"XFXWXaXXX4J5K}# E [XIWJWWWWG4BUGkz.Rbo{ >Rfx&:CYet4JL:LkLLLy(yDz(z?zezvzzH[?d (UH[[([UZ(Z;ZZZZ ZZZZ([([([([([([([([^(^hM(M[([([5C{'1(Pax(N_(6ZkuDl #GXbGt :i#GXb(7Sw5B&2;Gk|(9]nx(8y(?by$d99(9H| @@|@@9@U@?A|@@9 U ?A  |@@9U?A |~xH|89| @9&@|@@9 U ?A|@@9U?A  |@@8T?A |~xH;(@<`8c@Hx HŀA8`X8!P|N 8`N |B|#xb!,@t8aHmA8aHYA(@8a8$H9A8a8HIA8a88HuA8a8HA88a88HA,@,8aHрA(@8a8$HA8ap8HA8ap88HA8ap8H%A8a888H5A,@8aHIA(@8a8$H)A8aX8H9A8aX88HeA8aX8HA8a888HA,@@|8@@9U?A|8@@9`Ug?A |8@@9 U'?A eH99(|8@9H@|@@9@U@?A|@@9 U ?A  |@@9U?A eH8<`8c@H H݀A8`H8!@|N a|||y;;;!@<`8c@H`8`PH AA|{yA8{888H`(8{@<`8cHx8,H9AX8!Pa|N 8cN |!8(@08(A8@HɀA8`H|xH8!@|N |;8b;|+x;88δ!88H A8,@8I; fa b#6X*>ey /CJ9oHmcfa0-80b6-fb92-9972e48e3dcc}׺''{d9b1f97f-cfa0-80b6-fb92-9972e48e3dcc}'ڽf0sourcex-johabM>EdestinationUnicodem My{d9b1f97e-cfa0-80b6-fb92-9972e48e3dcc}Ȼ'ClassNameUnicode Encoder-x-johab  ȻInprocServerrel:ucvko.shlbF*  7ȻComponentTypeapplication/x-mozilla-nativefFtȻContractID@mozilla.org/intl/unicode/encoder;1?charset=x-johab 44Ȼ@mozilla.org/intl/unicode/encoder;1?charset=x-johabD4ZClassID{d9b1f97e-cfa0-80b6-fb92-9972e48e3dcc}d'l'D{d9b1f97e-cfa0-80b6-fb92-9972e48e3dcc}ڽ'=f0sourceUnicode ڽdestinationx-johab=)  5ڽ{7090544b-c885-4c52-95f8-3c8f0c2fde67}]'`ClassNameUnicode Encoder-x-johab-noasciiξ   InprocServerrel:ucvko.shlb  ξComponentTypeapplication/x-mozilla-nativeU* 8ContractID@mozilla.org/intl/unicode/encoder;1?charset=x-johab-noasciiu U<<@mozilla.org/intl/unicode/encoder;1?charset=x-johab-noasciiܿ<gZClassID{7090544b-c885-4c52-95f8-3c8f0c2fde67}g8'@'{7090544b-c885-4c52-95f8-3c8f0c2fde67}'f0sourceUnicodedestinaPP{ba6151b4-1dfa-11d3-b3bf-00805f8a6670};QQ'TjRClassNameUnicode Decoder-T.61-8bitQ[Q eQ;QInprocServerrel:ucvlatin.shlbQQ QQ;QComponentTypeapplication/x-mozilla-native RQQQ;QContractID@mozilla.org/intl/unicode/decoder;1?charset=T.61-8bitjR)R  R64R6;Q@mozilla.org/intl/unicode/decoder;1?charset=T.61-8bitRR6USZClassID{ba6151b4-1dfa-11d3-b3bf-00805f8a6670}SR'R'R{ba6151b4-1dfa-11d3-b3bf-00805f8a6670}VS/S',VSf0sourceT.61-8bitSvS }S VSdestinationUnicodeSS SSVS{9416bfb2-1f93-11d3-b3bf-00805f8a6670}TS'V;UClassNameUnicode Decoder-x-user-definedKT"T ,TTInprocServerrel:ucvlatin.shlbTkT KTxTTComponentTypeapplication/x-mozilla-nativeTTTTTContractID@mozilla.org/intl/unicode/decoder;1?charset=x-user-defined;UT T;U;T@mozilla.org/intl/unicode/decoder;1?charset=x-user-definedU[U;kXUZClassID{9416bfb2-1f93-11d3-b3bf-00805f8a6670}UU'U'U{9416bfb2-1f93-11d3-b3bf-00805f8a6670},VV'YVf0sourcex-user-definedbVLVSV,VdestinationUnicodeVV bVV,V{6803cac6-1e3b-11d5-a145-005004832142}VV'YXClassNameUnicode Decoder-x-mac-arabic$WV WVInprocServerrel:ucvlatin.shlbcWDW $WQWVComponentTypeapplication/x-mozilla-nativeWWcWWVContractID@mozilla.org/intl/unicode/decoder;1?charset=x-mac-arabicXW W9W9V@mozilla.org/intl/unicode/decoder;1?charset=x-mac-arabickX2X9J[XZClassID{6803cac6-1e3b-11d5-a145-005004832142}XX'X'kX{6803cac6-1e3b-11d5-a145-005004832142}YX'[iYf0sourcex-mac-arabic5Y!Y (Y YdestinationUnicodeiYUY 5YaYY{6803cac4-1e3b-11d5-a145-005004832142}YY'\$EOF