TADS2 bin v2.2.0Fri Sep 30 23:46:43 2005 XSI:?@OBJ[MO drN|N\NN   !} closed. N!NNMOlocactorvobjN  D  N N~D yN ! NN%You% can't reach   from  . N*NNllMO listOcnttotiobjjN9N:N=@N>NF+O scNJ6NK8NM@NN1NONPNSNUNVNWNXNYxxMOobj1obj2N"66 E E%E E  N&MO cntNeNf onetwothreefourfivesixseveneightnineteneleventwelve thirteen fourteen fifteen sixteen seventeen eighteen nineteentwenty@NkNl88MO objN\N] LLMOobjdepthNqUUNr MO objOlistitotNNNN9N@NNN ddMO parmNN>N>> N MOlOtotic totweightNNNNN@NN N  N N wN N MO listO$itottotbulkremcurN N!N"N#dN%@N&N'N(N)N*N+TTMO amountN8>N9>> N:PPMN 4You fumble around in the darkness. How inelegant. N MNIn a total of >N' turns, you have achieved a score of N> points out of a possible N> .\nNMN.t(MNA short span of time later, you stir once again. You climb cautiously to the surface, making certain no mortal eyes see you emerging from the earth. NN\\MOoNP" NQ! NS(NTqNU(NV8NW%NXNY"!NZ/N\ N]# &N^ŕ#!N_MO objOretilstlenNk Nn"D"E |~NqNrNsNt!Nu@NvNxNy00MO parmN"{NMOret html_modeN@" E @N&NNNN NNHHMOxNNCCC on 2onX]X^MOobjflagsindent O<icounttotlistcurdisptot prefix_countN"0xKN"1xN"2xN"3xT fO"contvisN5x"D"E |D N8xN9xN":xQN";xN"xN"?xN"@xN"AxN"BxN"Cx[N"Dx@N"Ex-N"FxN"Gx+O"before after j scN Kx6 N Lx   _N Mx @>N Nx N OxN PxN Rx  N Sx N Tx N VxN"WxT MO"jNYx\nNZxN[x\t|N"]x gN"^xN"_x, =N"`x N"ax and N"cx, and N"dx N"ex,(N"gx N"hxN"ixN"jxT E N"kxT "lx+N"mx ,upon which %you% see%s% N"ox ,which contains N"pxN"qxT ,7oMO actorNv<|LNv!How odd to not notice that the !< is already open! MO actorNv<5Nv Opening <  reveals . &Nv You open !< . "|MO objN{ N}gNGN Sitting on   is N. NNNE N N  seemN:sN to contain NN. NNNE NNMO objOlistitotthisobjNNNNqN@NE E NNNNsN @@MOpointsturnsN!N!HHMOpointsturnsN/N"#$MOobjactorOretilstlenN N! NN"D"E |D NNNNDN@ N@$NNC EC  NC$NNN%,,MO objN[Nls&MO fnameNKNN>> N Restored.\bN"C N"NN/The saved position file could not be opened. N!NN4This file does not contain a saved game position. N!NNbThis file was saved by another version of TADS that is not compatible with the current version. N!NNwThis file was saved by a different game, or a different version of this game, and cannot be restored with this game. N!NNAn error occurred reading the saved position file; the file might be corrupted. The game might have been partially restored, which could make it impossible to continue playing; if the game does not seem to be working properly, you should quit the game and start over. N!NN!NNRestore failed. N!N7eQ\N'00MO newPlayerN C N NC! E C ! NCC N! E  ! N N meCC1N!myselfCC1N$BN'meC0N(myselfC0N)(<<<</ MOnN>MN?["MO avNW@0MOavnO objNE! NF<NG<NH!NIZNJNK#%NLNMMOnNDN"#MOavipNhQ<! ^NhS?%You%'ll have to be more specific about which one %you% mean.NhT*NhUNhV"7MOavdpNW<#)3?MO actorNuMO actorN=ucIt took far too long to perfect the layout of your lands to merely go scrambling them about now. *ttttXMO otherRoomN'That is not within %your% reach from !<  +X,MMMv.1PGJ|?_a]^-X_.33!3!3:MO actorNjv=IMO actorN=lv*That would draw far too much attention! eMOactorioNnvAThat would cause quite a ruckus if you tried to give that away!MO actorNpvFMO actorNrv'Maybe when you're in a crazier mood. yMO actorNgwv Dropping !< ; would require you to be actually toting it about first. NgxvSMOactorioNzv You are certainly not wearing !<  !WMOactorioN?~v*That would draw far too much attention. N?v#MOactorioNvoMOactorioNv Nv5Nv)That would draw far too much attention.pMO actorN:vTraipsing about with !< & would draw far too much attention. N:v MOactoriobjNvXWhile it would be quite amusing to see everyone's faces if you started lobbing around !< 4 that would most certainly destroy your disguise. 1MO actorNsv0MO actorNv>5" 5Nv&That would require a physical body. ,NvYou dig around !< . MO actorN#v@MO actorNGv!That would cause quite a stir! MO actorNvCMO actorNv$It hardly seems worth the effort. MO actorNvCMO actorNv$It hardly seems worth the effort. JMO actorNgvKCMO actorNv$It hardly seems worth the effort. MO actorNvCMO actorNv$It hardly seems worth the effort. MO actorNAv[MO actorNev<That would require a goodly amount of rain to accomplish. YMO actorNvZ*MO actorNv> > E >  E >" NvBIn desperation you summon forth great gouts of flame to consume !< .. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. Val leaps back from the sudden blaze, the flute held loosely in his hands.\b You are free. With a great fluttering of dark wings you are airborne once again, circling once, twice, thrice, and then you swoop out of the sky and steal the silver flute from Val's grasp. The mage's head whips around towards you, his hand raising, and then he hesitates and you are gone, soaring away to the northeast. Val pursues you on foot but he is quickly left behind in the sands of the grove. You fly over your lake, pausing only to drop the silver flute into its clear waters, before circling back. With a "PUFF" the fire is easily put out before it spreads and damages the rest of the meadows. Nv>&>>&!&Nv> > E >  E >" NvBIn desperation you summon forth great gouts of flame to consume !< 5. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. Val leaps back from the sudden blaze, the flute held loosely in his hands.\b You race forward and snatch the heinous thing from his grasp. Val turns quickly towards you, his eyes narrowing. \b "Your music is wretched," you say. "I can play far better, " and you put your lips to the mouthpiece of the flute and blow such a screeching shrill note that it sends both you and Val staggering as you clutch at your heads. \b Val pries the flute away from you while you are distractedly wondering if you should try to tear your ears off or not. "I think that's quite enough flute playing from the both of us today. " he says. Or you think he says. He could have been speaking about drinking white fluff from bootslaying growth at a buffet. \b Val tucks the flute back underneath his cloak and, still shaking his head a bit, wanders off to the north. With the mage's back turned to you, you carefully put out the fire before it can spread any further. Nv>>&!!Nv>   E >    Nv]You summon forth a great gout of fire to consume the white mage. From deep with the flames !> ! Lorekosi  the mageB laughs and the fires sputter out with trailing wisps of smoke. >   Nv>  E >   E >" NvYou rain fire down from the heavens. Lorekosi raises one hand upwards and summons forth a barrier as his eyes never leave the figure of Val.  Nv>  E >" E >" NvCNv>  E >" E >" NvC }Nv>  E >   E >" NvYou rain fire down from the heavens and upon the figures of the two mages. Only rhe faintest bit of smoke wisps up from the dark coat of Val and Lorekosi remains as ever untouched. Nv>  E >" NvHWith a wicked cackle you summon forth great gouts of flame to consume !<  . The flames lick greedily at !<  but not content with such a paltry meal, the fire stretches outwards to the newly waxed floor and catches within the dry wood of the tavern walls and timbers. \b Behind you some woman, either !>3 or the tavern maid, lets loose with a piercing high pitched scream. The drunkard awakens with a snort and nearly bowls you over in his sudden rush to leave the building. Tables, chairs, and benches are overturned in the chaos as the tavern denizens scramble to get out of the way. \b "FIRE!" some helpful person shouts and the stout tavern keeper is pushing past you with a basin full of washwater, as if such a thing could ever hope to stop the inferno now raging within the front room. \b You have to give credit to the old men, with more courage than sense, trying to beat at the edges of the flame with their ratty cloaks. And then one such cloak catches aflame within the hands of its owner setting the middle of the ceiling into fire. Everyone retreats in the face of the wall to wall blaze. \b All save for you. You stand in the midst of the inferno, watching the flames dance about in colors of blue, gold, and red. Observing the plumes of smoke drifting in thick pools across the room, first pale and then darker and darker as the building is consumed. Fire licks at the upper stairs, at the floor below, and the ceiling above, burning and burning and burning until there is nothing left to kindle. \b You stand amidst the ashen dark wreckage of what was once the tavern, your favorite place in all your domains. Oops. Nv">&Nv>  E> > E >" 2NvHWith a wicked cackle you summon forth great gouts of flame to consume !<  and burn away the intruding ofuda. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. You bask in the glow, in the warmth, as the fire eats away at its meal. \b And then in a shower of multicolored sparks the nearby tree catches aflame and then the next and the next. The albino trees that you labored so hard to create with their strange sweet smelling sap ignite like so much dried kindling. From branch to branch to fire leaps, until all around the trees are brimming with blossoms of flame. \b With a curse Val covers his face with his cloak and rushes out of the forest. Nv>!">&!>&WNv>  E> > E >" !NvHWith a wicked cackle you summon forth great gouts of flame to consume !< u and burn away the intruding ofuda. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. You bask in the glow, in the warmth, as the fire eats away at its meal. \b And then in a shower of multicolored sparks the nearby tree catches aflame and then the next and the next. The albino trees that you labored so hard to create with their strange sweet smelling sap ignite like so much dried kindling. From branch to branch to branch the fire leaps, until all around the trees are brimming with blossoms of flame. \b "Oh gods, my trees!" you yowl in pain as wreathes of smoke hang thickly in the air and petals of sparks rain down from the trees. "Do something!" you yell at Val. \b "Me? Do something?" says the mage as he looks all about him, at the forest all aflame from tips of blazing leaves down to the stony ground. "It's too late!" he coughs. "We have to get out of here!" he says as you steadfastly ignore him. \b "Hark! Snugglebums!" and Val finally grasps your shoulders and drags you bodily out of the forest towards the barren earth of the hills. \bNv">>!>&!>&Nv>  E >  E >" }NvRWith an inwardly wicked cackle you summon forth great gouts of flame to consume !<  amidst shrieks of surprise from your companions. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. And then the plumes of fire reach out arms towards the humans scattered about the courtyard. And towards you as well, lest you feel left out. "Great gods!" yells Old Coot. "Tis like the story where some fool caught the phoenix and it built up a nest and set everyone on--" the old man's story is cut off as he dashes inside the tavern. \b "I don't know if it's so wise to be running into a wooden building" Layna says as she backs away carefully from the flames. And with that the fire flares up once more and then collapses upon itself, embers dying away into ashes that flit away in the wind. \b "I don't suppose either of you dropped your pipe in the straw?" Layna says dryly as she wanders over to the horse trough and washes her arms, all the while still eyeing the remnants of the blaze. \b "A welcoming gift from the fey, I would think," says Val. "Its power extends all the way here?" says Layna as she purses her mouth. \b "To the edges of the courtyard, most probably," you assure her. And quietly behind you the ash falls away from !< % leaving it as it was once before. Nv>"^ Nw>  E >  E >" E >  =NwRWith an inwardly wicked cackle you summon forth great gouts of flame to consume !< k amidst shrieks of surprise from Layna. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. And then the plumes of fire reach out arms towards the humans scattered about the courtyard. And towards you as well, lest you feel left out, burning higher, brighter... "It's going to set the tavern on fire!" Layna yells out. \b She's wrong, you would never let something so foolish happen to your tavern. But she would have no way of knowing this, nor Val either, who seems to have taken her warning seriously. The young man edges over to the horse trough, dips his fingers into the water, and flings the droplets towards the blaze. \b Only they are droplets no longer, but a slender stream of water that rains down upon the fire, quenching it with a bubbling hiss. Both you and Layna stare at the pale haired stranger. \b "A mage," Layna says. "You are a--" and color drains from her face. \b "I do know a bit of magic," Val says simply as he gazes at the girl. And all your attention has turned upon him. \b "A bit too much for my comfort." says Layna. "I have no wish to be involved in such a few hunt. Good day to both of you. " The maiden hitches her divided skirts close to herself and half runs to the tavern. \b "More afraid of me than of the fey," Val muses, his tone dry. \b "I can't say I blame her," you reply and Val turns to you with a half smile. \b "And yet you won't run away?" he says, not truly asking. "Shall we be off then?" and Val pulls his satchel across his shoulders and sets off for the northwest. And quietly behind you the ash falls away from !< % leaving it as it was once before. Nw>>"!">&Nw>  E >  (NwYou summon forth great gouts of flame to burn and consume the mage. With a roar the arms of the blaze reach out towards Val, yet they slow and stop a mere handspan from him, dark smoke hanging thickly, glowing tendrils licking forward, yet unable to touch him.>Nw>  E >"" 9Nw*That would give away the game too soon. GN!w,It seems such a shame to ruin such a good !<. MO actorN2)wMO actorN2*wThat would require an expansive amount of energy and draw far too much attention. Although the image of it is rather amusing. MO actorN{3,wIMO actorN3.w*That would draw far too much attention. /5MN_<>NaOn <  %you% see%s% . Nb4NeThere's nothing on < . NfNgMO actorNh^:MOactordobjNkNl+MO actorNm3MO actorN@p< >N@qOn !<  %you% see%s% !. 0N@sThere's nothing on !< . N@t0  .*/MN  out ofMO actorNSuMN1%You're% not going anywhere until %you% get%s% !< !< . N!N&MO actorN<&MO actorN<fMO actorNJ  5NJ%You're% already on < ! NJNJdMO actorN Okay, %you're% now sitting on < . NN/MO actorN <N /MO actorNU<NU10 bed on out offMO actorNHOkay, %you're% now lying on !< .NHNH2= MO objNx!tlMOtstpropOElistiobjtotNZx<NZx NZxNZx<@NZxNZxNZx2"NZxNZx<NZxkNZxNZxKNZx! &NZx(NZxNZxNZx4)MN?uC<`BMO actorN;BuBut !< is right here! MO actorNDu>MO actorNEuThat thought is unacceptable!5476YMO actorN JuZrMO actorN/KuSSetting random people alight inside the tavern may raise suspicions. Just a bit. DMOactorioNMu That would cause quite ruckus!MO actorNOuEMO actorNPu&There is no slavery in these lands. MO actorN`RuKMO actorNSu,That's usually reserved for dead mortals. dMO actorNUueMO actorNVuHiding a whole human in your !> feathers cloak is a bit beyond your power. MO actorNXuMO actorNYu>5" 2NZu#That would reveal your presence. fN\uDThe edges of space fray at your touch as you reach forth, calling !<  to you. > <XMO actorNt^uMO actorN_u>5" 2N`u#That would reveal your presence. NbuYour power washes over you, tumbling, surging, crescendoing... and then finally fading away as you fail to give it shape or form. MO actorNeu<MO actorNfuBut they are already awake!5,   *6$+ZMO actorO waslitN/xu N/yu"-N/zu"N/{u%You% light !< N/|u E?N/}u, lighting the area.\bN/~u N/u.7.087MO actorN! 1MO actorNE <  6NE There's nothing under !< . fNE <! ;NE There's nothing else under !< . NE <<.NE 97MO actorN! 2MO actorNE <  7NE! There's nothing behind !< . gNE" <! <NE# There's nothing else behind !< . NE% <<.NE& :-+MO actorN!u3MO actorNEu"NEu<  *There's nothing in !< . ZNEu<! /There's nothing else in !< . NEu<<.;5MO actorN 5,MO actorN= <N= MN <N <86(MO actorN v!<yMO actorNGvzMO actorNkvRFor a moment you wonder what insanity has possessed you to try and drink <  =    .:; <MN  < N + can be turned to settings numbered from !<: to !<;. \^!< currently set to !<<. N MO actorN =*MO actorN -?N #MOactorioN7 >MOactorioN`  +N` ><:D ><; 3N` There's no such setting! N` N` ><< gN` ><N` Okay, !< now turned to N` <<. N` MN` \^!< already set to N` <<! N` N` KN` I don't know how to turn < N`  to that. N` N` ?`    to@.?MO actorN @MO actorN= <--N= Okay, <  !<} now switched N= <-N= onN= offN= . N= MO actorN  E ~"N It's pitch black.AN <-1N \^!< already turned on! N ,\MO actorN "-N Okay, !< now turned on. N _MO actorN <-2N \^!< already turned off! N A]MO actorNV !-NV Okay, !< now turned off. NV A1MO verbosityNu<)NuYou feel the earth striving to press closer from above, below, and all sides. But in the surrounding gloom there is a sense of space. MOvNu<D \ "NuYou feel the earth striving to press closer from above, below, and all sides. But in the surrounding darkness there is a sense of space. \n!C\ D>sDMO objNyL"E Ny"! MO actorO clistNsy<NsyCs<tNsy>5" NsyNsy INs y\b\^!< !<} clad in !. GNs y\b\^!< !<} naked as the day is long. SMOactorioNu y/That would cause quite a ruckus to give away!#MOactorioNy4MOactorioNy?<MMOvdpiN1y, E  E a  <**9MNy\^!<  isn't saying anything!c2MNy\^!<  looks confused.@MNy\^!<  looks just like !<,.BMO actorI don't know how to look in !< .+*MO actorNy How rude!eHMOactordobjNy\^!<  doesn't want it.MO actorNy>MO actorN+yThat thought is unacceptable!5476EWFHH H HDMN <jkNMN  <j  !<j} no longer here. N ,MOvdpiN <*MMN j`MO actorN l7MO actorN <j N #MOavipNC G UNC \^!<j  !<j} no longer here.NC *NC NC "pMOavdpN \^!<j  !<j} no longer here.N *N G|000 Follow the leader!Hiiyiyi} are5~MNM<>" fNN<ZYou are in your human form. A tall, but not too tall, male with creamy pale skin and dark hair that has been artfully tousled. A pretty face, but not so perfectly pretty as to bring down suspicion. Your eyes could be called gold upon closer inspection; you have dimmed their color over the years lest they bring down too much attention. NP<>  lNQ<]\b Somewhat ruining this impression is a shadow dog with teeth clamped tightly to your leg.NS<>5" _NT<PYou are nothing but a shadow, formless, shapeless, and without any substance. NV<>" E >" GNY<8You are in your raven form. A middling-large specimen with perfectly preened, glossy plummage that shimmers with rainbow iridescence in the light. Your talons are sharp, your beak powerful and long, and your sleek dark feathers flare out at your neck and taper to a wedge in your tail. \b The only thing that would give you away is your eyes, far too intelligent even for a raven and with a deep golden glint to them instead of the depthless black of normal birds. Well, that and your feathers have a distinctly rainbow tint since your bath in the rainbow fountain. N\<>" N`<You are in your raven form. A middling-large specimen with perfectly preened, glossy black plummage that shimmers with iridescence in the light. Your talons are sharp, your beak powerful and long, and your sleek dark feathers flare out at your neck and taper to a wedge in your tail. \b The only thing that would give you away is your eyes, far too intelligent even for a raven and with a deep golden glint to them instead of the depthless black of normal birds.Nb<>" Nf<You are in your dragon form. An elegance of shape in sweeping curves of shadow and glittering points, from the graceful tip of your muzzle, through your sinewey neck and tail, to the farthest arch of your tautly stretched wings. Dark jeweled scales cover every fingerswidth of you, leaving bare only your brilliant gold eyes. \b In this form you are the beautiful death that reigns through sweet nightmares. ''MO actorNi<mMO actorNj<NYou drop down upon the ground for a moment before raising yourself up again.IMOactorioNY l<You lean against ! . IMOactorioN n<You lean against ! . MO actorN o<UMO actorN p<6That's something usually reserved for dead mortals. MO actorNv q<LMO actorN r<-You are not giving yourself away for free! LO actorN s<NO actorN t<You couldn't, even if you really wanted to. You have no true need for air and could drink in an entire ocean before drowning. YMO actorN u<ZMO actorN v<As amusing as it would be to see the faces of the others if you suddenly set yourself alight, that would well and truly destroy your disguise.MO actorN w<<MO actorN x<You already have yourself. MO actorN y<4`MO actorN z<AYou peer inside yourself and find... a desire? A desire for... MO actorN~ {<=MO actorN }<>  E >" E >" N ~<&You twirl about the tavern floor. \^!>D stretches and cackles. "Y' looking fer a dance partner?" he asks.DN <>  E >" E >" QN <BYou launch yourself into the air and circle around the rafters. N <> > E >" |N <mYou turn about before Val. The young seeming mage watches you and finally says, "As good coming, as going."+N <>  <N <-You walk around a nearby heavy limbed tree.N <>  :N <+You twirl about a flower bedecked column.N <> m E >" ;N <,You walk a perfect circle around the lake.3N <>   ON <@You spin about, gazing upwards towards the sea of butterflies.N <>  nN <_You circle around the fountain, admiring its rainbow splendour from several different angles.NN <>  E >" YN <JYou pace round and round between the red arch and the cleft mirror hill.N <>  E >" 8N <)You pace about in front of the tavern. N <>" AN <2You fly around in a careful circle of the area. ,N <> b BN <3You wander in circles around the darkened caves. N <> c <N <-You walk a perfect circle around the lake. N <> d pN <dYou reach out trail a hand across the cool stone walls as you walk about the edge of the chamber. MO actorN<PMO actorN<>  E >" E >" wN<You stand, casually brush yourself off, and then do a perfect flip, leaping head over heels to land lightly on your feet. The other tavern patrons goggle at you.\b "Now that's quite dandy," says !>F. "My nieces and nephews would love to see that! Just like that there tumblers in their bedtime stories." The other old man claps enthusiastically. N<> > E >" N<Ahead of you, Val is immersed in his magery, mucking about with your territory while patently ignoring you. How irksome. \b Suddenly you do a perfect somersault, brushing right past Val and nearly taking off his head in the process. The strange mage barely leaps back in time and looks at you askance as you casually brush yourself off as if nothing of any particular interest had happened.\b "Well... I'm quite glad to find you so flexible!" Val finally says.N<>" BN<3You do a perfect flying loop de loop in the air. IN<=On a whim you twist about and flip neatly head over heels. EMO actorN)<F|MO actorNM<]You plop yourself down upon the floor and decide that there are much better places to sit. GMO actorN<H_MO actorN<@For a moment you rest upon the floor before popping up again. LMO actorNX<NOMO actorN|<0Maybe when you're in a more masochistic mood. MO actorN<MO actorN<vIf this life were a dream, there is only one way to wake up. And if that is so, then you are in no hurry to awaken! MO actorN<OMO actorN<0That would require quite a bit of contortion. JKLNPLQNLNRLSNMO actorNy<MO actorN<>" E >" JN<;You brush a hand across the soft fabric of your clothes. 3N<>" E >" N<You brush a hand across the soft surface of your human skin. Pretty but rather fragile. Or it would be if it was true human skin. N<>" -N<The soft brush of feathers. DN<>" 0N<$Your scales are smooth and tough. MO actorNP<FMO actorNt<'You smile enigmatically to yourself. [MO actorN<\WMO actorN<8Ouch! Well at least you know that this isn't a dream. MO actorNA<6MO actorNe<You howl mournfully. MO actorN<BMO actorN<#You whistle happily to yourself. MO actorN <@MO actorN1<!You merrily laugh at yourself. 3MO actorNw<2>MO actorN<If only it were that simple. MO actorN<sMO actorN <> > E >" E>  > N <nYou draw forth your power and for the moment the world around you ripples into shields between you and Val. >N <> >  E >" N <You draw forth your power and for the moment the world around you ripples into shields between you and the white mage. Yet the barriers seem to bleed away, fading around the figure of the mage. >  N <You draw forth your power and the world around you ripples into shields surrounding you. Hmmm... perhaps that was a bit of overkill... MO actorN|"<NMO actorN"<You !<@ to !< . sing a little ditty lilt out a love songcroon a soft lullabye chant an ancient lament !warble out a high pitched tune %sing about a bird in a gilded cage *MOactorioN#<FEE!)MOactorioN#<FI!%MO actorN$<FOO!MOactordobjN0$<" ?N0$<0Maybe when you're in a more masochistic mood. N0$<!yMO actorN$<+MO actorN$<$You spank yourself for being bad. N$<>  E >" WN$<2The others goggle at you. \b "Too much liquor," !>F mutters. N$<> > $<O\b"Val stares at you for a moment. "Need some help there?" he casually asks. dMO actorN&<eMO actorN3&<>  E >" AN3&<2You fade unseen into the shadows of the tavern. ^N3&<>  hN3&<YYou look stealthily about the courtyard before crouching down behind the apple barrel. N3&<>  YN3&<JYou quickly slip behind a tree and beyond the sight of any prying eyes. uN3&=>  N3&=You slip in amongst the twinery of metal and glass, careful of the faintest of brushings, lest you accidentally skin yourself. N3&=> m N3&=You look about the shores for a suitable place to hide, yet outside of diving into the lake itself, there are no secret places to be found. You finally settle upon skulking behind the tiny bonsai trees that forest the lakeshores. N3&=>   N3&=You stalk out into the sea of wavering grass and flop over amongst the blades. The stalks rise high above your resting head, sealing you completely out of sight. N3&=> > ~N3&=o\b Val watches your actions with a soft chuckle. "Should I start counting to give you a head start?" he asks.NN3&=>  ZN3& =KYou press your back against a flowered column and peer cautiously about. N3& =>  IN3& =:You duck behind the rolling curve of a smooth red hill. N3& => b D > d D > c SN3& =GYou fade unseen into the shadows of that fill the caverns and caves. MO actorN+=>MO actorN,=You coo happily to yourself. MO actorNS,=LMO actorNw,=-You refuse to surrender, even to yourself. MO actorN,=5MO actorN,=You squawk noisily. MO actorN(-=NMO actorNL-=/Perhaps try braiding your hair, if you wish. MO actorN-= GMO actorN-=(You accept yourself for what you are. MO actorN.=8MO actorN5.=You preen to yourself.  MO actorNs.= ;MO actorN.=You skulk about skulkily.  MO actorN.= MO actorN.=oAfter you spent so much time getting your forms perfect? It takes quite a while to fully master a new shape! MO actorN/=MO actorO/foofwearitN/"=>N/#=N/$=!N/%=iN/&=+N/'="N/(="N/)=-N/*=N/+=N/,=N/-="")N/.=)oMO actorN04=pKMO actorN05=There's nothing wrong with !<. MO actorN?16=MO actorNc18=>" 5Nc19=&You wrap your arms around yourself. 3Nc1;='You wrap your wings around yourself. MO actorN1<=NMO actorN2== You are rather fond of !<. #MOactorioNn2>=_MOactorioN2@= N2A=yYou draw forth your power and the world around you ripples into shields surrounding you as you defend yourself against ! .>N2B=  N2C=YYou draw forth your power and the world around you ripples into shields between you and! Z. Yet your barriers seem to bleed away, dissolving around the figure of the white mage. >  N2E=yYou draw forth your power and the world around you ripples into shields surrounding you as you defend yourself against ! .MO actorN4F=RMOactordobjN 5H=You defend yourself against !< .,MO actorNx5I=-MO actorN5J=\^!<V smells of flowers and greenery, perhaps from your recent walk through the meadows. MO actorN&6K=sMO actorNJ6L=TYou lovingly kiss yourself. Perhaps next time you might try kissing someone else? MO actorN6M=[MO actorN6N=<You really would rather do this with someone else. MO actorNH7O=kMO actorNl7P=LWere you sold when you weren't looking? You have no need to buy yourself. aMO actorN7Q=bMMO actorN8R=.Try feeding the food to your mouth instead. MO actorNT8S=,MO actorNx8U=>5" ENx8V=6That would require a physical body clad in clothes. ,Nx8W=>" Nx8X=As ravens aren't normally known for their attire, you have nothing to take off. You could pluck yourself of feathers, but the thought seems rather painful. D+Nx8Y=>" =Nx8Z=.Now is most certainly not the time for that!*Nx8[=>" =Nx8\=.You're already as naked as the day is long! *Nx8^=>  E >" NNx8a=\n With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. \b There comes a great sound of crashing cutlery behind you as the tavern maid walks back into the front room and yelps in surprise. \^!> gives a squawk of dismay and covers her eyes, although you notice she's left enough room between her fingers to peek through. \b \^!>X gives hoot of delight and shouts "Take it all off!"\b "I think he already has," says !>F  as he sips calmly at his drink. "That's a fine figure you have there, son. " \b "What the hell is going on?!" roars the tavern keeper as she comes thundering into the center of the room. "This is no peepshow!" and you are unceremoniously thrown out on your bum. \bNx8e=>9'Nx8g=> > E >  Nx8h=Alas with the shrill song of the flute shivering through every fiber of your being, you find that you lack the power required to remove your clothes. n&Nx8k=>  E >" CNx8q=\n With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. \b Val has been so entranced with watching you that he has tread upon the patterns drawn in the sands. The young seeming mage looks distractedly upon the ground. \b "I was doing... something..." he tilts and then shakes his head with a shrug. Then, continually casting glances over his shoulder at you, Val begins to head towards the forest to the southeast. !>&>"">& $Nx8s=>  E >  E >  E >"  Nx8v=With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. \b \^!>S gawks openly at you and then claps her hands over her eyes with a deep blush. \^!> grins wickedly at you as !> gives a hoot of delight. \b "You plannin' on actin' as bait to lure out the fey? " cackles the old man. \b "When I said we should divest ourselves of all unnecessary objects this wasn't quite what I had in mind... although I suddenly see the merits of--" says !>3. \b "Oh for god's sake, put on your clothes! " !> chokes out.\b Well, it is quite breezy out here for running about in the buff. As a human anyway, as they have no hair nor feathers nor scales to protect them. As for the nigh identical glints in the young and old man's eyes--\b "Y' better do as the lady says, lad." says the older man. "Wouldn't want t' give her a case o' apoplexy. " \b "She is turning a rather alarming shade of red," !>U agrees. \b "Be quiet you two, you don't understand with being men and all. " says !>. "What if I decided to strip and prance around stark naked too?!" \b "Bless me, the idea o' this adventure just keeps getting better and better! " and !>q chortles so loudly that he begins to choke. \b "Maybe you are the one we need to worry about, old man, " says !>W. "Can your heart take all of this? " \b "For the love of god, PUT ON YOUR CLOTHES!" !> half squeals. \b You have no particular love of god, but you look from the choking old man, to the squawking woman, to the young man grinning at you even more wickedly then he was a moment ago, and you decide to shrug back into your clothes. \^ !>\ gives a small 'tsk'. \b "There, there," he soothes. "He's all fully clothed again." \b \^!> looks suspiciously at all of you. "I don't know if I should be traipsing off with you people. " \b "What? Don't we seem trustworthy enough?" asks !> innocently. \b \^!> lets out another huge guffaw resulting in an even more violent coughing fit. "Oh gods, it's too much," the old man chokes out as he scrubs at his eyes. "I'm going to go lie down for awhile. " and choking & wheezing, !> waves gaily at you as he goes back into the tavern. \b One down, two to go. \b "I suppose we could start off without him," says !> as he and !>' return to their respective packing. Nx8=>!"Nx8=>  E >  E >  E >"  Nx8=\n With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. \b \^!>U gawks openly at you and then claps her hands over her eyes with a deep blush as \^!>\ grins wickedly at you. \b "I am suddenly overwhelmed with enthusiasm for this trip,"says !>3. \b "Oh for god's sake, put on your clothes! " !> chokes out. \b Well, it is quite breezy out here for running about in the buff. As a human anyway, as they have no hair nor feathers nor scales to protect them...\b "She's turning a rather alarming shade of red," !> remarks as he gazes idly between you and the young woman. \b "Be quiet, you wouldn't understand with being a man and all. " says !>u. "What if I decided to strip and prance around stark naked too?!" \b "Far be it for me to try and stop you," says !>X as his grin widens. "Just as long as he is prancing around naked too..." \b \^!>& looks suspiciously between you and !>. "I don't know if I should be traipsing off with you people. " she says. \b You begin to agree with the girl as you look suspiciously at !>X who has yet to take his eyes off you. You decide to shrug back into your clothes. \^ !> gives a small 'tsk'. The wind suddenly kicks up, tearing your tunic away from your grasp, and blowing it up over the tavern rooftop. \b Val holds out his hand and the fluttering shirt suddenly curves about, turning back against the wind and obediently leaping into his grasp. He walks over to you and hands the tunic back with a small bow as you stare at him. \b You are not the only one. \b "You're a mage" Layna says, and her tone is half accusing. Val turns and bows slightly to her as well. \b The maiden swallows hard and visibly pales. Then she turns and, of all people, stares at you suspiciously! Not that her suspicions are unwarranted, but of the many things you could be accused of, being a mage is assuredly not one of them! \b \^!>R is still looking between you and the pale haired young man. "Far be it from me to interrupt you two! " she says and marches back into the tavern. \b And then there was one. \b Next to you, Val laughs softly, dryly. "I do believe she's more affrighted of me now, then she was of the fey!"\b "That sounds about right to me," you reply. Nx8=>!"!"Nx8=>  E >"  Nx8=\n With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. \b Val gazes wistfully at you, the sunrays falling in between the trees collecting within pinpricks of light within his eyes. \b \t "And so the lord of the skies \n \t of the stars and the moon \n \t descended to earth \n \t to bathe in the noon. \n \t And in the shadows of the forest \n \t in the dancing of the light \n \t came the hunter to this clearing \n \t to behold such a sight. \n \t Pale as lilies was his skin \n \t with hair as dark as night \n \t the sun in his eyes \n \t lay bare of all samite. \n \t Such a vision that was seen \n \t beyond what mortal eyes may know \n \t Innocence fails as a shield \n \t beneath the power of this blow \n \t The hunter was struck dumb \n \t as in fury the great lord turned \n \t A thousand baying hounds \n \t with hatred in their eyes burned \n \t And so the price was gladly paid \n \t that day the earth met the sky \n \t for such a taste of eternity \n \t only will I surrender and die."\b And suddenly the sutras slip away from the trees, fluttering softly to the ground below. Val watches the slips of paper fall with some surprise and then laughs softly. "I really must work on that," he says. \b Beneath your gaze the papers crisp and fall away to nothing before they touch the ground. Val watches you for a long moment before turning away and walking to the east. >""!>&! Nx8=>  E >" cNx8=\n With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. \b The chant has come to a sputtering halt as Val's lips are too busy smirking at you to be singing. The young seeming mage manages, with some difficulty, to pull his gaze from you and look distractedly around at the surrounding red hills. \b "I believe I was doing something... although suddenly it has slipped my mind..." he says. \b "You were torturing me with your abominable singing, " you retort. \b "Oh, was I? " asks Val. "And then you decided to strip down? I need to sing more often then! " he exclaims and then laughs. The wind blows just then, kicking up clouds of red dust, and Val begins to choke while you stare down at him. Val catches a look at your expression and begins to laugh-- and choke-- all the harder. \b "Shall we go to someplace more hospitable?" the mage finally asks and, with many backwards glances to see if you are following, he starts off towards the north. >"">9&"9>&Nx8=>  E >" \Nx8=With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. \b"And are you planning on taking a dip in the fountain...?" the mage's words trail away as he gazes at you. Val drives his shovel deep into the earth and leaves it standing there as he leans against it. "You know, you're quite a sight, standing there like that with the water catching rainbows all around you. " \b [INSERT SOME SORT OF CONVERSATION HERE THAT WILL END WITH VAL LEAVING]m>"">9&!9Nx8=> > Nx8>\n With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. \b Val watches your every movement with a grin blossoming upon his face. He eyes you from head to heel. "Well..." he clears his throat. "Well, you've certainly gained my attention. Dare I hope for some greater meaning to this? " \b INSERT CONVERSATION STARTER HERE \b ""Nx8>>" Nx8>\n With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. "();MN>>  E >  N >(<(KN >N >N >N >N>N>N>N>N>N>N>QThrough the dying wind the trilling notes of the flute come to you once again. "C)"'A[u+MN>> > E >" E >" N>(<(KN>N>N>N>N>N>N>N >N!>~N">N'>=Suddenly over a distant rise Layna appears with the Old Coot in tow. They begin to walk down towards you, stop short in their tracks, and then do a doubletake between you and Val. \b "Err, are we interupting something?" Layna asks, blushing, as she turns her head up and to the side, gazing at the sky with great concentration. The Old Coot merely cackles his head off. \b Before you or Val can say anything in reply, the maiden grabs hold of the old man's arm and begins dragging him away. "Let's search over here!" she says as they disappear over the ridge once again. C)"C]wIDDDD.:MN\^!< !< important.#MOavipNY+ HNY\^!<  !< important.NY*NYNY"cMOavdpN\^!<  !< important.N*NJ2#MOavipNu, E - E + E  E  E  E  E { "\^That is beyond your power.*"7MOavdpNu<#K<:::.MO actorNL;XMO actorN>w>5" 1N?w%That would require a physical body.MO actorO }listNBwCs>tNCw +NDw> <&>"NEw<m)qMOactorioNHw>5" 4NIw%That would require a physical body.NJw<m)qMOactorioNKw>5" 4NLw%That would require a physical body.NNw<m)qMOactorioNPw>5" 4NQw%That would require a physical body.NRw<m) qMOactorioNuTw>5" 4NuUw%That would require a physical body.NuVw<m) qMOactorioNXw>5" 4NYw%That would require a physical body.NZw<m)lMO actorNc[w>5" 4Nc\w%That would require a physical body.Nc]w<m)MO actorN_w>5" 4N`w%That would require a physical body.uNbw<E <cwYou look about for !< / forgetting that you are already wearing it. nMO actorNfw<  gNgw(First taking !< )\nNhwMI  Niw<   Njw*Nkw!<Nlw""!XMO actorNmpw>5" 1Nmqw%That would require a physical body.oCMO actorO listNuwCs>tNvw 0Nww!<>"!Nxw<D <Nyw:In a sudden fit of absentmindedness you try to take off !< 5 which you hadn't been wearing in the first place. N{w!<!!MO actorNw>" ICYou shouldn't overburden yourself with items while in this form. oNw>5" 4Nw%That would require a physical body.)Nw< <Nw)MXNfO6MO actorNu<|&\^!< already open. ;Nu<r*NuYou open the !<. "<tRMO actorNu<~! !Nu Unlocked. !<wNu-PPd""" withQ$"""O|rRHG G G5*MN &MO actorN=<&MO actorNi<MO actorN   GN"%You're% already !< !< ! N#UN$~AN&%You%'ll have to drop !<  first!N'N(kMO actorNf+Okay, %you're% now !< !< . Nf,&Nf-uMN01%You're% not going anywhere until %you% get%s% !< !< . N2!N3YMN5< MO actorNm7GNm8%You%'ll have to get !< !<  first.Nm:)Nm;#MOavipN>E + E S E T XNA%You%'ll have to get !< !<  first. NC*NDNE"MOavdpNHE U XNJ%You%'ll have to get !< !<  first. NL*NMNNSX_TXUXV/W  5 |MN<E< >NIn <  %you% see%s% . N4NThere's nothing in < . NNMO actorN_MOactordobjN< < HN%You% can't fit ! in < . N NNNMO actorN4/MO actorN<3N+MO actorN3MO actorN&<E< >N&In !<  %you% see%s% !. 0N&There's nothing in !< . N&X  5MN"MN<E< >NIn <  %you% see%s% . N4NThere's nothing in < . NNmMO objN<E<|;N%You% will have to open !<  first. NxAMO actorNM"|NM Opened. NMMO actorN4&MO actorN<3+MO actorN3MO actorN<E< >NIn !<  %you% see%s% !. 0NThere's nothing in !< . NY5{lMO actorNu<rINu=You jingle the lock to make certain it has caught properly.bMO actorNu<r>Nu You open !<  to reveal !. rMOactorioNu<rJNu>You jingle the lock to make certain it has caught properly. gMOactorioNku<r>Nku You open !<  to reveal !. Z/#MOactorioNuMOactorioNBu<~ KNBuYou close and lock <  NBu!|NBu"rBNBu\^! !n't fit the lock. #MOactorioNuMOactorioN(u<~ aN(uYou open and unlock <  to reveal . N(u"|N(u!rBN(u\^! !n't fit the lock. [5MO actorN~:MOactordobjN=N=MO actorN}:MOactordobjNN\dccc5MO actorN#MO actorN=<]D; ; ;MN!<,  a number (MN the number !<MOactorio>MOactorioN"Tap, tap, tap, tap..." MO actorN1MOactordobjN>^,"*"*"*"<MO actorNwMO actorN=w<;N=wYou have failed to be saved. N=w!"N=w Saved. N=w"MO actorNwrMO actorNw<NwAYou decide to take notes of your actions for future reference. MO actorNawMO actorNw>  E> > E >! E>  ABRACADABRA Nw"Abra Ca Dabra!" you say.\b "Open Sesame!" Val responds.\b Suddenly the red archway begins to shimmer and the grounds beyond fade away to be replaced by a glimmering curtain of light."vNw>  E> XYZZY NwC.Nw> XYZZY ^NwOFor a moment a fit of madness makes you consider speaking your name outloud. Nw>  E> > E >! E> ABRA CA DABRA Nw"Abra Ca Dabra!" you say.\b "Open Sesame!" Val responds.\b Suddenly the red archway begins to shimmer and the grounds beyond fade away to be replaced by a glimmering curtain of light."Nw> > E >  E >" E>  ABRACADABRA Nw"Abra Ca Dabra!"you say.\b "Open Sesame!" Val responds.\b Suddenly the light in the archway dies away and the far grounds fade back into view.!Nw> > E >  E >" E> ABRA CA DABRA Nw"Abra Ca Dabra!"you say.\b "Open Sesame!" Val responds.\b Suddenly the light in the archway dies away and the far grounds fade back into view.!Nw>  E>  ABRACADABRA Nwv"Abra Ca Dabra!"you say and look around expectantly. For a moment you feel a twisting and then-- nay, it fades away.Nw>  E> ABRA CA DABRA Nwv"Abra Ca Dabra!"you say and look around expectantly. For a moment you feel a twisting and then-- nay, it fades away.DNw> > E>  ABRACADABRA Nwz"Abra Ca Dabra!"you say.\b "Open sesame!" Val responds.\b You both look around expectantly but nothing seems to happen.  Nw> > E> ABRA CA DABRA Nwz"Abra Ca Dabra!"you say.\b "Open sesame!" Val responds.\b You both look around expectantly but nothing seems to happen.  Nw>  E>  ABRACADABRA E >" Nw"Abra ca dabra!" you suddenly say. For a moment there is silence as the other tavern occupants stare at you as if you've gone quite daft before turning back to their own conversations. Nw>  E> ABRA CA DABRA E >" Nw"Abra ca dabra!" you suddenly say. For a moment there is silence as the other tavern occupants stare at you as if you've gone quite daft before turning back to their own conversations. Nw>  ABRACADABRA cNwT"Abra ca dabra!" you say. You look around expectantly but nothing seems to happen.: Nw> ABRA CA DABRA cNwT"Abra ca dabra!" you say. You look around expectantly but nothing seems to happen. Nw> > E >  E>  OPENSESAME Nw"Open Sesame!" you say.\b "Abra Ca Dabra!" Val responds.\b Suddenly the red archway begins to shimmer and the grounds beyond fade away to be replaced by a glimmering curtain of light."Nw> > E >  E>  OPEN SESAME Nw"Open Sesame!" you say.\b "Abra Ca Dabra!" Val responds.\b Suddenly the red archway begins to shimmer and the grounds beyond fade away to be replaced by a glimmering curtain of light."Nw> > E >  E >" E>  OPENSESAME Nw"Open Sesame!" you say.\b "Abra Ca Dabra!" Val responds.\b Suddenly the light in the archway dies away and the far grounds fade back into view.!Nw> > E >  E >" E>  OPEN SESAME Nw"Open Sesame!" you say.\b "Abra Ca Dabra!" Val responds.\b Suddenly the light in the archway dies away and the far grounds fade back into view.!Nw>  E>  OPENSESAME Nwu"Open sesame!" you say and look around expectantly. For a moment you feel a twisting and then-- nay, it fades away.Nw>  E>  OPEN SESAME Nwu"Open sesame!" you say and look around expectantly. For a moment you feel a twisting and then-- nay, it fades away.GNw> > E>  OPENSESAME Nw{"Open Sesame!" you say.\b "Abra Ca Dabra!" Val responds.\b You both look around expectantly but nothing seems to happen. Nw> > E>  OPEN SESAME Nw{"Open Sesame!" you say.\b "Abra Ca Dabra!" Val responds.\b You both look around expectantly but nothing seems to happen. Nw>  E>  OPENSESAME E >" Nw"Open Sesame!" you suddenly say. For a moment there is silence as the other tavern occupants stare at you as if you've gone quite daft before turning back to their own conversations. Nw>  E>  OPEN SESAME E >" Nw"Open Sesame!" you suddenly say. For a moment there is silence as the other tavern occupants stare at you as if you've gone quite daft before turning back to their own conversations. Nw>  OPENSESAME bNwS"Open Sesame!" you say. You look around expectantly but nothing seems to happen. ENw"\^!<%" you say to no one in particular. JMO actorN/wICMO actorNSw"\^!<!" you shout. LMO actorNwKLMO actorNw"\^!<!" you whisper softly. 7MOactorioNw>5" NwtWhile it would be amusing to see the reactions of the tavern denizens if a disembodied voice starting speaking to ! r, that would destroy the deception you worked so hard to create-- that the tavern is free of all fey influence.  Nw>  E> XYZZY E  NwCNx> XYZZY E  NxFor a moment a fit of madness actually makes you consider blabbing your true name to the mage! There are far more pleasant ways to die...Nx> XYZZY aNxRFor a moment a fit of madness makes you consider tell the world your true name. yNx"\^!<" you say to ! . Unsurprisingly, ! has no response to that. MOactorioNO x"\^!<" you say to !. Unsurprisingly, !  has no response to that. MO actorN x"\^!<" you say to !< . Unsurprisingly, !< has no response to that. MOactordobjNr x"\^!<" you say to ! . Unsurprisingly, ! has no response to that. MOactorioN x>5" N xtWhile it would be amusing to see the reactions of the tavern denizens if a disembodied voice starting speaking to ! r, that would destroy the deception you worked so hard to create-- that the tavern is free of all fey influence. }N x"\^!<" you whisper to ! . Unsurprisingly, ! has no response to that. MOactorioNx"\^!<" you whisper to !. Unsurprisingly, !  has no response to that. MO actorNVx"\^!<" you whisper to !< . Unsurprisingly, !< has no response to that. MOactordobjNx"\^!<" you whisper to ! . Unsurprisingly, ! has no response to that. MOactorioNx>5" NxtWhile it would be amusing to see the reactions of the tavern denizens if a disembodied voice starting speaking to ! r, that would destroy the deception you worked so hard to create-- that the tavern is free of all fey influence. iNx"\^!<" you yell at ! ,, which remains silent at your onslaught. VMOactorioN! x"!<" you say to ! . NMO actorN{!!x"!<" you say to !< . XMOactordobjN!#x"!<" you say to ! . _8555BMOactorobjseqnoNTNU MOactorprepiobjO_retlocN}[ N}\ N}] N}^$$>N}`N}aBMOactorobjseqnoNdNe!9OactorprepdobjMN^g<  IMOactorprepioNi Nj DMOactorprepNm Nn`_\adb555n.10 a|cHP jumpvMO actorN%[>  E >" N%[You leap elegantly about the tavern as the other patrons gawk at you. \b "Had some o' them jumping beans, eh?" asks one of the old men. N%[> > IN%[:You take a joyful leap as Val watches you in amusement. KN%[?You take a joyful leap, springing elegantly through the air. .1hPGJ|drrr //You drop to the ground and do a quick pushup..!P ax?x2ef|QgXh`ijd""" froml|_m|n`    inod!!! offpd!!! outqAAA_ plugn.nr|s_t_uH turnpMO actorN%d>5" 5N%d&That would require a physical body. N%d>  E >" E >" N%d&You twirl about the tavern floor. \^!>D stretches and cackles. "Y' looking fer a dance partner?" he asks.fN%d>  E >" E >" QN%dBYou launch yourself into the air and circle around the rafters. N%d> > E >" |N%dmYou turn about before Val. The young seeming mage watches you and finally says, "As good coming, as going."MN%d>  <N%d-You walk around a nearby heavy limbed tree.N%d>  :N%d+You twirl about a flower bedecked column.N%d> m E >" ;N%d,You walk a perfect circle around the lake.UN%d>   ON%d@You spin about, gazing upwards towards the sea of butterflies.N%d>  nN%d_You circle around the fountain, admiring its rainbow splendour from several different angles.pN%d>  E >" YN%dJYou pace round and round between the red arch and the cleft mirror hill.N%d>  E >" 8N%d)You pace about in front of the tavern. N%d>" AN%d2You fly around in a careful circle of the area. NN%d> b BN%d3You wander in circles around the darkened caves. N%d> c <N%d-You walk a perfect circle around the lake. N%d> d N%dYou reach out to trail a !> wing handJ across the cool stone walls as you walk about the edge of the chamber. .1?> axPx2=vKKKn switch.!PGJ|Pw flipMO actorN%d>5" 5N%d&That would require a physical body. =N%d>  E >" E >" wN%dYou stand, casually brush yourself off, and then do a perfect flip, leaping head over heels to land lightly on your feet. The other tavern patrons goggle at you.\b "Now that's quite dandy," says !>F. "My nieces and nephews would love to see that! Just like that there tumblers in their bedtime stories." The other old man claps enthusiastically. N%d> > E >" N%dAhead of you, Val is immersed in his magery, mucking about with your territory while patently ignoring you. How irksome. \b Suddenly you do a perfect somersault, brushing right past Val and nearly taking off his head in the process. The strange mage barely leaps back in time and looks at you askance as you casually brush yourself off as if nothing of any particular interest had happened.\b "Well... I'm quite glad to find you so flexible!" Val finally says.N%d>" BN%d3You do a perfect flying loop de loop in the air. IN%d=On a whim you twist about and flip neatly head over heels. . axx_y===_  turn off.Az look[MO actorN%e>5" N%e!> 'N%e" {|||}|_~duuuYMO actorNb:A heartbeat of time passes as in stillness you wait...\bCCC'MO actorNd>" D >" D >5" /Nd You carry nothing with you. \nNd{Nd<4NdYou carry :\nNd 6Nd You carry . Nd -Nd!%You% carry nothing with you.\nLLL0MO actorNc">LLL0MO actorN c!>|_(} attackMO actorN'buEven for you, its easier to break things than to create them. Be careful you don't destroy something irreplaceable..!LN a|Px2s climbmMO actorN&@bNAs climbing air is a bit hard, you'll have to decide what you want to climb..PGJ|x|X||===t.!PGJ|`    at===_  stand on.SSS7MO actorNe>5" 5Ne&That would require a physical body. Ne ! D  ! FNe7If you stood up any further you'd be standing on air!tNe"(Ne Ne<(Ne Ne  greetXMO actorN&e9"Hail, friend!" you call out to no one in particular.\n.HG axXJJJm clean.!PGJ|Pz sayEMO actorN$kb&You mumble incoherently to yourself..!PGJ|?|;;;^ scream MO actorN'Q_>5" N'R_As amusing as it would be to see the reactions of the tavern denizens to a disembodied voice, that would well and truly destroy your disguise. % N'T_>  E >" N'W_You drink in a deep, smoke-filled breath and wail like a banshee. There comes a great clatter as the tavern wench drops a handful of cutlery in surprise. The other tavern occupants stare at you in astonishment as you clear your throat.\b The tavern keeper pops her head around the corner. "What in all the bloody shades was that?" she asks.\b "Methinks he sat on a splinter," says one of the old men. >^&Z N'X_> > E >  E >" N'a_You struggle to draw in breath as the chant rolls from Val's tongue, numbing your mind and dulling your senses. The wind blows red dust in circling eddies and Val stands with his back to you. You lean against a smooth roll of hill for support as a painful throb wells up behind your forehead, pounding irregularly, swelling and pressing outwards until you bend over and scream. \b Your cry echoes and rebounds throughout the hills before fading away. And then silence. \b "Was it so terrible then, my singing?" asks Val. He has turned to look at you, still and poised, as if on the point of coming over to you. \b You straighten and smirk. "It was abominable," you say. "Giving me quite a headache. "\b "Well then, I suppose I should stop. I wouldn't want to pain you." Val elegantly shrugs. "I suppose we're done here anyway. Shall we go?" and he walks under the red arch and away to the north. >&N'b_>  E >" IN'c_:Your scream dies unfulfilled within your frozen throat. (N'h_>   E >    N'i_You lower your horned head and scream at the white mage. The grass before you ripples outwards as the sound hangs shivering within the air. The white mage staggers back from the sound given form and you feel his hold on you slip just a little bit. >  N'k_>  E >   E >" 9N'n_*You scream, directing your keening wail towards the pale figure of Lorekosi. The sound echoes, growing ever shrill, sending the white mage reeling back in pain. \b "Good gods, Snugglebums" Val mutters as he crouches next to you, twitching a bit at his own ears. "Remind me to watch out for that. N'q_>  E >   E >" N's_You scream and the sound fills the plains, echoing back and forth, growing shriller ever shriller until it sends the two mages reeling, Val collapsing down to one knee. N'v_> > N'w_rYou dig deep into your soul and let loose with a piercing, primal scream. Val turns to look at you quizzically. N'x_> b N'y_You dig deep into your soul and let loose with a piercing, primal scream. Within the dark expanse of the caves something wails back at you. WN'z_> c N'{_You dig deep into your soul and let loose with a piercing, primal scream. Within the dark expanse of the caves something wails back at you. N'|_> d N'}_You dig deep into your soul and let loose with a piercing, primal scream. Within the dark expanse of the caves something wails back at you. N'~_>  N'_zYou dig deep into your soul and let loose with a piercing, primal scream. Your cry echoes around the surrounding hills. XN'_LYou dig deep into your soul and let loose with a piercing, primal scream. .!JIPGJ|X_|__((( unplugMO actorN'd>  ZN'dKYou look about but there's not much to 'unplug' within the tavern walls. }N'dqYou pull up an errant bit of grass and toss it aside. It flickers out of existence before reaching the ground.  typeMO actorN%dYour type? Well, you're polyamorous... as its nigh impossible for two fey to be together, you must find your pleasure with other creatures.SSSO unlockP.!PPGJ|nnnEMO actorNb>5" NNb?The conversation has turned far too interesting to sleep now!Nb>" BNb3If %you% sleep now %you%'ll never wake up again! ~NcmAway from prying eyes, %you% allow %your% corporeal body to fade away as you sink into the earth to rest.\b sleep||???_  move north.#???_  move south.$>>>_  move east.%>>>_  move west.&CCC_ move northeast.'CCC_ move northwest.(CCC_ move southeast.)CCC_ move southwest.*||| _`XXXXXXXXXXX_ _`MO actorO yesnoN) e.\bDo you really want to quit? (YES or NO) > N) eN)e\bN)e N)e\bExhausted by your current games and trickery, you sink into the embrace of the earth to rest for awhile. Anon, You shall pursue this adventure to its end. N)eHN)e<The game is still afoot! You return from whence you came. 'MO actorNe<+hMO actorNe!You are feeling more VERBOSE.\nNe"CNe"C 0MO actorNe<Ne+QMO actorN!e!You are feeling rather TERSE.\nN"e!C0MO actorNp$e<Np%e+ score,MO actorN&}N&~9MO actorNX<NX+NXdMO actorOsavefileN)+eFile to save game inN).e@KN)/e@MN)0e:An error occurred saving the game position to the file. !=N)2e-You hold this moment close in time. Saved. "N)3eN)4e4You discard this moment. Unrepentant and unsaved. !N)5eN)6eYou have failed. !'MO actorN7e<+(MO actorOsavefileN)=eFile to restore game fromN)@e@KN)AeN)Be^You reach out into the stream of time and grasp the past, pulling it back into the present. N)Ce@&N)DeN)Ee8You try to step back into the past and fail. Canceled.!N)FeN)GeYou have failed.!0MO actorNIe<NJe+XMO actorO scriptfileN)neFile to write transcript toN)qe@K?N)reN)se@N)teYou burn these memories into your mind. All text will now be saved to the script file. Type UNSCRIPT at any time to discontinue scripting.N)ueN)veN)we(You discard these memories. Canceled. N)xeON)yeN)zeYou have failed.N){ekMO actorNee!Nfe=You discard these memories from your mind. Script closed.\n0MO actorNhe<Nie+L   MO actorO yesnoN)Ve"N)We5Are you sure you want to start over? (YES or NO) > N)XeN)Ye N)ZezYou have made too many mistakes to rectify. You pray to an unknown force for a second chance and your wish is granted.\bN)[e N)\e>##N)]eN)^e N)_el\nYou discard this second chance you have been given and are determined to continue onward to your fate.\nN)`e=  version/MO actorN(#N($9MO actorN]'<N](+N]) jj\(Gilded: The Lily and the Cage\) \n An Interactive Faerie Tale from the Other Side \n IFComp v0.9\n \bjjjNMO actorNOe$+NPeAck, icky bugs! Squish them! pMO actorNe%E%dNe$(Taking a step backward in time)\bNe"C Ne>> JNe>Unfortunately you've reached the end of what can be undone. `    ofh%%%  betweend""" overd$$$ aroundh%%%  throughd### northd### underd$$$ behindXMO cmdN` E%@g D@again "Nb>PNcNdNeNf"NgMO*actorverbdoListprepiobjNo>FO strNGq>NGrNGsNtMOactor cmdWordListO> actorWordList actorString cmdWordString cmdStringN5<N5<N5<N5<N5<N5, N5N5MOwordListOilenN(N(~N(@KN(N(andN(,N(N(allN(N(N(butN(N(N(itN(N(N(themN(pN(N(himN(AN(N(herN(N(N(anyN(N(N(bothN(N(N(oneN(N(N(onesN(TN(H ,AXBIkTMRYB8NbPN(|N(N(+MO strNon to %Nin to %N in between%N down in %N down on %Nup on %Nout of %Noff of %Ni wide %Ni tall %N wait for %N wait until%NNMOwordListO7ilenstrNJNJNJJNJ@NJ NJ NJNJNJMO actorO! statstr actorWordListNC 6N<N<NBN"?NN?NNNMO actorO actorWordListN NC2N:"NC2@NC2@NN  MO#valuetarget replacementOIret new_value valuesave targetsavereplacementsaveflagsN*N*!N*#L  N*$T pO* tmptargetN&%<N'%> *%< N(%>N)N*N*,N*.T wN*0N*1N*2N*3 N*4 N*5 N*6N*7DN*8T ;N*:N*;N*<N*=N*>=O*lentmpNP@NPANPB@*NPC@NPDNPENPF@@CNPG@@@@NPINPJT QNPK4N*LT E  N*N!N*O! ;zN*PN*QN*RN*SMO |<<<_  talk to. MOrActorinitPropOQ yourResponsesyouHaveResponse NPCResponse numChoiceschoiceloopN.(@ N1(@N2(@N3(@! N4!N6"N8.N;"N<(N=NCDNENJ NK\bNLWNM\t - NN@@NO\nNPNQNT  NUNVHNYNZN[D  ;N\N_\bN`@@Nc@@! Ne\bNf@@(Ng@Nj@! Nk!Nl4Nn"No@(NpNrNtNuNwNyMN \H+nMN&\b*** You have ceased to exist ***\bNR\bYou may restore a saved game, start over, quit, or undo the current command.\nN"O respN#3\nPlease enter RESTORE, RESTART, QUIT, or UNDO: >N$ N% RESTORE #N'File to restoreN)! BN*3Your attempts to return to the past have failed. N+BN,3Your attempts to return to the past have failed. FN/"C N0>> N1+N2N3cN4 RESTART 4N6 N7#N8N9QUIT 4N;N<N=+N>N?UNDO NA%lNC(Going back one step)\bND"C NE>> NF+NG4NI(Sorry, what is done cannot be undone. NJNKNLMN@" D@2.2.4lNW\b\b\(WARNING! This game requires the TADS run-time version 2.2.4 or higher. You appear to be using an older version of the TADS run-time. You can still attempt to run this game, but the game's screen display may not work properly. If you experience any problems, you should try upgrading to the latest version of the TADS run-time.\)\b\bNNN\t Another sleepy day passes within the warm confines of the wayhouse tavern. In accordance, the resident drunkard dozes at a table at the edges of the room. Bright sunshine streams in from the open windows and doors, leaving half the room in light while the rest is cast in dim grayness. A young maiden serenely sips at her drink in this darkness. Perhaps she shall prove to be interesting. \b And so two old men sit on stiff wooden benches in front of the flickering hearthfire and gossip loudly to each other. You are one of the shadows that lays pooled beneath their table's legs.\b "There be gold in those hills," sighs one of the old men dreamily.\b "I thought you just said it was jewels in the forest?" replies the other old man.\b "As I said, gold in the forest..."\b "Gold?" says the maiden as she leans forward.\b "Aye, and more treasures than you can rightly imagine. But the sticky wicket is that it all belongs to the fey. "N!# N" NC N">N"BN@@MN#Your mind blank, you do nothing. NdehhMO fnameNN \b[Returning to the past...]\bN&NddMNP\bNQM\bYou may RESTORE a saved game, RESTART, QUIT, or UNDO the current command.NR"O respNxU\nPlease make your choice: >NxV NxW RESTORE NxYFile to restoreNx[! BNx\3Your attempts to return to the past have failed. Nx]BNx^3Your attempts to return to the past have failed. =Nxa"C Nxb>> Nxc+tNxd RESTART +Nxf Nxg#1NxhQUIT +NxjNxkNxl+Nxm AMUSING NxnFOO!NxrUNDO Nxs%kNxu!(Going back one step in time)\bNxv"C Nxw>> Nxx+4Nxz(Sorry, what is done cannot be undone. )'MN3!>9MN4(N5C)L Tavern description here* You hear the murmur of conversation and laughter in the background, the hiss and pop of the hearthfire, the creaking of the wooden floorboards and the songbird piping melodically from its cage.+ You drink in a deep breath of warm tavern air. It smells of smokey wood, and cooking food with the slightest edge of burning, of old dying flowers, and the musty scent of old men. It smells of not of you, but of mortality and excitement. WWYou discard the thought of leaving now, when things have finally become interesting. MOoN [N N! ONN>[[N!NNN>NXHTTMO codeN\b>NN00MO codeN N JJJC7[MON5@" -N7@ N8N;!N<N>>LNB2NCon NDonNEKNJ2NKoff NLoffNMNO<<MO actorO? choice_no valid_inputchoicesinput_nolenindNUNV /NYN]> N_N`Na /NbNfNjNkNl> 1 cNn,NoNpNqNs@ Nu> on UNw[! ] !Nx5N{[!] !N|N}N~N\nNNN[0] \(. . .\)N> 1  N N\b>>NNNKbNNNNNNNNNN@NNN>off NNN>E > 1  NNNcNNNNB 12345678902NNtN>E > 1 !N<NNN6\b\b\b(Please press a key to exit conversation mode)N N.NNN,NNNNNNNMO actorOquipsonindlenNNN8N@  NN N"NN!NNTTMO!actorquipno quipvalueNNdNgggKMO actorN>N> on XNoff N*\b(Menu hyperlinks are now switched off)NSNon N)\b(Menu hyperlinks are now switched on)NNRN=\bThat command is only available on HTML-TADS interpreters.NNMO actorN> N> 1 wN2 NoffN5\b(Menu options will now appear in the main window)NuN 1 N onN 7\b(Menu options will now appear in a separate window)N N RN=\bThat command is only available on HTML-TADS interpreters.NNMOnumstrN NYour power washes over you, tumbling, rising, crescendoing... and then finally fading away as you fail to give it shape or form. N!N NYour power washes over you, tumbling, rising, crescendoing... and then finally fading away as you fail to give it shape or form. N !MO+actorwordlisttypelisterrnumNKENNYour power washes over you, tumbling, rising, crescendoing... and then finally fading away as you fail to give it shape or form. N+NNYour power washes over you, tumbling, rising, crescendoing... and then finally fading away as you fail to give it shape or form. N+X!MN+

Gildedr

The Lily and the Cage

IFComp v.0.9
MN.5a#.$MOvantageND""MO actorNEE"  the sceneryMNI> 0F0 F0 F0#J$MOvantageNL""MO actorNEM"  set on fire You see no fire here. MO actorNR^*MOactordobjNT>  E >  E >" NUBIn desperation you summon forth great gouts of flame to consume ! .. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. Val leaps back from the sudden blaze, the flute held loosely in his hands.\b You are free. With a great fluttering of dark wings you are airborne once again, circling once, twice, thrice, and then you swoop out of the sky and steal the silver flute from Val's grasp. The mage's head whips around towards you, his hand raising, and then he hesitates and you are gone, soaring away to the northeast. Val pursues you on foot but he is quickly left behind in the sands of the grove. You fly over your lake, pausing only to drop the silver flute into its clear waters, before circling back. With a "PUFF" the fire is easily put out before it spreads and damages the rest of the meadows. NY&&>!&N[> > E >  E >" N\BIn desperation you summon forth great gouts of flame to consume ! 5. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. Val leaps back from the sudden blaze, the flute held loosely in his hands.\b You race forward and snatch the heinous thing from his grasp. Val turns quickly towards you, his eyes narrowing. \b "Your music is wretched," you say. "I can play far better, " and you put your lips to the mouthpiece of the flute and blow such a screeching shrill note that it sends both you and Val staggering as you clutch at your heads. \b Val pries the flute away from you while you are distractedly wondering if you should try to tear your ears off or not. "I think that's quite enough flute playing from the both of us today. " he says. Or you think he says. He could have been speaking about drinking white fluff from bootslaying growth at a buffet. \b Val tucks the flute back underneath his cloak and, still shaking his head a bit, wanders off to the north. With the mage's back turned to you, you carefully put out the fire before it can spread any further. Nd>>&>&!!Ng>  E " NiHWith a wicked cackle you summon forth great gouts of flame to consume !<  . The flames lick greedily at !  but not content with such a paltry meal, the fire stretches outwards to the newly waxed floor and catches within the dry wood of the tavern walls and timbers. \b Behind you some woman, either !3 or the tavern maid, lets loose with a piercing high pitched scream. The drunkard awakens with a snort and nearly bowls you over in his sudden rush to leave the building. Tables, chairs, and benches are overturned in the chaos as the tavern denizens scramble to get out of the way. \b "FIRE!" some helpful person shouts and the stout tavern keeper is pushing past you with a basin full of washwater, as if such a thing could ever hope to stop the inferno now raging within the front room. \b You have to give credit to the old men, with more courage than sense, trying to beat at the edges of the flame with their ratty cloaks. And then one such cloak catches aflame within the hands of its owner setting the middle of the ceiling into fire. Everyone retreats in the face of the wall to wall blaze. \b All save for you. You stand in the midst of the inferno, watching the flames dance about in colors of blue, gold, and red. Observing the plumes of smoke drifting in thick pools across the room, first pale and then darker and darker as the building is consumed. Fire licks at the upper stairs, at the floor below, and the ceiling above, burning and burning and burning until there is nothing left to kindle. \b You stand amidst the ashen dark wreckage of what was once the tavern, your favorite place in all your domains. Oops. Ns"&!Nu>  E> > E >" 7NwHWith a wicked cackle you summon forth great gouts of flame to consume !  and burn away the intruding ofuda. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. You bask in the glow, in the warmth, as the fire eats away at its meal. \b And then in a shower of multicolored sparks the nearby tree catches aflame and then the next and the next. The albino trees that you labored so hard to create with their strange sweet smelling sap ignite like so much dried kindling. From branch to branch to fire leaps, until all around the trees are brimming with blossoms of flame. \b With a curse Val covers his face with his cloak and rushes out of the forest. N{>!"&!&N}>  E> > E >" $NHWith a wicked cackle you summon forth great gouts of flame to consume ! u and burn away the intruding ofuda. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. You bask in the glow, in the warmth, as the fire eats away at its meal. \b And then in a shower of multicolored sparks the nearby tree catches aflame and then the next and the next. The albino trees that you labored so hard to create with their strange sweet smelling sap ignite like so much dried kindling. From branch to branch to branch the fire leaps, until all around the trees are brimming with blossoms of flame. \b "Oh gods, my trees!" you yowl in pain as wreathes of smoke hang thickly in the air and petals of sparks rain down from the trees. "Do something!" you yell at Val. \b "Me? Do something?" says the mage as he looks all about him, at the forest all aflame from tips of blazing leaves down to the stony ground. "It's too late!" he coughs. "We have to get out of here!" he says as you steadfastly ignore him. \b "Hark! Snugglebums!" and Val finally grasps your shoulders and drags you bodily out of the forest towards the barren earth of the hills. \bN">>!>&!>&hN>  E   E " NRWith an inwardly wicked cackle you summon forth great gouts of flame to consume !  amidst shrieks of surprise from your companions. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. And then the plumes of fire reach out arms towards the humans scattered about the courtyard. And towards you as well, lest you feel left out. "Great gods!" yells Old Coot. "Tis like the story where some fool caught the phoenix and it built up a nest and set everyone on--" the old man's story is cut off as he dashes inside the tavern. \b "I don't know if it's so wise to be running into a wooden building" Layna says as she backs away carefully from the flames. And with that the fire flares up once more and then collapses upon itself, embers dying away into ashes that flit away in the wind. \b "I don't suppose either of you dropped your pipe in the straw?" Layna says dryly as she wanders over to the horse trough and washes her arms, all the while still eyeing the remnants of the blaze. \b "A welcoming gift from the fey, I would think," says Val. "Its power extends all the way here?" says Layna as she purses her mouth. \b "To the edges of the courtyard, most probably," you assure her. And quietly behind you the ash falls away from ! % leaving it as it was once before. N>" N>  E >  E >" E >  ;NRWith an inwardly wicked cackle you summon forth great gouts of flame to consume ! k amidst shrieks of surprise from Layna. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. And then the plumes of fire reach out arms towards the humans scattered about the courtyard. And towards you as well, lest you feel left out, burning higher, brighter... "It's going to set the tavern on fire!" Layna yells out. \b She's wrong, you would never let something so foolish happen to your tavern. But she would have no way of knowing this, nor Val either, who seems to have taken her warning seriously. The young man edges over to the horse trough, dips his fingers into the water, and flings the droplets towards the blaze. \b Only they are droplets no longer, but a slender stream of water that rains down upon the fire, quenching it with a bubbling hiss. Both you and Layna stare at the pale haired stranger. \b "A mage," Layna says. "You are a--" and color drains from her face. \b "I do know a bit of magic," Val says simply as he gazes at the girl. And all your attention has turned upon him. \b "A bit too much for my comfort." says Layna. "I have no wish to be involved in such a few hunt. Good day to both of you. " The maiden hitches her divided skirts close to herself and half runs to the tavern. \b "More afraid of me than of the fey," Val muses, his tone dry. \b "I can't say I blame her," you reply and Val turns to you with a half smile. \b "And yet you won't run away?" he says, not truly asking. "Shall we be off then?" and Val pulls his satchel across his shoulders and sets off for the northwest. And quietly behind you the ash falls away from ! % leaving it as it was once before. N>>">&CN>  E >  (NYou summon forth great gouts of flame to burn and consume the mage. With a roar the arms of the blaze reach out towards Val, yet they slow and stop a mere handspan from him, dark smoke hanging thickly, glowing tendrils licking forward, yet unable to touch him.>N>  E " E >" NCN>  E >" E >" NC iN>   E     N]You summon forth a great gout of fire to consume the white mage. From deep with the flames !> ! Lorekosi  the mageB laughs and the fires sputter out with trailing wisps of smoke. >  ]N>  E >   E >" NYou rain fire down from the heavens. Lorekosi raises one hand upwards and summons forth a barrier as his eyes never leave the figure of Val. N>  E >   E >" NYou rain fire down from the heavens and upon the figures of the two mage. Only the faintest bit of smoke wisps up from the dark coat of Val and Lorekosi remains as ever untouched. N>  E >"" 9N*That would give away the game too soon. JN,It seems such a shame to ruin such a good !. MO quipnoN+KtN+ Aye, just stand right there...`N+Nay!MN+"Aye, you can be my pincushion...MO quipnoN,K~N,\b"Aye," you say and beckon towards the mage. "Simply stand right there and..."\b "And?" Val says as he moves to stand where you motioned. "Stand right there while I pounce on you!"\b "Do I get to pounce back?" asks Val and you begin to reconsider the wisdom of this game. >##N,\\b"Nay!" you say and go on prowling on your way as Val watches you with a raised eyebrow.   WN,\b"Aye," you say. "You can be my pincushion!" \b "I can be your what?" \b "Just wait right there while I get a sword or otherwise pointy implement..." And for some reason Val seems less than enthused with the prospect of this particular game. mmmmD m<#/=>Mm MNE<  mNE\n\^!>K leans his hip against the stone well, patiently waiting for the others. NE<  NE\bVal stands amidst the flowers and greenery, eyes closed, and a silver flute held to his lips. The trilling notes of the flute hang in the air and seem to shiver into your very being, holding you steadfast. NE<  E</" NE\bVal has somehow wedged himself into one of the dark metal trees. An intricate design of swoops and swirls, whorls, and crossing lines covers the sands of the nearby area. NE<  NE\bVal crouches down amidst the grains and glass, trailing his fingers through the sands. A design is created around the mage, the metal trees, and you, swoops and swirls, intricate whorls, and crossing lines, all in some arcane pattern you cannot quite grasp. NE<  E<=" NE\bVal lays nonchalantly sprawled within the branches of a birch, as if he had chosed to climb it on a whim and had not been chased aloft. Amongst the surrounding trees sutras cling to the pale white wood through some unnatural force. NE<  E >  NE\bVal stands amidst the trees, his fingers flickering through a series of secret signs. Amongst the surrounding trees sutras cling to the pale white wood through some unnatural force. NE<  E >  NENE<  NE\bVal stands within the valley of the red hills an odd chant in a strange tongue passing through his lips. The song is rather... mindnumbing...NE<  NE\bVal stands hip deep within a long, narrow ditch of his own making. He continues to shovel away as the edge of a rainbow trails behind his back. `NE< m WNEH\bVal stands upon the edges of the lake gazing far into the distance. NE<  nNE_\bVal stands atop the waters that lap at the edges of the island, stands in challenge to you.wNE<  E >   fNEW\bVal stands before you in the grass that is neither part of plains nor lakeshore. \bNE<  NEr\b Val carefully wanders amidst your treasure, pausing to run his hands over this or to laugh softly over that. _NF<  KNF?\bVal carefully paces about the nine sides of the trap room. LMNF<!" NFVal"NFthe cloaked stranger,JMNF<!" NFVal N Fa cloaked stranger LMN F<!" N FVal"NFthe cloaked strangerMNFThe face beneath !<! Val'sthe stranger'sQ silvery-pale hair is young and handsome, but there is an oldness within those !<k @ eyes. A tattoo arches above his right brow and sweeps down his right cheek, ending with a slight flourish near the curve of his lip. \bNF<" NFPale from head to foot and seemingly undaunted by his nakedness. A large stylized sun has been tattooed along the back of Val's right shoulderblade and a vine of thorns crawls around his left ankle. And along nearly the entire length of his right and intricate interlocking tattoo of nine nine-sided figures. These are far more distinct than the ones of his face... Mage markings. NFNot from here, or anywhere near here, this stranger comes, of that you are certain. He is as tall as you, and besides that, little else can be known as he is otherwise covered from head to foot. LMNF<!" NFVal"NFthe cloaked stranger!5476?MO actorNF}MO actorNF^You reach forward and try to call forth Val, but the mage keeps slipping through your grasp.akviolet pale bluegreen flecked gold warm browndeep ocean blue sea green pale yellow coal blacksilvery grayhazeldark jade green blue green@MO actorNN FMO actorNr"F>A" E >" 7Nr#FYou stride up to !>! Valthe cloaked stranger: and reach towards the loop of his belt to unbuckle it. !>! ValHe grins wickedly at you, puts his hand atop yours, and pulls you closer. You back off and suddenly decide you don't need his clothes after all. Nr$F>A" E >" @Nr%FWith your mind you reach out towards the breeches, preparing to snatch it away with your unseen powers. And then you run up against... a barrier? Something seems to be pushing you away, if not physically than at least mentally. It seems !>! Valthe cloaked stranger came prepared. Nr&F>" =Nr'F.Now is most certainly not the time for that!{Nr(F>A" gNr)F=With a wicked cackle you strip all the clothes off of Val.  >()MN-F> > E >  N.F(<(KN/FN0F\bVal gawks at you as you hobble after him. "Umm... you seem... to have a little something... there..." he says and gestures to the dog clamped tightly to your leg. \bC) 2h i B0MN6F>  N7FC0N9F(<(KN:FN;FNFN?FN@FNAFNVal carefully slides out of the dark metal tree to the waiting sands below. !/C0KedMO actorNoCFeMOactordobjNEF  E> > E >  E >C" NFFVal's !>k @ eyes widen slightly as you hand the blue rose over to him. "Thank you," he says and gazes down at it, moist petals glittering in the light like so many diamonds. For a moment it seems that the mage is about to say something more, but then he merely tucks the blue rose safely away. \b Chanting forgotten, Val smiles faintly at you as he walks under the red arch and away to the north. NGF>"C> &>9&"9>&NIF>" 4NKF%Alas, the time for that has passed!ONMF" yNNF=The mage gives you a small bow of thanks as he accepts the ! . D>##NQF  E >  E >C" E> > NSFVal's !>k @ eyes widen slightly as you hand the blue rose over to him. "Thank you," he says and gazes down at it, moist petals glittering in the light like so many diamonds. For a moment it seems that the mage is about to say something more, but then he merely tucks the blue rose safely away. \b Val turns his back on the pit he had been digging and, smiling faintly at you, he begins walking towards the glimmer of the lake to the west. NTFm>"C> &>9&!9vNVF  E >  E >C" E> > NXFVal's !>k @ eyes widen slightly as you hand the blue rose over to him. "Thank you," he says and gazes down at it, moist petals glittering in the light like so many diamonds. For a moment it seems that the mage is about to say something more, but then he merely tucks the blue rose safely away. \b Val turns his back on the pit he had been digging and, smiling faintly at you, he begins walking towards the glimmer of the lake to the west. NYFm>"C> &>9&!9)N[F  E >  E> > /N\F Now is not the time for that! N^F  E >  E >C" E> > DN`FVal's !>k @ eyes widen slightly as you hand the blue rose over to him. "Thank you," he says and gazes down at it, moist petals glittering in the light like so many diamonds. For a moment it seems that the mage is about to say something more, but then he merely tucks the blue rose safely away. \b Val stands up once again, and turning his back upon the patterns he had been drawing, he smiles faintly at you. He gently pats the place where the rose is now hidden and walks off to the southeast. NaF>"C> &>&O NcF  E >  E >C" E> > NeFVal's !>k @ eyes widen slightly as you hand the blue rose over to him. "Thank you," he says and gazes down at it, moist petals glittering in the light like so many diamonds. For a moment it seems that the mage is about to say something more, but then he merely tucks the blue rose safely away. \b Unbidden, the sutras fall from the trees. Val smiles faintly at you before turning away and walking to the east. NfF>!"C> &!>&! NiF  E> > ]NjFVal's !>k @ eyes widen slightly as you hand the blue rose over to him. "Thank you," he says and gazes down at it, moist petals glittering in the light like so many diamonds. For a moment it seems that the mage is about to say something more, but then he merely tucks the blue rose safely away. "C> & NlFq E >A" .NoFVal hesitates as you offer the crystal ball to him, but he eventually reaches forward to take the thing from you. The moment his fingers touch the cool glass the sphere blazes with a bright pulsing light. Val staggers back and then crumples to the ground, the sphere falling with a heavy thunk after him. \b The crystal ball now has a few more cracks to decorate it. And the mage... well, he is very passed out. >>"A! &> > &> >q& CE" "" ""YNqFq E >A" eNrFVVal waves the memory sphere off having learned to keep his distance from the thing. NtFI E >  NuF"Thank you," says Val as he blinks down at the key in surprise. "Wait, is this the--" Val's voice trails away as he hastens to the chest and turns the iron key within its lock. With a metallic click it springs open. >I& C) NwFI E >  PNxFA"Keep it," Val demurs. "To open whatever it was meant to open,"INzFQ E> > E >  }N|F7Without a word you hand the tattered journal over to the mage. Val gazes down at the book for a moment, hesitating before he reaches out for it. Soundlessly he flips through the pages, his fingers gently turning over each fragile page. \b "So you found it," the mage says. "I never thought to see it again."\bQ>Q&>##m>"FN~FQ E >  NF8Without a word you hand the tattered journal over to the mage. Val gazes down at the book for a moment, hesitating before he reaches out for it. Soundlessly he flips through the pages, his fingers gently turning over each fragile page. \b "So you found it," the mage says. "I never thought to see it again."\b<)>Q&>##Q"FNFQ sNF7Without a word you hand the tattered journal over to the mage. Val gazes down at the book for a moment, hesitating before he reaches out for it. Soundlessly he flips through the pages, his fingers gently turning over each fragile page. \b "So you found it," the mage says. "I never thought to see it again."\b>##>Q&Q"F|NFVal blinks down at the ! > in slight confusion, but he graciously accepts your offer. &MO actorNu.FMOactordobjN.F  N.FVal looks down in some surprise upon about the flower that you show him. "Black diamonds in the sun which glows with purple light in a sky turned green with envy from the golden waters sight. Fire in the feathers as the fish do leave the sea and man walks underwater before the mouse the lion flees. A rainbow in the evening as blue roses are set free the stars fall from the heavens all things never meant to be." the mage recites from memory. N.F>" 4N.F%Alas, the time for that has passed!N.Fq E >" N.FYou hold the crystal ball up to Val and it catches the light, flickering glows seeming to spark deep within its depths. \b "I wouldn't have expected to find something like this here," Val muses. "It's a mage's memory sphere." \b "Memory sphere?" you say. \b "For holding the memories of magic or something such. It can also hold more mundane things as well. I've never had use for one myself. And this one..." Val cocks his head one side as his eyes pore over every crevice of the sphere. "... appears to be broken. ""SN.Fq E >" oN.F`"It's a mage's memory sphere," Val reminds you. "To hold either mundane or magical memories. "N.FQ vN.FgVal's eyes never leave the tattered journal as soon as you pull it forth. "May I see that?" he asks. AN.FVal looks over the !  with interest. bz3MOwordlstNm4FK-Nm4FNm4FNm4FNm4F>  Nm4FCaNm4FUFor a moment a whim of insanity nearly has you babbling your true name to the mage!Nm4F"Nm4FNm4FNm4FNm4F>"" PNm4FA"I am merely a traveler passing through this way," Val replies.Nm4F"Nm4FNm4F>Q" E >F" kNm4FIVal lips quirk upwards. "I think you already know that truth," he says.>##qNm4Fe"Trey? An old fashioned name, although common enough long ago. You would know more of that than I.""Nm4FNm4FNm4FNm4F\Ki-nor? An old town in a lond dead kingdom very far away. How would you know of that name?>##Nm4F"Nm4FNm4FQ"I yield... you are far better at creating embarrassing names than I,"Val says.>##Nm4F"Nm4FNm4FN"I did warn you it was a very good flute, did I not?" Val says with a wink. "Nm4FNm4FL"I think you would know much more of that than I," says Val with a laugh. "Nm4FNm4F"Anrui is another city of mages to the southwest. They have captured and bendedt one of the few dragons to their will. It... is not a pleasant situation. The dragon's body has been grafted into the foundations of the city and..." Val trails off. "Nm4FNm4F"If I have ever met a werewolf than I do not know it. Of course, if I was a werewolf I would not exactly be shouting it to the hills.""Nm4FNm4F"My dreams?" Val grins wickedly at you. "Do you really want to know of them?" \b You gaze suspiciously upon the look on the mage's face. "Something tells me I might not," you say. Nm4F"Nm4FNm4FNm4F "My love is like a rose in bloom\n so perfect in its fleeting beauty\n from bloom to blossom to falling free.\n Red burns the passion in my heart\n and white the whisper of purity\n in violet haunts the old, past love\n and blue is for eternity."\n Val quotes to you."Nm4FNm4FP"An old fashioned name," Val says softly."One I have not heard in many years.">##"Nm4FNm4FNm4FNm4FNm4FNm4Ff"Hedge wizards are those people with the tiniest spark of power. They can usually do a few small things... speed up one's normal healing, suck the poison from a plant or animal, or catch the edge of the trail of some magical creature. Most of it is mere common sense however... the practice of herbology or the knowledge gleaned of the antidotes to magic.""Nm4FNm4FNm4F "There is not much more I can tell of that beyond what is common enough knowledge. Tis the end of a mortal life and the lifting of a soul to... well, no one knows. Having not experienced it myself, I cannot say. And I hope to keep it that way for a good long time. ""Nm4GNm4GNm4GT"There's not much I can tell you about that... unless you want a demonstration...">##"Nm4GNm4GNm4G"Being rather philosophical, are we?" says Val with a small smile at you. "I believe that life is not something that can be explained, but must be experienced.""Nm4 GNm4 GNm4 GNm4 G"Nay, I have never been married either. I am most often on the road and... the company I tend to keep is not conducive to romance. ""Nm4GNm4GNm4GNm4G"Mages are just like other people..." Val says. "Full of love and hatred and greed and forgiveness and self-sacrifice and desire. Yet with our strengths, everything is magnified. When a normal couple fights, the world turns their eyes away. When mages fight, the world trembles. ""Nm4GNm4GNm4G"I have never met one in person, yet seen a few, a very few, from afar. Dragons are not particularly enamoured with mages. " Val says. >"Nm4GNm4GNm4GNm4GNm4GNm4GNm4 G>#ENm4!G6"You are cruel, Snugglebums," the mage says softly. Nm4"G># Nm4#G}"You? You are very pretty. Slightly mad, but very pretty. But I am slightly mad as well, so what I pair we make!" says Val.>##Nm4$G>#Nm4%GX"You... are very special. I will do everything in my power to protect you," says Val. >##YNm4&G># ANm4'G5The mage merely presses a kiss upon your forehead. >##Nm4(G"Nm4*GNm4+GNm4,G]"Love... love is not something so easily explained," says the mage. "It is something that can be very beautiful or very ugly, that brings with it blessings and always some pain. Although there can be a pleasure in that pain as well. It is something that must be experienced to be understood and even then it's like to sow more confusion than less.>##"Nm4.GNm4/GNm40GNm41GNm42GNm43GNm44GNm45GNm46GNm47GNm48G"Hate is a passion just as much as love, although perhaps a simpler one. It seems easier to let love fall into hate rather than the other way around. Nm49G"Nm4;GNm4Gf"Villain and enemy, as such strong words, are they not?" says Val. "I prefer the term 'antagonist'.""Nm4@GNm4AGNm4BGp"Orea? Orea is a mountain range in a kingdom far south of here. I believe it's now called the Kiri Peaks now. Nm4CG"Nm4EGNm4FGNm4GGNm4HGNm4IG"Bonding a fey, you mean?\ Tis not something that I have ever done, obviously, yet I have watched the outcome with my fellow mages with great interest. \b>##"Nm4KGNm4LG"The daft man bonded three fey at once," Val tells you. "And they, of course, tore him up into pieces shortly thereafter. Destroyed the entire city around them as well. How in the world he thought he could handle three, where a sensible mage hesitates at one, is beyond me. "Nm4NGNm4OGNm4PG@"Keilantra and her fey have been together for a very long time... some say five hundred years or more. He... it... her fey... is called the Reaver amongst the mages and is perhaps the most powerful of the bonded ones that remain. They are supposedly married... several times over, to tell the truth, which quite shocked and revolted my peers, to say the least. Mayhaps, that's why they keep doing it. " and Val laughs. " That pair had quite a few enemies in the beginning, but they are all dead now. I believe Keilantra is the empress of some empire or other at the moment.""Nm4RGNm4SGNm4TGV"Names have power," the mage says. "But what that power is, is up to you to decide. "Nm4VGNm4WGNm4XGNm4YG!"\bWhat about eyes?" asks Val. "Nm4[GNm4\G-" {Nm4]GlAs soon as you mention 'unicorn' the mage bursts into gales of laughter as you scowl at him in annoyance. Nm4_G"Unicorns are my favorite," Val confesses to you. "Although I have never beheld one myself. The rumor amongst the mages is that there is only one left... and when that one dies, so does the world with it.""Nm4aGNm4bG*"I prefer unicorns, actually," says Val."Nm4eGNm4fGNm4gGNm4hGb"A cozy little place, is it not?" Val says. "Although you probably know much more of it than I.""Nm4jGNm4kGNm4lGNm4mGNm4nGNm4oG"Carrion birds of death, bringers of ill omen," Val says to you. "Or so they say. I rather like them however. Especially the ones with glossy feathers," he says and winks at you."Nm4qGNm4rG"One of the most poisonous things in the world," Val tells you. "An ill omen for whoever finds it, symbol of death. In other kingdoms the giving of a kisei bloom is a declaration of war. "Nm4tGNm4uG>" +Nm4vGVal gives you a small bow.xNm4xGl"A fine mage, good tempered yet with an odd sense of humor. Ugly as sin, however," says Val with a laugh. "Nm4zGNm4{Gj"Powerful," says Val. "But the worst sort of mage, who cares for none but himself and what he can gain.""Nm4}GNm4~GNm4G"A brave lass," Val says. "Especially if I have placed her accent correctly. I well understand why anyone from Wakanda would be leery of mages.""Nm4GNm4G"Wakanda is one of the great mage cities to the west" says Val. "Yet not one that I am wont to visit. It is under the rigid rule of some very... strict mages, to say the least. None without magic powers may enter or leave the city without the permission of its council."Nm4GNm4GNm4GNm4GnVal laughs. "Well, he's certainly a character, is he not? I would watch my rump around him, if I were you." "Nm4GNm4GNm4GNm4G7"He is most probably the most sensible of all of us.""Nm4GNm4GNm4GNm4Gr"She seems nice enough." says Val. "To tell you the truth, I was not paying that much heed to her in the tavern."Nm4GNm4GNm4GNm4G]"The most frightening thing in the tavern," says Val. "Far more frightening than you or I.""Nm4GNm4GNm4GNm4G"Some say that the shadow prince was a mage," says Val. "Yet I don't believe it... his powers do not seem like any mage I have ever seen. He sounds more fey than human... but there's no such thing as a displaced fey, is there?""Nm4GNm4Gb"A king of Panarche was a man of odd tastes and terrible inclinations. He hired a nine times nine the number of the greatest composers across the lands to compose for him the greatest of symphonies. And when their work was done and he had heard it from the beginning of the prelude to the last note, he cut off all their hands and tongues, so that none other could ever hear the songs meant only for him.\b But one minstrel escaped, and in vengeance traveled the world, spreading the songs all around. Yet it seems that most people do not share the tastes of the king, and so the songs are not that popular.""Nm4GNm4GNm4G"They live high up in mountain aeries and are not particular fond of humans, mage or not. Once upon a time, men used to ride upon the backs of gryphons, supposedly into castles that float within the skies. Whatever truth remains in those stories is long past.""Nm4GNm4GNm4G6"A lonely existence as there is only ever one phoenix within the world at one time. Tis actually quite fond of humans, which often leads it to being trapped by those greedy enough to desire the gold and silver spun for its nest. Yet the phoenix only builds a nest when it is ready to renew itself in fire...""Nm4GNm4GNm4GNm4GNm4G~"The seas?" says Val. "Yes, I often been upon them They are rather wet," The mage winks at you. "By far the most beautiful is the Summer Seas to the far south. Its waters is the color of turquoise and glowing, as if lit within by a another sun."\b "I should like to see that," you quietly admit. \b "Then we should go there together," says Val, "when this treasure quest is done,">##"Nm4GNm4GNm4GNm4GNm4GNm4GNm4G"The treasure I came for is not jewels," says Val. "Although I would not be averse to finding gold," he says as he looks at you. "Nm4GNm4GNm4G"A lily has many faces," says Val. "It means death and sweetness and purity and falseness and truth and coquetry... It has so many meanings, mayhaps it has no meaning at all. "Nm4GNm4GNm4GNm4GNm4GC"I don't particularly enjoy cages," says Val. "Even gilded ones.""Nm4GNm4G INSERTHERENm4G"~xyzzyO yournameKmynameI stranger himselfvalTreyXki-norQkinorPki norN pookiebuttfeyRfeyanrui werewolf dreamsrosekrosesjmaiawizardhedgehedge-wizardhedge wizard wizardrydeathRdeadRkissl kissingilifeliving marrying marriage marriedmagicmagesmagedragon9 dragons6 snugglebumsmyself yourselfyouselfme belovedloverancorcenmityagrudge_ antagonismY animosityTmaliceR loathingN abhorrenceHhatredFhateF antagonistenemy villainKiri_Orea_bond bondinglink linking DelerianReaver Keilantraname names eyesmeyesm eyeballsi unicorn capricorn wayhouse7inn8tavern6crowsravenravenscrow blackbirdkisei^ trevalkian# lorekosimaidenLlaynaK Wakandacoot oldcoot old cootman{oldmany old manvmaid tavernmaid tavern maidkeeper,tavernkeeper$tavern keepershadowprinceshadow princey panarcheh gryphon griffen phoenix firebirdsea$seas$ocean#oceans!goldgildedgildgilt treasure treasureslilyFliliesD freedomfreecagecages INSERTHEREJNm4G!c 22"You would know more of that than I," says Val. JK6}[~\[\+301n_^=NL6 5GH12IJ\[)(CBpo23KLQPMNOP      Q R     . / - ,   S T  c Z Y U V # " W X b a Y Z S R    [ \         ^ ] U T e d W V     !       t222)' Flowered Meadow \(Flowered Meadow\)+ IIAn intoxicating scent, a cacophony of flowers, almost too overpowering.* MN<" NThe haunting music of Val's flute fills the air. It could almost be a pretty sound if every note didn't feel as if it was wedging itself under your skin, holding you perfectly still. .N"The meadow is blissfully quiet. 6MNg" &N\b Cracks, clefts, and upheavals of land pockmark the landscape, greenery and grasses tossed all askew by the recent earthquake. Crushed flowers grow at bedraggled angles, their petals fallen in amongst the churning earth. Several of the columns of twining blossoms that dot the land seem almost on the verge of collapse, many of them having lost their decorative ribbons.\bThe hazy figure of trees can be seen, white to the east and black to the north. And to the west and south... you can sense it more then see it, your boundary. N\b From horizon to horizon unfurls a meadow of rolling green grass, each blade placed just so. A riot of flowers in all different shapes and colors spread their petals in carefully calculated abandon amongst the greenery. And rising above all are columns of twining blossoms, each trailing a circle of ribbons in the wind. \b The hazy figure of trees can be seen, white to the east and black to the north. And to the west and south... you can sense it more then see it, your boundary. \bMOvN<Ez E + E r E ~ E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E  E U NThe shrill notes of the flute seem to shiver into the every fiber of your being rendering you motionless and voiceless, if not powerless. !N)"MN Defiance-- it fills you as you gaze at the boundary that seperates your lands from those of the Beast. With careful calculation you step over your border and, ignoring the flare of pain and uneasiness that fills you, you call out a challenge to the other fey.\blVNMNYou travel ever northward, and though the shadow of trees does not seem far at first, it is quite some time before you reach them. \bTmPVMN>The light dims as you step into the canopy of pale trees. \bS You sink into the embrace of the earth. Quiet serenity as your land cradles you close-- but now is not the time to rest. You climb cautiously to the surface, making certain no mortal eyes see you emerging from the earth.R {{You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.HHH)' Bottom of the Lake \(In the Lake...\)+ &&You drink in the cool clear waters. \b You are standing in a hollow of pale sand amidst spires of coral and kelp. All around are bright colors tinted with the promise of blue. A lush garden of drowned vegetation sways hither and yon, spreading forth webbed fingers and brushing lightly against you. At your feet lay round tumbled stones, pastel gleaming seashells, and the odd sea squirt or star fish immersed in its feeding.\b Several schools of fish dart playfully about, racing in and out of the dapples and shadows cast by the sun. Sensing your presence, the capricorn drifts out of a break in the coral reef and up to your side. \b The shores of the lake shimmer above you.\b>MN"#&You tilt your head upwards, towards the shimmering world above you, and with a sudden surge you break through the surface, clear crystalline waters bursting around you, and land neatly upon the shores of the lake. With a slight shake you dissolve all the moisture that has seeped into you. \bmR:MN##"You tilt your head upwards, towards the shimmering world above you, and with a sudden surge you break through the surface, clear crystalline waters bursting around you, land neatly upon the shores of the lake. With a slight shake you dissolve all the moisture that has seeped into you. \bmS You sink into the embrace of the earth deep beneath the lake. Quiet serenity as your land cradles you close-- but now is not the time to rest. You ascend back to the bottom of the lake.5  silver flute ttAn ornate silver flute, its keys and holes comprised of whorls, elegant twists and twirls, surrounded by etching. YMO actorN;ZMO actorN;The edges of the flute smolders red for a moment before returning to its normal cool metal. The intrument apparently has absorbed some of the powers of its master, for it repels your fire. MO actorN;MO actorN;> > E >  E >" uN;iYou race forward and snatch the heinous thing from his grasp. Val turns quickly towards you, his eyes narrowing. \b "Your music is wretched," you say. "I can play far better," and you put your lips to the mouthpiece of the flute and blow such a screeching shrill note that it sends both you and Val staggering as you clutch at your heads. \b Val pries the flute away from you while you are distractedly wondering if you should try to tear your ears off or not. "I think that's quite enough flute playing from the both of us today. " he says. Or you think he says. He could have been speaking about drink fat white earfluff from bootslaying growth at a buffet. \b Val tucks the flute back underneath his cloak and, still shaking his head a bit, wanders off to the north. With the mage's back turned to you, you carefully put out the fire before it can spread any further. >>&!T     )' Grove of Black Trees \(Grove of Black Trees\)+ zzThe smell of hot sand with a faint metallic tang. The perfume of the dark grove is quite different from all other trees.* PPThe eternal quiet of dusk hangs about the Grove, even in the light of midday. FMN\\b The grass gives way to sand here, patterned with clear patches of glass. The sand gives way entirely to glass as you approach a grove of black trees with boughs and limbs intricately interlaced and woven around each other. Instead of leaves, deeply colored glass is spun between the branches, and the sunlight touching upon the trees casts multicolored dapples upon the ground. \b N^9" N_Several spans of the stained glass have been shattered into serrated points, with glinting bits and shards littered underneath the trees. \bNcFireflies in matching hues of blue, gold, purple, green, turquoise, and red hover and twinkle underneath the trees. \b Green awaits you, meadows to the south and lakeshores to the east. The Beast's territory surrounds to the north and the west. \bMNeYou gaze defiantly towards the west, where your domain turns imperceptibly into those of another. A lance of pain shimmers through your body as you step over your border and into the lands of the Beast. \blOvMNf^It is a long trek through the sands before you reach the green of the meadows once again. \bVT PMNiSurrounded by these hot sands makes you long for cool water all the more. You make your way towards the lake that you know lies beyond your sight to the east.\bmS You sink into the embrace of the earth. Quiet serenity as your land cradles you close-- but now is not the time to rest. You climb cautiously to the surface, making certain no mortal eyes see you emerging from the earth.R {{You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.T,,. patterns in the sand, the patterns in the sand Swoops and whorls and lines crossed over lines have been drawn into the surrounding sands by the mage. What the overall pattern is and what it means you cannot begin to tell as you gaze at the designs all around you.MO actorN5vMO actorNYx>" NYyAs you reach down towards the design in the sand Val tsks and catches your hand. "This will lure out the fey," he says. "You don't want do disrupt that, do you?" he looks at you through eyelashes in a narrowed gaze. }NY{qVal shoos you away from the patterns in the sand. "You don't want to disrupt the circle, Lord Raven," he says. YMO actorN|ZMO actorN}Flames flicker along the patterns as Val steps back and laughs. "It adds a certain 'spark' to the overall design, doesn't it?" he says and with a 'POOF!' the fire peters out. JMO actorN~KMO actorNAs you reach down towards the design in the sand Val tsks and catches your hand. "This will lure out the fey," he says. "You don't want do disrupt that, do you?" he looks at you through eyelashes in a narrowed gaze. JKJKJKLNPQ =op[\}~VWMOTULr `MNM<  3NM$satchel slung around his shouldersNM satchel A dark green and brown satchel of some leather and fiber mix. It's shapeless and... not particularly interesting to gaze at, really. Perhaps there's something more interesting inside. MO actorNUMUMO actorNyM6The material of the satchel is tough, but flexible. ,MO actorNM-MO actorNMgIt smells of green forests and rich dark earth. And a faintly sweet floral scent... perfume, perhaps?MO actorNMMO actorNM<  E >" NMYou reach forward and give !>! Val'sThe stranger's satchel a couple of tugs. He looks back at you and softly laughs. "Nothing of interest in there, my friend," he assures you. NM>  E >" NMYou perch upon the satchel and hop about cawing. Alas, it is far too heavy for you to carry and seems to be warded against any more powerful attempts to take it. NM) =T=T=T=)' Tavern`MN>  *N\(Remains of the Tavern\)N\(The Tavern\)678"&MN>  N\bThe tavern is snug and warm, cast half in light and half in shadow from the sunshine streaming in through the unshuttered windows. Benches and chairs and round wooden tables litter the room, their surfaces worn smooth from years of use and polish. N<"" E >  |NpTwo old men sit gossiping and laughing in front of a sputtering hearth that takes up nearly an entire wall. \bN<"" E >  NYour newly formed group of traveling companions and current playthings chatters excitedly amongst themselves before the fire as the other old man shakes his head dolefully at them. \bN>  NAcross the far end of the room runs a counter, behind which lies the door to the scullery where the tavern keeper rules supreme, sending the tavern maid rushing to and fro every other passing moment. N<"" E >  dNXSaid tavern maid is currently hovering in interest over the shoulders your companions.N>  N>\bSolid wooden steps lead into the sleeping quarters upstairs and around the corner, unseen but known, lie the dampish stone steps that lead down into the cellar. The tavern is decorated with three black and white paintings adorning its simple wooden walls, a hazy smoke hovering around its rafters, and in a corner !I9an empty birdcage=:a small plain songbird in a cage just as small and plainj. The resident drunkard dozing away at his usual table could perhaps be considered a decoration as well.N<"" E >  HN<\b A young pale haired girl shares the shadows with you.\bN<"" E >  N\bIt's all so remarkably mundane and unfey. You have impressed every detail into your mind, as if you created all this yourself.\b N>  N\b You would be hard pressed to still call this a 'building'. The burned out skeleton of the tavern is nothing so much as a large, lopsided pile of ashes and broken and burnt kindling. * MNYou hear the murmur of conversation and laughter in the background, the hiss and pop of the hearthfire, the creaking of the wooden floorboardsN>I  EN6, and the songbird piping melodically from its cage.N. + You drink in a deep breath of warm tavern air. It smells of smokey wood, and cooking food with the slightest edge of burning, of old dying flowers, and the musty scent of old men. It smells not of you, but of mortality and excitement.NMN>|" ]NNYou decide to wait for the rest of your companions before wandering outside.NYMN>|" ]NNYou decide to wait for the rest of your companions before wandering outside.NR You drift up the stairs and along a darkened, narrow hallway bordered by empty doorways. The sleeping quarters manage to be both barren and cramped at the same time, thin-walled and tucked up under the eaves with nothing but straw pallets, wooden washing bowls, and chamberpots to occupy them. There's nothing of interest, no one would leave anything of value up here. You return to the tavern below. S ^^You wander down the few narrow wooden steps that lead into the cellar. It's slighter cooler here and smells of dank earth and potatoes. Crates and barrels full of vegetables and bottled liquor are piled up in the shadows. You find the spuds sitting and gossiping around the fire far more entertaining than these, and so return to the tavern above. MNvPhazing through the walls now would cause quite a stir. Amusing, but you're not quite ready to reveal yourself yet. GMO actorN~>  E<" N~|A gasp ripples through the tavern as you wander through the door with the shadow dog still firmly attached to your leg. The two old men leap to their feet and reach for their canes while the Layna and the tavern maid rush frantically about the room. \b A flurry of activity ensues as various tavern denizen's pick up whatever is at hand and commence whacking at the dog to try and pry him loose. The shadow dog snarls and growls at them all, but his jaws remain steadfastly entrenched in your leg. Finally it is the tavern keeper who comes out of her scullery and brains the thing with her heavy iron skillet. The shadow dog yowls and rushes back out the door, yipping in consternation the whole way.\b "Good gods, man, are you quite well?" asks the tavern keeper as she shakes the skillet back and forth. \b "Fine," you reply. "Tis only a flesh wound," and you hobble to a nearby table. \b!>)N~>"" N~C:)HN~J" E J  E >;" 4N~Silence descends upon the room as you enter it. And then comes an uproar of laughter. \b "Methinks you don't quite have the figure for that dress," says !>FI.\b "Might look a bit better on the ol' tavern maid than on you," says !> in between his cackles. \b";)N~K" E K  E> > E >  E ><" N~\^!>Fn gives a low whistle as you enter the tavern clad in full armour. "Now that be what I call a tin can!" says !>F. \b"<)=: MN(<(K Np\b"Everyone is has returned so soon... and here I was afeared that I'd be lonely in here all by myself," says !>F$. \b "Oh hush you, old man," says !>g. "The fey was actually there flingin' things around to high heaven! And a mage bein' there to boot!" NX\b"From what I heard you turned tail long before the mage revealed himself," chuckles !>Fb. \b "At least I went out the door, which is more than can be said for your lazy self!" retorts !>. N N=\b"Turning back truly was the only sensible thing to do..."b NS N,\b"I wonder what the mage is doing here?" !>w finally speaks. \b "He's here for a fey meatpie, would be my guess! That's where they be gettin' their powers from!" N\\b"I wonder how one eats a fey anyway? They don't have no real bodies, supposedly," muses !>A. \b "I could live a long happy life without ever knowing how!"NNNV\b"I never heard of no mage called 'Val'...I wonder if that be his real name?" says !>0. \b "Are we going on about true names again?"N\b"Well I was saying...mages like to show off their powers by letting all and sundry know their names! In fact they like names so much they're always adding extra bits to it! No mage named Nob...no they're Lorekosi or Fiddedilikins or something. Tis odd to meet a 'Val'..."NC\b"Mayhaps he hasn't earned the rest of his syllables yet," says !>F with a chuckle. N\b"Fiddediddidy?" asks the tavern maid as she bustles asbout her. "Aye, well maybe I made that one off the top o' my head," says !>.NNN:\b"That reminds me o' a story..."\b"Great gods," groans !>F. breathing reminds you of a story!"\bTNEN6N\b"As I was sayin'... this reminds me' of the story about the pooka, the black devil horse who used to lure people to ride upons its back and then, lickety split, it would run off into the lake or the seas or whatnot and drown them all!"N 1N O\b"I fail to see how that has anything to do with anything at all!" exclaims !>F as !> giggles. N \b"It simply reminded me about how the pooka used to defeat the traps of the mages by warping their patterns. Aye, well, how about this one..." ND\b"There was this hunter who came across a great white she-wolf--"NB\b"Not that one! You've told six times today already!" exclaims !>F.\NI\b"Is that so, well, how about the one about that there nightengale..."NC\b"You truly ought to have gone out hunting with the mage," says !>Ft. "You could have bored the fey to death until it begged the mage to come and eat it to put it out of its misery!"5NR\b"You are simply jealous that you can't tell a story half so fine as me," says !>. C:@H   T m ow i()MN&(<(KqN'N*\b"So you'll be gallivanting off just like that?" asks the other old man. \b "'Course not," says your old companion. "We'll need provisions first!" \b "I still have my traveling pack with me," the maiden adds. N,N/\b "It would be wise to pack lightly," the pale haired stranger warns. "The fey can turn the land against you, and if you carry around too much you'll sink like stone if we stumble across some swamp or marsh." \b "Ah yes, yes, o' course," agrees the old man. N1N5\b"We be needin' some weapons, at the least," says the old man as he wrinkles his forehead and looks all about him. "Hmmm... I suppose my dinner knife will have to do." he says and holds up said dull-looking knife to the light. \b "Oh lords..." says !>F& \b "I have my walking staff," adds !>". \b "And I have a flute," says !>. Silence falls for a moment as everyone turns to stare at him. \b "Tis a very good flute!" he says. And then everyone turns to you. \bN; N=N>(\b "And secondly, our clothes," says !>. "Maybe some proper change o' clothes too. From what I heard, the fey likes to steal people's clothes. " \b "What? What use could a fey have for clothes?" says !>^. \b "Collectin' them? Or mayhaps it just likes to see people run around starkers?" replies !>b. \b "And that's the real reason you're so enthused to be running off with these young people," !>F- says dryly to his softly cackling friend. ND NGNIM\b The tavernkeeper wanders out of her scullery for a moment and places fisted hands on her ample hips. "Not again!" she says. "More balmy people rushing out into the fey lands again? And not no one has ever come back with treasure!\ Came back with enough bruises and gray hairs though! And you..." she points one thick finger at !>* "You ought to know better!"\b The old man simpers at the tavern keeper, who sighs and turns her back on the room once again. "Forty coppers," she calls back. "For the grand heroes to rest their heads in my beds after they've had their bums handed back to them by the fey." \b "Pay her no mind," !>^ says airily. "Always been like that since her husband up and ran away. "\b "He died," says !>FA.\b "Like I said, ran away. Can't run any further than death!" NQ<NSNU,\b "We'll be needing some food as well," !> says as he ticks things off upon his gnarly fingers. \b "There's plenty of stew left in the pot," says the tavern maid. \b "Not any," !>H gainsays. "Not unless we're planning to poison that there fey." \b \^!>s backs away from the rest of your chattering companions and wanders towards the paintings hanging upon the wall. N[N]Nat\b "How about those apples in the barrel outside?" suggests the tavern maid. \b "Ah, very good, very good," says !>u. "That's food, weapon, clothes... are we forgetting anything?" \b "You'll be needing forty coppers a piece," says !>F] dryly. \b Meanwhile, the young stranger admires the paintings along the opposite wall. \b Ne NgNi/\b "Have I mentioned that you're all daft?" !>FW asks the room at large. \b "Ah, you're getting all curmudgeonly in your old age!" \^!> claps his friend upon the back. \b "I'm five years younger than you!"\b The cloaked stranger's attention is still caught by the paintings.NoNrNt\b "Well, I suppose that be it. We should be on our way... with a little stop to replenish outside o'course." and so saying, !>@ gathers together his things and walks purposely outside.\b \^!>D looks doubtfully about the room for a moment before following. \b>>xNvNz\b The young man finally pulls away from the paintings. He glances back at you one last time before following the other outside. \b "If you had any sense, you'd remain here too," says !>F \b>C)L wW %%MO quipnoN3KfN3)I'll pick something up along the way...eN3I have my wit and charm...<N3CI'll throw myself upon the mercy of the dinner knife and flute...N3I am my own weapon...N3 Whoever said I possessed that?N3Mind your own business...sN3#Your warnings are wasted on me...CN378U{MO quipnoN5KoN5\b"I'll pick something up along the way," you day with a casual shrug. \b "You truly ought to have at least something to defend yourself," the !>8 says doubfully. \b "Here, have my dinner knife" says !>F with a slight sigh. \bL&QN5d\b"I have my wit and charm," you say with a bow and slight flourish of your cloak. \b "Oh lords.."!>F moans again.\b>##oN5v\b"I'll throw myself upon the mercy of the dinner knife and flute," you say. \b "And what of me and my staff?" asks !>s. \b "Nay, not you," you say with a wink. "You actually have something that might be considered a real weapon."\b>##N5h\b"I am my own weapon," you state boldly as the others blink at you in confusion. \b "If you say so," !> says doubtfully.\bBN5?\b"Whoever said that I possessed that?" you ask lightly.\b \^!>Fk heaves a great sigh. "Well, you're in fine company there, at least," he says and nods a farewell to you."|FN5;\b"Mind your own business, old man" you coldly brush off !>FT. \b He gives a shrug and turns back to the fire. "Can't accuse me of not trying.""|eN5/\b"Your warnings are wasted on me," you tell !>F. "Although perhaps not for the reasons you think." \b He heaves a sigh. "Well, if you're so determined, I wish you luck. You tell that old man out there too.""|CN57 [F[aF[aF[  A young maiden, no more than twenty, with porcelain skin and pale gold hair that falls smoothly to her waist. Her eyes are large and silvery grey, her bones are light, her stature small, and yet despite this, she does not have an air of fragility about her.MO actorN*BNMO actorNNDN>" cNNEN\^!> looks mildly disturbed when you flutter up to perch on your small shoulder. With a loud coo you wrap your wings around her neck.\b "It's either embracing you or trying to strangle you," says !>FA "I can't rightly tell which. " \b "Charmed, I'm certain" says !>( as she tries to pry you off her head.ZNNGN>" FNNHNYou wander up behind the maiden and wrap your arms around her slender body. She is warm and soft and fits snugly within your grasp. \^!> blushes deeply as she leans against you for a moment before pushing herself away. \b "Rather forward, are you not?" she asks, perhaps not as cooly as she wished. NNJN> > 2NNKN&\b"And now I'm jealous," teases Val.NNLN> > E> > :NNMN"O' which one?" asks !> slyly. 5476MO actorNPNMO actorN$RN>  bN$SNSLobbing random people around the tavern might raise a few suspicions. Just a few.N$TN>  N$UN(With your mind you reach out and take !> who yelps loudly as she begins floating through the air. She remains hanging there as you decide exactly what you were supposed to do with her now that you have her, until Val steps forward. With a wave of his hand, !>$ is wrested from your lax grasp and wafts delicately back down into his waiting arms.\b For a moment the maiden clings to the young seeming man. You seeming because if he had the power to thwart you, no matter how smally, then he is far more than that...\b "Was that the fey?" gasps !>. "And then you... brought down..." The girl's eyes widen as she stares up at her rescuer. "You brought me down... which makes you..."\b "A mage?" Val says lightly.\b !> recoils back from him. "I may not have much experience with fey, but I have had a bellyful with mages. As for mages on fey hunts..." the maiden draws back with an impreceptible shudder. "I believe I shall take my leave now. Good day to you both," she says and makes a beeline for the relative safety of the tavern.\b "More afraid of me than of the fey," say Val as he watches the maiden leave. \b "From what I've heard of mages, that seems to make sense to me," you reply. "Oh really?" asks Val. "Then some time we should speak of what I have heard of the fey and what you have heard of the mages." Then with a slight nod to you, he pulls his satchel higher along his back and starts off for the northwest. N$\N>>&>!"MO actorN ]N4zMO actorN ^N<With your minds eye you peer into the contents carried by !<... !.MO actorNv _NMO actorN aN>" 4N bN)With a loud "KRAWK!" you flutter up to !> and perch upon her shoulder. The maiden stills as she stares at you with wide eyes.\b "Now y've got a new friend!" calls out !>S. "I can think of better omens then making friends with a carrion bird," replies !>. N eN>  E >" rN fNcAs she's currently standing and you're currently in human form, that would be a bit problematic. N hNYou wander over to !> and nonchalantly plop down into her lap. Then you are nonchalantly pushed off unto the floor. \b "What do you think you are doing?" !>%. \b "He be fallin' for you!" says !> with a cackle.N jNNMO actorNlN>" E >  NmNWith a cackling croak you sweep into the air, criss crossing the room as you carefully build up speed, faster and faster until you suddenly swoop down and attack, pecking and scratching at !>. \b There is sudden pandemonium in the tavern as the tavern maid screams, the two old men leap shouting to their feet batting wildly at you and overturning benches and tables in their wake, and !>' dives into her travel satchel to pull out a SOMETHING. "The demon bird is attacking! " the tavern keeper comes lumbering into the room, her handy scullery skillet in hand. \b You merrily lead everyone in a chase round and round the room, stopping every now and then to divebomb your prey. \^!>  runs face first into a wall, several pots and plates are thrown, some of them even hitting (others, ofcourse, never you), and everything is in shambles, all except for the lone table where the drunkard still slumbers peacefully. \b "DEMON!" the tavern keeper shrieks as you are finally chased out of the tavern window. With a BOOM of finality the shutters are slammed closed behind you. \b You wing your way back to perch on the window ledge and carefully preen your feathers. Looks like you might have to avoid the tavern for a little bit. NwN"i>NyN>  uNzNfIn front of everyone? That's not quite the reputation you were hoping to build for your human form. )N|N>  N}N<JMO actorNNIMO actorNN>" NNC"KAK KAK COA!" you screech at the top of your avian lungs within !>@'s ear. She yelps and tries to brain you with a nearby plate. yNN>" eNN&You rant on about meddling mages to !>& as she gawks up at you in surprise.NN>  VNN"Too much to drink," says !>F! with a sad shake of his head. uMO actorNkNUMO actorNN>" NNYou perch atop !>['s shoulder. She shoves you off impatiently as you begin to scratch and peck at her arm. 'NN>" NN<MO actorNiN <MO actorNNYou agree with !>\MO actorNN[?MO actorNNYou disagree with !>MO actorN8NNMO actorN\N>" N\N<UN\N<\MO actorNNMO actorNN>v" NNYou flutter up to !> and rub your feathered head against her. She is soft and warm and smooth to the touch. She is also currently trying to shove you off her shoulder. NN>" NN"You carefully edge over towards !> and surrepticiously run your hands over her shoulders and down her chest. She is soft and smooth and... stinging as she backhands you across the face. \b "I beg your pardon!" she snaps at you.NN> > NNw\b"Now, lad, that's a very rude thing to do to a woman!" he says. \Now if you come over here and do that to me--oof" !>'s words cut off as !>F jams an elbow into his side. MO actorNNMO actorNN>" SNN\^!>3 looks over uneasily as you grin beakily at her. tNN>" `NNYou smile enigmatically at !>*, who blushes slightly and smiles back. [MO actorNN\MO actorNN>" NNYou flap over to !> and pinch a clawful of skirt covered flesh in between your talons. She gives a squawk worthy of any bird and bats you halfway around the room. NNYou wander past !> and surrepticiously reach out and pinch her rump. For your trouble she straightforwardly reaches out and punches your nose. MO actorNN;MO actorNNThat thought is confusing./MO actorNN.{MO actorN N\^!>K breath softly goes in and out as her clothes rustle with her movements. ,MO actorN N-MO actorN NHer smell is... pleasant. There is the faint impression of road dust and sweat, yet also the scent of clean water and of roses.MO actorNd!NdMO actorN!N>" N!NYou flutter over to !>, fluff your feathers, and proceed to coo up a storm as you pepper her throat with soft pecks. \b "Friendly, isn't it?" says !>V as she tries to shoo you away.\b "Seems to be gettin' quite a taste for you," says !>.N!N>" HN!NYou edge carefully over to !>, stealthily stalking the maiden until you see your chance and swoop down upon her, pressing your lips against hers. For a moment she melds against you before pushing away, giving your cheek a light slap. \b "Impudent!" she calls you as she rubs her lips with her fingers.N!N> > 4N!N(\b"Now I am truly jealous," says Val. N!N>" gN!N2"If she's not willin', you can come over here!" !> calls out with a cackle. MO actorN$NGMO actorN%N(An attractive thought... maybe later. @MO actorNc%NMO actorN%N>  N%NYou stride up to !>v and begin pulling at her dress. She backhands you forcefully across your face. "Mind your manners," she tells you. {N%N>" N%NYou land atop !>U and begin pecking at her clothes. She shrugs her cloak tighter and shoos you off. N%N>  N%NWith an inwardly wicked cackle you reach out with your mind and snatch all the clothes off of the young maiden. She looks down upon her pale pretty skin and and lets loose such a scream that the sound of it actually sends you staggering back a few steps. \b "Don't look!" she yells at you and Val. "Don't you dare look at me!" and she begins throwing stones at you. Apparently she means to blind you as one stone glances right across your lid and eyebrow and would have caused quite a bit of damage if you were truly flesh and blood. \b "Please calm down!" says Val, who has half turned away. And half crouched as well to try and avoid being stoned to death. "Milady..." he pleads and then curses as a particularly large stone bounces off his head. "Enough!" Val says as he stands upright and the stones around him freeze and hang within the air. Then all eyes are turned to the cloaked stranger as he waves his hand sending the pebbles clattering to the ground once again. \b "You are... a mage," says !> as her eyes open even more widely. And then she realizes that she is still naked and gives one last little shriek before diving inside. As the door slams behind her the sound of further yelps mixed in a few cackles can be heard from within. \b "More afraid of me than of the fey," says Val. "More afraid of me than of being embarrassed about wandering around naked..."\b "Makes sense to me," you say. "Nothing wrong with running around naked."\b The mage turns to you with a wicked little grin. Oh yes, he was going to be interesting. Perhaps even more interesting than you could could hope to stand.\b "Shall we be off then?" asks Val as he hefts his satchel upon his back. And so he sets off for the northwest. N%N"&>!">"wMO actorN.NMO actorNC.N>  E >" )NC.NYou !> perchsit] in stillness, eyes demurely cast down, not a single twitch of a muscle nor a flutter of a !> feather cloakS to bring a bit of attention to you. And yet you sense the intensity of the gaze !> turns upon you. >NC.N>  (NC.NYou !> perch stand] in stillness, eyes demurely cast down, not a single twitch of a muscle nor a flutter of a !> feather cloakS to bring a bit of attention to you. And yet you sense the intensity of the gaze !> turns upon you. xMO actorN0NMO actorN1N>" N1N""KAK KAK KRAK COA!" you sing to !>R who half grimaces \b "I know the bird cannot help the sound of its song yet..."N1NYou !<@ to !>^ who smiles demurely at you. \b "Nothin' like a good serenade to win a woman's heart," says !>: "Even if the singin's not so good."\b "Hush you," says !>. "His singing is... fine."N1Nsing a little ditty lilt out a love songcroon a soft lullabye chant an ancient lament !warble out a high pitched tune %sing about a bird in a gilded cage yMO actorN3N:MO actorN3O>" N3O\^!> bats at you wildly as you flutter atop her head and fuss about with her hair. "It's trying to build a nest in my hair!" she exclaims. \b "That reminds me o' the story about the lady who's hair grew so long that bees and birds started nestin' in it..." says !>I. \b "I hardly think the lady is in the mood for one of your stories," !>F interrupts. pN3O>" \N3O\^!> gazes at you half in perplexity and half in wariness as you run your hands through her long, silky hair. With a few deft twists you have plaited a slender braid amongst the tendrils. !>y laughs softly as she holds it before her eyes. \b "My mother used to braid my hair when I was little," she tells you. N3O"zMO actorN6O^MO actorN 7 O>" DN 7 O5You flutter your wings to no effect at the maiden. JN 7 O>You wave slightly at the maiden, who smiles and waves back. {MO actorN7ONMO actorN7O>" N7O["Aren't you the cuddliest wuddliest little wittle pretty witty girlie ever?!" you coo at !> as she carefully back away. N7O)"kak kak krak coa coa coa!" you coo at !>1.\b "The ol' crow thinks he's a lovebird now!" !> laughs. N7Ob MOwordlstN;9OKN;9ON;9ON;9ON;9ON;9O"The seas?" !>c asks. "I did pass by a bay in my recent travels. It looked much the same as a large lake to me. "N;9!ON;9"ON;9#O2"Myself? I am merely a wandered at this point." !>A laughs dryly. "I have been displaced from my home... or rather I displaced myself. I suppose I should simply settle down in a nice town somewhere and become a weaver." She shows her hands to you, slender calluses threaded through her fingers. "Or I could be dairy maid for all I care. As long as I am free of Wakanda.""N;9%ON;9&O8"Wakanda is the city from whence I once hailed," says !>!. "My family has been living there for many generations. Or been trapped there I should say. Some poor ancestor of mine was in the city during the revolution and well... no one was able to leave once the mages had taken charge. Wakanda, the splendid city of magic." She laughs bitterly. N;9'O"N;9)ON;9*ON;9+ON;9,O"Mages? I have had a bellyful of them my entire life! Crawling all over Wakanda, taking whatever they wished, and nevermind if you ever got in their way. Magic is all well and good if you control it, but when it is used to control you..."N;9-O"N;9/ON;90ON;91OY"I know not what is his story... he has been like that the entire time I've been here.""N;94ON;95ON;96Ob"That's one of those magical bird, is it not? The one that bursts into fire every now and then. "N;98ON;99ON;9:O3"Another magic bird. I know little enough of it. "N;9O"The shadow prince? They say he is nothing but a legend, yet the mages were in quite an uproar when the rumor said he was heading towards Wakanda. "N;9@ON;9AO"From what I can tell, the werewolf is merely a child's tale to be told around the fireplace. For certain there are fey who can take the shape of wolves and men, but a mortal man becoming half wolf?""N;9CON;9DON;9EO3"My mother used to grow roses outside our house.""N;9GON;9HON;9ION;9JOcFor a moment you are suddenly overtaken by the urge to blurt forth your true name. Utter madness!"N;9LON;9MON;9NON;9OO0"I would be wary of him, if I were you," says !> as her delicate face crinkles in dismay. "It may not be fair to judge all mages by what those in Wakanda are like but still... tis not right for one person to have so much power. Tis more likely for that person to crush normal people like us underfoot, even if they don't mean it.""N;9QON;9RON;9SON;9TON;9UON;9VO"From what I have heard they are not mages. They have no true powers but are simply people with a good knowledge of herbs and remedies. "N;9XON;9YON;9ZO"\^!>D blushes a pretty pink. "Why are you asking me this?" she says. \b"N;9\ON;9]ON;9^OR"Tis when two people who love each other... oh, surely you know all about this!""N;9`ON;9aON;9bON;9cO%"Powerful magical creatures," says !>. "The mages were always going on about catching one. Supposedly, one has been caught and chained to the city Anrui and its blood now powers their magic. "N;9eON;9fON;9gON;9hON;9iON;9jON;9kOS"You... I...I should think you would know much more about yourself than I!" says !> as she faintly blushes. "N;9mON;9nON;9oO["Love... love is something beautiful. When you care about someone more than yourself..." !>8 smiles faintly, her eyes turned inward and far away. "N;9rON;9sON;9tON;9uON;9vON;9wON;9xON;9yON;9zON;9{ON;9}O!"Hate is the opposite of love. "N;9ON;9ON;9ON;9O"\^!> looks at you in confusion. Enemies are... the bad people? No, that's not quite right. I'm not certain what you want of me regarding this. "N;9ON;9ON;9O"Names have power, names have power...that's what everyone repeats. Yet I've never seen this power of names. The mages certainly fling their names about with impunity. My name is Layna and I don't see how anyone else's knowing it could bring me any harm."!"N;9ON;9O"A magical creature, in the shape of a horse with a horn upon its head. Although that's not quite right... it resembles a horse the way that a raindrop resembles a lake. A beast of healing and love, or so they say. "N;9ON;9ON;9ON;9OY"A nice enough place, I suppose. Far better than bedding down by the side of the road!""N;9ON;9O"Capricious creatures with no true shape or form. They like hoarding things and playing tricks upon humans, although some 'tricks' can be quite deadly. They are the enemy of the mages, so I hold no rancour for them. Truly... I feel a bit sorry for them," say !> while you look on in some surprise. \b"They are trapped within their own lands the same way that I was trapped within Wakaba. Although, I suppose they don't view it that way, themselves, what with having the lands obey their every whim," the maiden laughs shortly. \b"I suppose they are a bit like the mages in that way. And yet, they are hunted by the mages, to the very end, to have their own powers consumed. And being stuck on their own lands, they cannot run away...""N;9ON;9ON;9ON;9ON;9ON;9O"In Wakanda crows meant ill luck. Good news was sent via pigeon and bad luck via crow. But good or bad, they were still useful enough. "N;9ON;9Oz"Another mage. He's is fine, I suppose. That is to say I can't recall any atrocities particularly attached to his name. "N;9ON;9O"One of the mages who often frequented Wakanda. He looks harmless enough, but he is a cruel, cruel man. The tales of what happened to those poor souls who crossed him the wrong way... it's enough to chill the blood. "N;9ON;9OE"One of the most powerful of all mages, or so I have heard. " says !>B. "Apparently her ill-will bodes very bad for her fellow mages. "N;9ON;9O0"Another mage... I know not much else of him,""N;9ON;9ON;9O"That man!" \^!>[ gives a sniff. "That scoundrel has been rushing about pinching rear ends all day today!""N;9ON;9ON;9O"\^!> glances at !>FY. "There's not much I can say about him that you couldn't find by asking him yourself. "N;9ON;9ON;9ON;9O"\^!>y glances up at the tavern maid who is bustling about the room. "If you want to order food or drink just call her over.""N;9ON;9ON;9ON;9O("I would simply stay out of her way," !> advises. "Vseaseasocean oceans maidenlayna wakandamagesmagemagicdrunk drunkard phoenix firebird gryphoni griffenfshadowprince werewolfBrosesrosexyzzyX yournameTmynameRval strangerpookiewizard#hedge-wizard wizardryhedge wizardhedgekiss kissing marriage  marriedanruigdragone dragonsb snugglebums>you? yourself;me=myself;self;love belovedrancormenmitykgrudgei antagonismc animosity^malice\ loathingX abhorrenceRhatredPhateP antagonistyenemyx villainuname"names! unicorn4 wayhouseinntavernfey~ravenxcrowxcrowswravensu blackbirdp trevalkian lorekosi keilantrah deleriancootD oldcootAmanoldmanmaidY tavernmaidS tavern maidLkeepertavernkeepertavern keeperN;9O!c """I fear I know nothing of that."!OMNO<!" NOLayna#NOthe maiden in shadowsOMNO<!" NOLayna#NOthe maiden in shadows,MMNO<!" NOLayna!NOa maiden in shadows MMNO<!" NOLayna!NOa maiden in shadowsMkMNO<  ENO\n\^!># fiddles with her traveling pack.NOh i +34JKBLCNLNJI6P[Q\[\}[~\R[S\@)  foo room It's the foo room! This is where everything will be stored, as shuffling things off to nil might introduce some complications. MO quipnoN<:KN=:)I don't think you have the fortitude...hN>:In your dreams...HN?:What a repulsive thought...^MO quipnoNB:K"NC:\b"I don't think you have the fortitude for that, mage!" you say as Val laughs. "Are you planning on tiring me out then?" he asks.>##gNF:t\b"In your dreams!" you retort. "Or maybe your nightmares."\b "Depending on your mood, eh?" says Val with a wink. NI:[\b"What a rather repulsive thought" you say as the mage mockingly clutches at his chest. Y||MOfromtoO liNN!N@&eadX.)z{' White Willow ForestMN>  E   0N!\(White Willow Forest Blazing\)N>  E >  <N-\(Charred Remnants of White Willow Forest\)%N\(White Willow Forest\)+MN>  E >  -N!The sweet scent of burning woodN>  E >  ;N,The smell of char and ash, sweetly scentedfNZA faint perfume hangs in the air, not quite floral and not quite belonging to the trees.*qMN>  E >  8N)The crackle and roar of a fiery blaze. N>  E >  8N)Silence but for the quiet fall of ash. YNM\b The wind sighs through the trees and the trees murmur back to the wind. N>I  LN@A lone songbird warbles into the chorus of the wind and trees.MN>  E >  NuThe wood blazes all around you, the air heavy with plumes of dark smoke, and the trees wreathed in leaves of fire. N>  E >  NThe charred remains of your once pale forest. All is dark devastation, ash and broken kindling, wetly dripping like the fall of tears.  N\b A forest of widely spaced white barked trees stretches before you. They are birch and willow, some weeping, and all of them with pale, translucent leaves. Branches full of soft colored flowers entwine high above you, forming a canopy that blocks out most of the sun. \b A faint glint of water can be seen through the trees to the far north and the forest tapers off into green grounds to the west and red earth to the east. \b Petals delicately float down to the ground as the trees whisper to each other. N>I  TNHA single songbird sings joyfully from far atop a nearby birch tree. \bN| 9N-A herd of deer grazes amongst the trees. \bN>| E >  nN_The herd of stags faces down the shadow dog, rows upon rows of antlers menacingly lowered. \bN \bOMN>" mNXYou step out beneath the trees and return to the remains of the tavern to the south.\bcNQYou step out beneath the trees and return to the waiting tavern to the south.\bWMNYou gaze defiantly towards the west, where your domain turns imperceptibly into those of another. A lance of pain shimmers through your body as you step over your border and into the lands of the Beast. \blVMNvA flutter of excitement, a flicker of madness fitfully sparks in your heart as you brashly step unto man's road. \buNMNYou wander northward, following the glint of water that lies ahead of you. The trees fall away as the ground begins to gently slope downwards. \bmUTPMN>vg" NAs you travel east, the green of growing things gives way to barren red earth. Before you stand the red archway, nearly entirely blocked by a tumble of red stones. You give a slight shrug and phaze through the rock and into the surrounding red hills. \bNAs you travel east, the green of growing things gives way to barren red earth. Smooth curved hills rise all around you as you pass underneath an arch of red rock.\bQwMN_You slip out of the trees and into a low-lying meadow that stretches far into the horizon.\bS You sink into the embrace of the earth. Quiet serenity as your land cradles you close-- but now is not the time to rest. You climb cautiously to the surface, making certain no mortal eyes see you emerging from the earth.R {{You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.p...)' Sculpted Hills \(Sculpted Hills\)+ vvYou inhale a deep breath... and end up coughing it out again as a swirl of wind blows red dust back into your face. * The wind sings through the stone and a melody is risen, keening high and then low. Something beautiful but very lonely. The sound dies away with the wind. .MN3B\b The grass grows sparser as the shape of red rock hills comes into view. The hills rise one upon the other, their shapes smooth and ornate, as if sculpted by a giant's hand.\b Directly before you rises a cliff with a mirror inset into its cleft, and behind it another hill shaped like a lion with its teeth bared. Towering above all is a narrow lichen-covered promontary that resembles nothing so much as the perfect spiral of a unicorn's horn.\b The knolls overlook the road to the south and east and the dim shape of a forest can be seen to the west. A tall red archway !><6filled with a shimmering light stands to the north. PMstands to the north through which an ever changing glimmering can be seen. B \b A faint haunting melody can be heard playing on the wind. \bOMN3>M" E >M  cN3TYou stagger about as the hills shake around you, unable to maintain your footing. N3The path lies tantalizingly before your eyes, seemingly so ordinary and drab with its unpaved and uneven surface. A flutter of excitement, a flicker of madness fitfully sparks in your heart as you brashly step unto man's road. \buWMN3>M" E >M  cN3TYou stagger about as the hills shake around you, unable to maintain your footing. N3uVMN3>M" E >M  cN3TYou stagger about as the hills shake around you, unable to maintain your footing. N3The path lies tantalizingly before your eyes, seemingly so ordinary and drab with its unpaved and uneven surface.A flutter of excitement, a flicker of madness fitfully sparks in your heart as you brashly step unto man's road. \buNMN3>M" E >M  cN3TYou stagger about as the hills shake around you, unable to maintain your footing. N3>vg" vN3XYou give a slight shrug and phaze through the rock and into the green lands beyond. \bN3uN3iThe rainbow bedecked fountain is framed perfectly within the red archway as you pass under the stone.\bUMN3>M" E >M  cN3TYou stagger about as the hills shake around you, unable to maintain your footing. N3mT Uninhabited fields and trees stretch out before you. Undoubtedly there are animals and humans who live somewhere on this land, but no fey has possessed it for many years. You've been steadily pressing your influence upon it, in a contest between you and the other surrounding fey.PMN3>M" E >M  cN3TYou stagger about as the hills shake around you, unable to maintain your footing. N3The path lies tantalizingly before your eyes, seemingly so ordinary and drab with its unpaved and uneven surface.A flutter of excitement, a flicker of madness fitfully sparks in your heart as you brashly step unto man's road. \buQMN3>M" E >M  cN3TYou stagger about as the hills shake around you, unable to maintain your footing. N3>vg" vN3XYou give a slight shrug and phaze through the rock and into the green lands beyond. \bN3N3~You walk through the red stone arch and circle around the sculpted hills, towards the bulk of a pale forest to the east. \bS You sink into the embrace of the earth. Quiet serenity as your land cradles you close-- but now is not the time to rest. You climb cautiously to the surface, making certain no mortal eyes see you emerging from the earth.R {{You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.TTT. { iridescent seashell A seashell of an iridescent milky white and delicately whorled. Its spiral shape is no bigger than a gold coin and is half buried within the red rock. -7MO actorN/4A faint tang of salt. /MO actorN04.MO actorN<14hSupposedly you can hear the sea when listening to a seashell, but this one is far too small for that. MO actorN34qMO actorN54You gently run your !> claws  fingersH along the shell's pale surface. The seashell flashes brilliantly and N64<" N74rthe view of your lands fades back in as the light dies away. A rainbow arches from the sky to end at your feet. !{&/N84>  N<4^a fitful light fills the hollows of the archway as the rainbow bridge dissolves into the air. \b You hear a soft inhalation from below. You peer over the edge of the arch to behold Val standing in front of the glowing portal, his eyes reflecting the shimmer within them. The mage reaches out towards the flickering of light, draws back, and the shrugs and laughs.\b "An invitation, I suppose," he says. "And who am I to turn it down?" And thus saying, the mage steps within the light and disappears. \b You smirk to yourself. It has been quite awhile since anyone besides yourself entered the trap room. ""|>&|>C||N>4`a fitful light fills the hollows of the archway as the rainbow bridge dissolves into the air. ">&MO actorNA4MO actorNB4ZYou climb atop the clefted cliff and from there unto the taller hills surrounding it. \bv>X.$$. sutras,  the sutras Thin strips of parchment long as a man's hand yet three fingerswidth wide. Strange flowing symbols have been inked in black all along their lengths. Somehow they are clinging to the pale bark of your trees. MO actorNMO actorN4A shock travels up your !>talons handd when you touch the sutra. Warded, strongly, too strongly for you to remove it this way yourself. TMO actorNUMO actorNA shock travels up your !> beak hand_ as you peck at the sutra. Its too strongly wardered for you to remove it this way yourself. ZYLNPQ =op[\32}~VWJEJEJEJ)' Pebbled Courtyard \(Pebbled Courtyard\)+XMNU >" ENV 6The smoke of burning wood hangs heavily in the air. NX The scent of overripe apples fills the courtyard and beneath it the musky smell of horses in hay, of stagnant water, and dusty stone. And fainter still, the scent of eternal green things, the scent of magic, the scent that is your power.*MNZ >" N[ A heavy silence fills the courtyard. Even the knot of onlookers gawking at the remains of the tavern keep within a quiet huddle. N] \b The rustle of activity fills the courtyard. The whicker of horses, the clanging and clicking of people going about their work, and the overheard mutterings of those travelers leisurely resting inside. MN_ >" Nd >\b Pebbles crunch loudly underfoot as you step unto the tavern's courtyard. The gutted remains of the burnt out tavern continues to smoke before you. Nearby stands the empty stable, its roof severely singed and its horses fled to who knows where. The useless thick round-mouthed well stares forlornly at you, bereft of the other items that once decorated the courtyard. \b Further off, to the distant north, the murky outlines of a forest can be spotted. The pebbles sparkle and grow brighter as they lead away from the tavern into the forest's depths. \b Two old men and !> stand in a big eyed huddle close to the road, periodically staring over their shoulders or gawking at the place where the tavern once stood. \bNj \b Pebbles crunch gaily underfoot as you step unto the tavern's courtyard. Soft whickers and rustlings can be heard from the nearby doorless stable. A horse trough squats near at hand while a thick round-mouthed well can be seen further off.\b The sweet scent of overripe apples tinges the air, coming from the rickety barrel that slumps against the tavern's back wall. Around the corner a sign hangs silently from the side of the building, easily seen from the road to the east. Further off, to the distant north, the murky outlines of a forest can be spotted. The pebbles sparkle and grow brighter as they lead away from the tavern into the forest's depths. \bNl >h" `Nn TA large irregular scorchmark mars the stony ground in the middle of the courtyard NMNq >"" ZNr KIn a moment, you've not quite finished playing with your companions yet. Nt You head north towards the pale treeline. In one step there is nary a tree in sight and in another you are within the dusky shadows of the forest.\bUMNw >"" ZNx KIn a moment, you've not quite finished playing with your companions yet. Nz TMN} >"" WN~ KIn a moment, you've not quite finished playing with your companions yet. N >vg" N As you head to the northeast, grass gives way to barren red earth. Before you stand the red archway, nearly entirely blocked by a tumble of red stones. You give a slight shrug and phaze through the rock and into the surrounding red hills. \bN {As you head to the northeast, grass gives way to barren red earth. You circle steep hills and pass under a stone arch. \bMN >"" ZN KIn a moment, you've not quite finished playing with your companions yet. N uA flutter of excitement, a flicker of madness fitfully sparks in your heart as you brashly step unto man's road. \buQSMN >"" ZN KIn a moment, you've not quite finished playing with your companions yet. N You gaze defiantly towards the west, where your domain turns imperceptibly into those of another. A lance of pain shimmers through your body as you step over your border and into the lands of the Beast. \blXMN >"" ZN KIn a moment, you've not quite finished playing with your companions yet. N >" QN <You carefully step into the burnt wreckage of the tavern. N >8" E >" N Your games have caused you to be banned from the tavern today. Best not to try your luck by entering once again in human form. N >i" E >" N Your games have caused you to be banned from the tavern today. Best not to try your luck by entering once again in human form. RN @You once again duck into the shadowed warmth of the tavern. \bOMN >"" ZN KIn a moment, you've not quite finished playing with your companions yet. bN >" QN <You carefully step into the burnt wreckage of the tavern. N >8" E >" N Your games have caused you to be banned from the tavern today. Best not to try your luck by entering once again in human form. RN @You once again duck into the shadowed warmth of the tavern. \bj'MN >"" ZN KIn a moment, you've not quite finished playing with your companions yet. N >" QN <You carefully step into the burnt wreckage of the tavern. RN @You once again duck into the shadowed warmth of the tavern. \bSZMN >"" ZN KIn a moment, you've not quite finished playing with your companions yet. N You sink into the embrace of the earth. Quiet serenity as your land cradles you close-- but now is not the time to rest. You climb cautiously to the surface, making certain mortal eyes see you emerging from the earth.RMN >"" ZN KIn a moment, you've not quite finished playing with your companions yet. N You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor. \b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.(NMO actorNp >  Np C)Np ))MN (<(KN N \bYou step into the bright golden light of the morning to behold your companions merrily packing away for their adventure, and so it seems that it is time to show them the power of the fey. \b The cloaked stranger looks up at your entrance and smiles. "And so it seems that we have all gathered once again. Shall we introduce ourselves then before this journey commences?" And with the nods of agreement from the others, he continues. "You may call me Val. A mere traveler along the way. I suppose you could call me a jack-of-all-trades." \b "You mentioned a flute before," says the maiden. "Are you perchance a gleeman?" \b "Sometimes, when it's necessary." Val replies and then looks over at you. \b "!C) ff1MO quipnoNN K~NN I too am a traveler...NN I come from around here...NN It's none of your business...NN "No where you've ever heard of...eNN None of your businessANN  I come from...HizenvergersteinNN It's too dangerous...NN None of your business...NN What is your name?NN Are you accusing me of lying?uNN +Say those words again with drawn steel...=NN We are a proud people...NN Very well, then...NN 3A heritage full of the greatest highs and lows...NN Very well, then...NN 6And so all gathered during the breaking of ground...QNN You'll call me... what?!*NN "Maybe if you have a deathwish...NN Who are you calling old?!NN (Fine, then I'll call you Pookiebutt...NN 0Vs     *D}<(MO quipnoN! K (N! N! \b"I too am a traveler," you say. \b "Oh, is that so? And where do you come from? Where have you been?" Val asks. \b "I don't remember you saying where you're from either," you reply. \b "That's true... but I've been to so many places that I no longer belong to any of them. " Val says. \b 'The same is true with me' you almost reply, but the lie cannot be forced from your lips. Not while you stand in the land that belongs to you. \bo&N! N! \b"I come from around here" you say nonchalantly. \b "Is that so?" says the old man. "Haven't seen hide nor hair of y' before, though. I certainly would have remembered, someone looking like you. What part o' the region are y' from?" \b %N!N!(\b"That's really none of your business, is it?" you say cooly. \b "Aw, come now, don't be like with us being companions and all now!" says the old man as Layna frowns over at you. \b "I suppose he is has the right," Val interjects. \b The old man gives a sniff. "At least tell us your name." \b >##Z#N!N!y\b"No where you've ever heard of," you reply airily. \b "Is that so?" says Val. "Try me. I have been to many places."\b"N! N! (\b"That's really none of your business, is it?" you say cooly. \b "Aw, come now, don't be like with us being companions and all now!" says the old man as Layna frowns over at you. \b "I suppose he is has the right," Val interjects. \b The old man gives a sniff. "At least tell us your name." \b >## !N!N!n\b"I come from..." you fumble about. "...Hizenvergerstein!" you proclaim in a stentorian voice with a straight face. \b "Hissyverden--??" says the maiden in befuddlement.\b The old man scratches at his head and finally says, "Can't rightly say I ever heard o' the place."\b "Aye, it has an unusual ring to it. Almost as if it was made up on the spot," says Val. \b>##   >##N!N!\b"It's far too dangerous for me to be spouting off my name," you announce airily. \b "Dangerous?" the maiden tilts her head in bewilderment. \b "Won't say your name, eh?" says the old man as he narrows his eyes at you. "They say a fey never says its own name. " \b You blanch a bit and then retort, "Is that so, old man? Then what is your name?"\b The old man sniffs and tugs at his ear. "Well, I don't reckon I really want to say it with us wandering so close to fey lands and all. Names have power, y' know. " \b "And yet you want me to tell--" \b "Tis all good," says Val in a mollifying tone. "We shall simply call you two, Snugglebums and Old Coot." \b "!N!N!"\b"That's really none of your business," you say with a dangerous glint in your eye." \b "Won't say your name, eh?" says the old man as he narrows his eyes at you. "They say a fey never says its own name. " \b "Hold your tongue, old man, lest you lose it! If you care about names so much, then what is your name?"\b The old man sniffs and tugs at his ear. "Well, I don't reckon I really want to say it, with us wandering so close to fey lands and all. Names have power, y' know. " \b "And yet you dared to tell me to--" \b "Tis all good," says Val in a mollifying tone. "We shall simply call you two, Snugglebums and Old Coot." \b "!>##N!%N!'\b"What is your name, old man?" you go on the offensive. \b The old man sniffs and tugs at his ear. "Well, I don't reckon I really want to say it, with us wandering so close to fey lands and all. Names have power, y' know. " \b "I agree" you say and both of you stand there, not looking at each other. \b "Tis all good," says Val in a mollifying tone. "We shall simply call you two, Snugglebums and Old Coot." \b "!}N!*N!+\b"Are you accusing me of lying?" you muster up all the mock affront possible. \b "Far from it," says Val. "Simply remarking on the oddness of your town name." he says with sparkling !>k @ eyes as you gaze at him suspiciously. \b "You never did mention your name," says the pale maiden. "And I hope it's easier to pronounce..." she continues under her breath. \bN!,    ~N!.N!1{\b"Say those words again with drawn steel. And I don't mean your blighted flute." you tell Val in a low menacing tone. \b "Peace!" says Val, holding his hands up in front of him."I wish to have no quarrel with you." \b You give a snort and draw back slightly as the maiden and old man eye you warily. "Mayhaps you can at least tell us your name?" Layna adventures carefully.\b    >##zN!3N!4%\b"You shame us by intimating that our town name was ill-chosen" you say in a stentorian voice. "For we are a proud people, we Hizenvergensteinians..." You hope that is close enough to the word you originally said. "With a long proud heritage..." \b "Peace, I meant no insult. " says Val. \b>##    N!7N!8\b"Very well, then." you give a distainful sniff. \b "You never did mention your name," says the pale maiden. "And I hope its easier to pronounce..." she continues under her breath. \b  N!:N!;h\b"A heritage full of the greatest highs and lows... full of travails and accomplishments from generation upon generation, all remembered, every challenge and hardship, from the smallest to the greatest..." \b "Good gods, you've unleashed the hydra," the old man mutters to Val, who is still trying to apologize to you, if he could get a word in edgewise. \b>##  N!=N!>\b"Very well, then." you give a distainful sniff. \b "You never did mention your name," says the pale maiden. "And I hope it's easier to pronounce..." she continues under her breath. \b   N!@N!C\b"And so all gathered during the breaking of ground, every man and every child from the youngest to the eldest. And lo, they decided to honor our great ancestor, who came across in the boat of fire and slew the dragon of Ni, and thus the town was called Hizenmerg--" Oh gods, what in the nine hells did you call it again? "en*mumble*" you trail away. \b Yet apparently your companions are so deliriously happy that you have finally finished your speech that they did not even notice your botching of the supposed sacred name. \b "Good gods, don't you ever be insulting his ancestors again!" the old man tells Val emphatically under his breath. Not that the old man had much wiggle room to be complaining about long stories. \b The maiden hesitantly clears her throat. "Umm... you never did tell us what your name was," she says and then mutters, "And I hope its easier to pronounce..."\b>## N!GN!K\b"You'll call me what?!" you squawk while the maiden giggles and claps a hand over her mouth. \b "I have always wanted to call something 'Snugglebums'," says Val. "To hug and squeeze and love..."\b "You're demented!" you tell the young man. \b "You just noticed that?" Val grins at you. \b "Before anyone gets any notions about giving me strange nicknames... My name is Layna and I don't really care who knows it. " says the maiden. N!L"!N!NN!R\b"You'll call me that if you have a deathwish." you threaten. \b "Whatever you say, Snugglebums," replies Val, and you decide that the young man calls for some of your special treatment. You are pleased that he has noticed the wicked look in your eyes and begins to look a bit nonplussed. \b "Before anyone gets any notions about giving me strange nicknames... My name is Layna and I don't really care who knows it. " says the maiden. N!S"!>##N!UN!W9\b"Who are you calling old?" you demand from Val, who blinks and looks at you strangely. \b "Does that mean I get to be Snugglebums?" the old man cackles behind you.\b "Before anyone gets any notions about giving me strange nicknames... My name is Layna and I don't really care who knows it. " says the maiden. N!X"!N!ZN!\\b"Fine then," you snap. "Then I shall call you Pookiebutt!" you threaten the pale haired man, who- to your growing dismay- seems to be far too delighted with the sudden turn of the conversation. \b "Gods save me," mutters the maiden. "Old Coot, Snugglebums, and Pookiebutt... and I'm about to march off into the unknown with them. Before anyone gets any notions about giving me strange nicknames," she begins in a louder voice. "My name is Layna and I don't really care who knows it.""!"l>##{%gj     d}GQDXqqqq !KMNP<!" NPthe Old CootNP an old man,KMNP<!" NPthe Old CootNQ an old man LMNQ<!" NQthe Old CootNQ the old man5476 An old man with wild gray hair, half iron gray and half nearly white, the locks scattered hither and yon with no rhyme nor reason. His nose is bulbous and red, his skin is burnt umber, deeply wrinkled with lines lying in in thick friendly folds across his face. The small eyes set deeply within his head are a happy sparkling blue and the teeth he often flashes in smiles remain a bright white, what's left of them that is. GMN Q<!" N Q Old CootN Q an old manMO actorN8Q(MOactordobjN\Q" N\Q6"So you really did find the jewels in the forests!" !>j gives agreat cackle as he pokes his friend in the ribs. "I told you! I done told you, twas the truth!"?N\Q"That's nice, lad," !> says amiably.MoMNQ<  INQ\n\^!>' putters about with the apple barrel.NQh i MO actorNQMO actorN3Q>  .N3QzYou lean over and wrap your arms around the old man as he sits before the fire. \b "Bless me, but I must be dreaming! " !> gives a cackle of glee. "Now all we need is that there young maiden to come join us..." \b "You really are dreaming!" !> retorts. ZN3 Q>  N3!Q\^!> and !> stare as you walk up behind !><and wrap your arms around him. \b "Now I'm jealous," says !># as the old man cackles in glee. }N3%Q>" iN3&QYou flutter up to !><, who shoos you away. "Not quite dead yet!" he tells you. MO actorN(QMO actorN *Q>  E >" N +QYou walk up behind !>d and give him a light push. \b "No need to push, there's plenty o' room on the bench!" he chides. N ,Q>  oN -QYou walk up behind !>> and give him a light push. \b "Rarin' to go, eh?" he says. }N .Q>" iN /QYou flutter up to !><, who shoos you away. "Not quite dead yet!" he tells you. MO actorN 1QnMO actorN 2QkA rather gruesome thought, isn't it? And besides you doubt his skin would make a very good cloth anyway. MO actorN 3Q{MO actorN 5Q>  E >" GN 6Q(You casually walk past the bench that !> rest upon. Your leg snakes out, sliding the bench to the right and depositing the chattering old man upon the floor. "Whoops," he says. "Might o' had a spot too much o' whiskey," and he clambers up upon the bench and pulls it close to the fire once again. N 7Q>" lN 8Q]That is beyond your power at the moment... at least if you wish to maintain your disguise. N 9Q>  nN :Q^You reach out with your mind and easily pull the yelping old man right off of the ground. \^!>1 gasps in surprise while Val's eyes narrow and !> spins gracefully through the air. \b "Send for a priest!" the old man hollers, "A ghost has got me! Or a fey... the fey... send for the..." !> voice cuts off as he's flipped head over heels. Who would one call for to deal with a fey, anyway? A mage perhaps? But that would bring dangers of its own. \b Val reaches out for the old man and, deciding you have had enough fun with him, you allow !># to fall neatly into his arms. \^!>1 sags bonelessly within the safetly of the cloaked stranger's grasp for all of one moment before he starts up suddenly sending the young man staggering slightly. The old man bolts for the tavern door with nothing but a yelped "Good luck to you all!" left behind him. \b "He seems unhurt, at the least," !> comments as she gazes at the slammed door. "It seems the fey is ready for us." \b "Oh yes, one might say that," says Val as he rubs at his own arms. N @Q>MO actorN2BQuMO actorNVDQ>  ;NVEQ,Doing so here would reveal your presence. NVGQ<MO actorNHQ4|MO actorNIQ<With your minds eye you peer into the contents carried by !>... !.MO actorNwJQ=MO actorNLQ>" NMQ"You flap around the face of the !>d, easily dodging the his flailing arms, until he finally faces the direction you deem appropriate.NOQ>" NPQ You casually wander up behind !>C, rest your hands upon his shoulders and turn him sideways. \b \^!>_ blinks in befuddlement. "I don't see what's so special about what I'm lookin' at." he says. NRQEMO actorNlTQFMO actorNVQ>  NWQHard to accomplish at this moment considering that he's already standing up. Perhaps once you've scared him back inside once again. *NXQ>" NZQ]With a few graceful pumps of your wings you are swooping across the room and landing upon !>;'s shoulder. "Well, look at that, pretty as you please!" !>n says as you proudly puff your feathers out. \b "Crow thinks he's one of those fancy hunting falcons," says !>FL. "It's a pity he's not... some rabbit would taste plenty good right now. N\Q>" ~N]Q$You wander over towards where the !>u rests upon his favorite bench. And then with a swirl of your cloak you plop yourself right atop his lap. You hear !> sputtering in her corner and the old man cackles to himself. \b "There's plenty of empty chairs!" the tavern maid sounds half scandalized. \b "Oh, don't be giving him strange notions," !>F: warns you. \b "Pah, old man, don't spoil my fun!" says !>. "I can pretend to be his grandpappy all he wants and dandle him on my knee!" \b Having decided that you have had enough fun, you wander off to find a more comfortable seat. N^QMO actorN_QRMO actorN`Q3Kinky! Although there's prettier prey to pursue. LMO actorNbQNMO actorN%dQ>" N%eQWith a cackling croak you sweep into the air, criss crossing the room as you carefully build up speed, faster and faster until you suddenly swoop down and attack, pecking and scratching at !>. \b There is sudden pandemonium in the tavern as the tavern maid screams, the two old men leap shouting to their feet batting wildly at you and overturning benches and tables in their wake, and !>' dives into her travel satchel to pull out a SOMETHING. "The demon bird is attacking! " the tavern keeper comes lumbering into the room, her handy scullery skillet in hand. \b You merrily lead everyone in a chase round and round the room, stopping every now and then to divebomb your prey. \^!>  runs face first into a wall, several pots and plates are thrown, some of them even hitting (others, ofcourse, never you), and everything is in shambles, all except for the lone table where the drunkard still slumbers peacefully. \b "DEMON!" the tavern keeper shrieks as you are finally chased out of the tavern window. With a BOOM of finality the shutters are slammed closed behind you. \b You wing your way back to perch on the window ledge and carefully preen your feathers. Looks like you might have to avoid the tavern for a little bit. N%oQ"i>N%qQ>  uN%rQfIn front of everyone? That's not quite the reputation you were hoping to build for your human form. 4N%tQ>  E >"" N%uQ<MO actorN' yQ.MO actorNK {Q>" NK |Q"Stealthily you skulk underneath !>v's bench and begin to claw your way up his leg. You manage to reach his knees before he notices and shoos you away. UNK ~Q\^!>8's body does not look like it could bear your weight. MO actorN!Q6)MO actorN!Q>" N!QYou flutter atop the !>[ hair and begin pecking enthusiastically at his head as the old man swats away at you. \^!>W laughs. "The crow has mistaken himself for a woodpecker and you for a block of wood!N!Q< MO actorN"QMO actorN"Q>  E >" N"QYou walk up behind !>d and give him a light pull. \b "No need to push, there's plenty o' room on the bench!" he chides. N"Q>  nN"QYou walk up behind !>= and give him a light tug. \b "Rarin' to go, eh?" he says. }N"Q>" iN"QYou flutter up to !><, who shoos you away. "Not quite dead yet!" he tells you. HMO actorN$QGMO actorN$Q>" N$Q1"KRAK KAK KAK COA!" you call out a greeting to !>0. "Sure is a noisy one, isn't it?" he says to !>F. ]N$Q "Hail, !># !" you call out. "Good health!" !> replies. MO actorN%QMO actorN&Q>" N&QYou flap over to !>U and fuss about with his clothes and hair. "Getting a taste of you, already," says !>F6 to his friend with a laugh. \b "I'm not dead yet!" !> exclaims and shoos you off. N&QYou dither around with !> hair and clothes. The old man gives a great cackle. "Fussing over me just like a little wife!" he says. "Uh oh, you'd better run for it when he starts getting these strange notions," !>F says to you. JMO actorNC(QIMO actorNg(Q>" Ng(Q)"KRAK KAK KAK COA KRAK!" you squawk in !>a ear as he fumbles and swipes at you. "I'm not deaf!" he shouts, "Least ways, I wasn't..." and !>% slaps gently at his ringing ears. Ng(Q>  E >" Ng(QYou drink in a deep, smoke-filled breath and wail like a banshee. There comes a great clatter as the tavern wench drops a handful of cutlery in surprise. The other tavern occupants stare at you in astonishment as you clear your throat.\b The tavern keeper pops her head around the corner. "What in all the bloody shades was that?" she asks.\b "Methinks he sat on a splinter," says one of the old men. >^&Ng(Q>  Ng(Q^You drink in a deep, apple scented breath and wail like a banshee within a few handspans of !>2's ear. \b "Good gods, are you all right?" asks !>. \b "Forget him," !>( complains. "I'm the one who's deaf!".Ng(QMO actorNQ,Q1MO actorNu,Q>  PNu,Q*There are plain gray pebbles underneath !> 's feet.\Nu,QPNothing but solid wooden bench and insubstantial shadows beneath the old man. MO actorNN-Q2]MO actorNr-Q>Nothing but memories and old shadows lie behind the old man.MO actorN-QMO actorN-Q>" N-QYou flutter atop the !>[ hair and begin pecking enthusiastically at his head as the old man swats away at you. \^!>W laughs. "The crow has mistaken himself for a woodpecker and you for a block of wood!N-QgYou lean forward and give the old man a good poke in the ribs. "Aye, I've got a bit o' a gut there," !> says sheepishly. MO actorN/QMO actorN/Q>" N/Q?Carefully you wander across the wooden floor and hop up upon !>'s knee. You rub your feathered head against him. He is... scratchy. His home spun clothes are coarse with scraggly ends and his skin is wrinkled and rough with a liberal sprinkling of calluses mixed in. \b "Look! The bird thinks he's a dog now!" !>' hoots as he scratches at your head. N/Q>" E >  cN/QYou wander up to !> and run your hands along his body. He is... scratchy. His home spun clothes are coarse with scraggly ends and his skin is wrinkled and rough with a liberal sprinkling of calluses mixed in. \b \^!>F and !> goggle at you as !>0 cackles. "Got a good feel, did y'?" he says. VN/Q>" E >  5N/QYou wander up to !> and run your hands along his body. He is... scratchy. His home spun clothes are coarse with scraggly ends and his skin is wrinkled and rough with a liberal sprinkling of calluses mixed in. \b \^!> stops her packing to gape at you as Val leans back against the well. "When I said we should introduce ourselves to reach other, that's not quite what I had in mind," he drawls out. "Hush you," replies !>`. "And leave him be. You just go and do what you like, lad," he tells you and pats your hand. N/QMO actorN`5QMO actorN5QYou smile enigmatically at !>L. He returns the smile with interest, showing all of his remaining teeth. [MO actorN6Q\MO actorNC6Q>" NC6QOYou reach out and with one claw delicately pinch the rough, wrinkled skin of !>`. He shoos you away and complains "Not even dead yet and the crows are already peckin' at me!"NC6Q>" E >  NC6Q!Casually you wander past where !> relazes before the fire. Your hand stealthily reaches out and gives the old man a good pinch right on his resting posterior. \^!> shoots upright and cuts off in the middle of one of his old rambling stories. \b "And me old enough to be his grandfather!" he exclaims. \b "Too much liquor going round tonight," replies !>.(NC6Q>" E >  NC6QMYou reach out and give the old man's rump a good pinch as you walk past. \^!>n jumps nearly a foot into the air and lands with a great guffawing laugh. \b "Keep your hands to yourself!" !> scolds you as she pulls her cloak close around her. \b "When it comes to me, you may let your hands wander a bit," Val says. \b "Heh," says !> "Same for me. But y' can be a little gentler.". \b At this maiden looks suspiciously around at the men whose company she is now keeping. NC6QMO actorN!;Q MO actorNE;Q>" lNE;Q]"KAK KAK COA COA KRAW!" you croak. Alas, bird beaks are not particularly adept at howling. NE;Q>" E >  JNE;Q;You suddenly let loose with a howl. There is silence within the tavern for a moment and then... \b "Ah, that reminds me o' the story o' that there ol' man who went and turned himself into a wolf. Have y' ever heard that one? " says one of the old men. \b "Oh gods save us, not that one again," replies the other old man. \b "It was one o' them hunters who'd gone and lived up 'n a mountain. He'd been huntin' wolves n stag n whatever for years, but then one fine day he comes o'cross this great big ol' white she-wolf..."\b "And I reckon he hadn't seen hide nor hair of a woman for years so--"\b "Now don't be all dirty minded, y' old fool! Anyways, he finds this big ol' she-wolf who'd just given birth to a litter o' little pups and he ups and kills them all. The she-wolf is all tired from the birth, but she puts up a great fight. Fastens her jaws around the man's neck and nearly crushes 'im, before he manages to whack her good with his knife. Or was it his broken bow? Now I knows tain't a sword..." \b "Twas probably his dinner knife as he dozed before his fire..." \b "Anyways, he manages to kill them all and decides to skedaddle before the wolf's mate come back looken for o' a bit of revenge. So he skins the white wolf and off he goes back to his cabin. Only he hears howling all around for days an' days after that, howling and a yowling getting closer and closer... And then on the night of a full moon--"\b "He turns into a wolf himself, eh?" the old man sounds unimpressed.\b "Aye! He puts on the fur o' the white wolf and off he goes as a wolf himself!"\b "I heard, " the young maiden in the shadows interjects, " that he ended up becoming the mate to the white wolf's widow."\b There is silence for a moment then... "Well, at least the hunter shouldn't croak after giving birth to a litter of wolf pups." says the second old man. &NE;Q>" E >  NE;QYou howl mournfully. For a moment silence descends upon the courtyard and then Val speaks. "Wolves howl when they are looking for mates," he says idly. \b "Now, does that mean I should go and howl back?" !> says as he grins cheekily. b)MOwordlstNkDRK%NkDRNkDRNkDRNkDRNkDR/"They're big and wet and full o' salt," says !> with many gestures."NkDRNkD RNkD R"\b"I heard o' this story," says !>3 "Where some poor fool caught the phoenix as he wanted to steal all o' its gold. So it built up a nest all nice and pretty with gold and silver and then when the fool goes in for it...WHOOSH up goes the whole place in flames! \b And a man is not like a firebird... he don't rise up again from his ashes! ""NkD RNkD RNkDRNkDR@"Pay him no mind, tis just ol' Nob snoozing his worries away.""NkDRNkDRNkDR\b"Gryphons are those mighty birds who live up atop the mountains so high that there's not enough air for man to go and breath. Yet they say that there are castles up in that there mountains, castles that float right in the middle of the air like a cloud itself! And if y' can catch a gryphon it can take you up there to live... although I reckon the bird be more likely to eat you than take you anyplace. "NkDRNkDRNkDR\b"Oh, the shadow prince be a favorite o' the storytellers! They say he has control o' the shadows themselves and goes riding across the moon on the night itself. He can betwitch anyone with a mere glance or smile and if he takes a dislike to y' he'll chase you all over the earth with a pack o' hands as white as the underbelly o' a dead man with great big red rolling eyes..."\b "Oh lords, don't get him started," says !>F. "NkDRNkDR;\b"One o' those magical mage cities, off somewheres, eh? "NkDRNkDRNkDR\b"There was this story about roses about the young man who become lost... and his true love sent rose petals and... hrmmm.." !>F mumbles to himself. NkD R"NkD#RNkD$RNkD%Ro\b"A lovely lass, to be sure. Brave and true... and sensible enough to get out when the gettin' out is good!""NkD(RNkD)RNkD*RNkD+R\b"Mages are the most powerful o' all men... and well women too, o' course. Almost as powerful as that there fey. Well, that would make sense bein' that they snitch their powers from them. And they live for years and years too, never aging, never dyin'unless someone comes along and whacks them. Immortality is one o' the first things they be wantin' to take from the fey o'course.\b Not that we see their kind around here. There's no real reason for them being here, although this area does have quite a few fey livin' about it. ""NkD.RNkD1R\b"Now there be a story! It was one o' them hunters who'd gone and lived up 'n a mountain. He'd been huntin' wolves and stag and whatever for years, but then one fine day he comes o'cross this great big ol' white she-wolf who'd just given birth to a litter o' little pups and he ups and kills them all. The she-wolf is all tired from the birth, but she puts up a great fight. Fastens her jaws around the man's neck and nearly crushes 'im, before he manages to whack her good with his knife. \b Anyways, he manages to kill them all and decides to skedaddle before the wolf's mate come back lookin' for o' a bit of revenge. So he skins the white wolf and off he goes back to his cabin. Only he hears howling all around for days an' days after that, howling and a yowling getting closer and closer... And then on the night of a full moon-- He puts on the fur o' the white wolf and off he goes as a wolf himself!"\b"NkD5RNkD6RNkD7RNkD8RcFor a moment you are suddenly overtaken by the urge to blurt forth your true name. Utter madness!"NkD:RNkD;RNkD"" .NkD>R"A fine young lad, he seems!"NkD@R"Who would o' thought that young man would be a mage? Well, I guess he be safe enough wanderin' out there by himself. Come for all this way for the fey, I bet, and not lookin' for its treasure either!""NkDBRNkDCRNkDDRNkDERNkDFRNkDGR"Now we get quite a few o' those 'round these parts! Always glad to have a good healer passin' through. I've had this here crick in my neck for several moons now, so I be hopin' that another one will be passin' by soon."NkDIRNkDJRNkDKR "Aye, y' be wanting one now?" !> grins cheekily. "NkDMRNkDNRNkDORN"I was married once long ago. Took me several years before I escaped again!""NkDQRNkDRRNkDSR"Ahhh... dragons. They be the patron o' this fine establishment! Not that any o' us here have ever clapped eyes upon one. Although there have been rumors floating about for many years now about a dragon hidden away up in that odd forest somewhere. Reckon I don't know if I believe that or not... it seems to be that a dragon and the fey wouldn't get along well too well, both o' them being hoarders and all. ""NkDURNkDVRNkDWRNkDXRNkDYRNkDZRNkD[R5"You? Well, you're a fine lookin' animal yourself!""NkD]RNkD^RNkD_R "Love makes the world go 'round, or so they say. It certainly plays a big role in most o' the stories. Someone is always scaling that there mountain for love, or burning down that city for love, or making that war for love. Seems a very messy business, don't it?""NkDbRNkDcRNkDdRNkDeRNkDfRNkDgRNkDhRNkDiRNkDjRNkDkRNkDmR"Heh, that also plays a large role in the stories. Someone always swearing vengeance for this or undying hatred for that. I simply don't have the energy for such taxing emotions!" "NkDoRNkDpRNkDqRNkDsR-"\Those be the bad guys in all my stories!"!>: gives a great laugh. "Real life's not quite so simple.""NkDuRNkDvRNkDwR"Names have power, don't you know? And considering where we are, don't think I ought to be bandying mine around so easily. So you can just call me 'Old Coot' if you will.""!"NkDyRNkDzRi"A unicorn! They be the favorites o' the maidens. Or maybe the maidens are a favorite of theirs!" says !>). "A beast after my own heart! You pass that tall pointy spire on the road on your way here? Well, everyone hereabouts calls it the Unicorn's Horn. Supposedly it be the horn o' some long dead king o' the unicorns. That would have to be one might big unicorn to leave a horn that size behind it!""NkD|RNkD}RNkD~RNkDRs"A nice place to sit and chat for a spell. To get away from the hustle and bustle o'... our busy village lives." !>l gives a great big laugh. "But I suppose that this is boring to a well traveled person such as yourself. ""NkDRNkDR@"That they can make fire rain down from the sky, and the earth shake like a bowl of curds, they'll turn wood into water and water into air, and they'll steal the breath right out of your throats, all the while taking on the form of the thing you most desire..." and it seems to you that this speech is rather familiar."NkDRNkDRNkDRNkDRNkDRNkDR"That balmy bird has been around again! Although I must admit tis funny to see it drive the ol' tavern lady batty up the wall with its antics. "NkDRNkDRL"One o' those famous mages that everyone likes to tell stories about. I think he's most well known for freezing an entire sea so that a caravan o' some o' those war deserters could escape across it. It seems there's always some war or other going on down there. The funny thing is that I think twas the Summer Seas that he froze!""NkDRNkDR"Ooh, another one o' those famous mages, although the things he's known for... well, they aren't quite so nice. Hear he destroyed an entire mountain and everything on it, including several villages!, just to get at one fey. And then there are those rumors about that one city that who's lord supposedly disrespected him, and then one day there up and was no one left! No one in the city at all! Like they all evaporated into mist! "NkDRNkDR"She's my favorite o' the mages. Oh, the things they say of her... her and her fey the Ripper. No, that's not quite right... well, anyway, supposedly she floated an entire lake across the kingdom during one o' those magic related droughts. And then there was that time when she and her fey infiltrated the fortress of one o' her enemies... both o' them snuck in as belly dancers or something such! I heard much o' those belly dancers down south, but I rightly don't know what they'd really look like...""NkDRNkDRNkDR\^!>% cackles happily at their mention. "NkDRNkDR"That is that there mage most well known for biting off more than he could chew! Or rather he got all chewed up himself by the fey he bonded! Mighty crazy business that has to be, bonding fey. "NkDRNkDRNkDR"Nothin' but an old farmer, content to spend the rest o' his days dozing before the fire! Or was I a merchant? Now I know for certain I weren't no warrior...""NkDRNkDRNkDRQ"\Grumpy ol' fellow, reckon he sucked on one too many sour apples in his day," !>N says with a great big grin and laugh as his friend stares hard at his head."NkDRNkDRNkDRNkDR"Aye, she's a pretty lass, always helpful and... usually polite. If you act good, that is. Poor thing gets run ragged old day by the ol' harridan in the scullery. ""NkDRNkDRNkDRNkDR"Now I may tease her a bit, or a lot as you may have it, but she is a good woman. A good fine woman. Who has very good aim with those frying pans o' hers. "Xsea]seas]ocean\oceansZ phoenix firebirdnob$drunk# drunkard griffenj gryphongshadow prince  wakandarosesrosemaidenlaynamagesHmageHmagicG werewolffxyzzy yournamemynamevalq strangermpookiekwizardhedge-wizardz wizardryvhedge wizardnhedgemkissX kissingU marriage marrieddragon dragons snugglebumsyou yourselfmemyselfselflove belovedrancorenmitygrudge antagonism animositymalice loathing abhorrencehatredhate antagonistenemy villainnamenames unicorn wayhouseninnotavernmfeyhravencrowcrowsravens blackbird trevalkianF lorekosi keilantraV bellydancerVbellydancersN deleriancoot_ oldcoot\man oldman maid tavernmaid tavern maidkeeperhtavernkeeper`tavern keeperWNkDR!c ,,"Don't reckon I know anything about that."O(P(((((((((((S(T(-(,(((.(/(((K(L(2(3(p(o((((()(((((Q(R(((((U(V(#("(W(X(b(a(((Y(Z( (([(\(((((((^(](U(T(((((!( (+34JKBLCNLN6P[Q\[\}[~\R[S\)+ ..An ephemeral sweetness, here and then gone. '  Dark Island \(The Dark Island\), The Dark Island*pMN!> m 9N!*A fitful whispering amongst the leaves. N!Utter silence. MN!> m N!\bA dark barren island, its shape a perfectly smooth hump of a hill cresting over the pure waters of the lake. A single dark tree grows here, its azure leaves tremble and shiver violently in a non-existent wind.N!\bA dark barren island, its shape a perfectly smooth hump of a hill cresting over the pure waters of the lake. A single tree grows here, thick trunked and black of bark, with blue petalled leaves the color of a summer sky.MN!>" /N! You cannot flee this destiny. WN!KYou skim lightly across the water and to the green shores of the lake. \bm>XMN!>" /N! You cannot flee this destiny. TN!HYou dive back into the crystal waters that cradle the island close. \b>MO actorNW!0MO actorN{!rYou dig within the loose dark soil of the island but all you discover is twisted tree roots and more dark soil. MO actorN!NMO actorN6!/The soil of the island is loose and crumbly. -hMO actorN!IBeyond the tang of water, a sweet haunting scent permeates the island. MO actorN!MO actorN!pYou skim quietly across the peaceful lake, only tipping a toe or two into the cool waters along the way. Beneath you there is the glint of scales as fish flash on by, a whirl of colors from the coral and anemones and trailing water plants, the faint shimmer of rainbows caught underneath the waters.\b Without a sound, you land upon the dark shores of the island. \b>BC3333)' &&Edge of the Plains, Edge of the Lake **\(Edge of the Plains, Edge of the Lake\)+ eeThe scent of growing grass, faintly metallic and almost reminiscent of the smell of spilled blood. * 00Silence waits underneath the sound of battle. ""\b The shallow field where the verdant green shores surrounding the lake gives away to the colored grass of the plains, it touches yet does not belong to either area. The lake itself can be seen glimmering down the rise to the south while the sea of grass lies behind you to the north. \b OOThe time for flight has passed. One way or another, you must meet your fate. (MO actorN+>" N+N,># (N,C)N,)@N,># D># N,CN,))' MN,(<(K N,N ,N , N ,N,G"Mages are forever wary of each other," Val begins and for a moment you are amused by an introduction that could well have fit the fey. "And of this mage called Lorekosi I have long had interest. " Val's lips quirk. "Or perhaps you could call it ill-will. " \b Val tilts his head and gazes off into the distance, his eyes straying far away from yours. "This area is so far flung... so far from civilization and the holds of mages, and so thick with fey, while in our great cities we mages scrabble over every little bit of magic that we can snatch. \b It was inevitable that someone would see the riches and come here... And Lorekosi has cut quite a swatch of devastation. But that's not truly what I came for... When I learned where he was going and I remembered..." Val laughs, a bit uneasily, and runs his hands through his too pale hair. \b "I came here for you," Val says. \b "For me?!" you say and Val ducks the snort of fire that you unknowingly expel in surprise. "You came all this way to consume me in particular?" you ask suspiciously.\b "Nay," Val says. "I had hoped that it would not come to that, although that is what usually happens when a mage and fey meet. Two arrive and only one leaves yet... You know of this magic we possess. That we can consume and absorb some of the powers of the fey, yet also it is possible to bond... "\bN,>" N,N,"This is not how I would have wished it to be," Val says. "But we have little time. Lorekosi has so glutted himself on the surrounding fey that I have little hope of matching him as I am now... but perhaps together..."\bN,N!,Val reaches out to you and leans his head against the base of your sinewy neck. Your muscles remain taut, in anticipation of some trick-wise blow. And from the north... gods damn the north. You turn all you attention to the human standing before you. \b "Some things cannot be reasoned, some things cannot be explained, some things require this leap of faith. " Val pulls back slightly, standing squarely in front of you, within the reach of claws and teeth and fiery breath. And yet you feel his power burning within him... It is not he who will be required to gamble all in trust. \b "I am Trevalkian and if you would accept this offer, simply tell me your true name." says the one you know as Val. \b gN#,)Val waits patiently for your response. 1N%,lVal's eyes flit nervously towards the north. "Only say your name as a token of your acceptance," he says. N',N+,T"I understand," Val says and inclines his head to you. "It was too much to ask too soon. If only there..." His voice trails away. "Lorekosi will come for you, but I will not back down so easily. " \b "If you can't have me, then no one will?" you ask. \b "Something like that," says Val. "I pray that one of us will come out the victor..."C)C7-lWMN/,ՠ<KN0,N1,7\bVal walks up to your head as you watch him warily. "This area is so far flung... so far from civilization and the holds of mages. " he begins, his tone too casual. "The land so thick with fey, as I have never remembered seeing before. It was inevitable that someone would see the riches and come here..." \b   N2,N3,N8,\bThe dark clad mage looks down at you sadly. You feel a flicker of... remorse?... anger?... and so you pull yourself to your full height, towering high over him, in black scaled glory. \b "The one who comes is called Lorekosi and he has glutted so much on the surrounding fey that I do not know if I have any chance to match him. Yet I hope one of us can defeat him." says Val and he turns half away from you. \b And to the north, something comes. CC> PTMN;,<K'N<,\bMy name is...\b And the moment you speak your name, the sound hovers upon the air, and you are unraveled. You feel yourself being drawn to Val, into Val, every bit of your essence breaking free of the form you hold to flee within the mage and you taste the bitter tang of betrayal as the whole world becomes Val, all the world, everything, nothing but Val...\b ... and with a start you come to yourself once again, crouched down next to the mage with your muzzle and neckfrills being petted. You admit to being rather touchy-feely in your other forms, but this is certainly a first for your dragon one! You start upwards nearly knocking the dark clad mage back upon his posterior. And you felt the unbalance, just as if it was your own legs which staggered under you. \b C)!"#"N>,Your glorious introduction to the world of a bonded and unlanded fey is interupted by the silent arrival of a pale figure in white. CC> G2MNB,<K NC,NK,\bHe comes across the colored plains, gliding on slippered feet. \b "Lorekosi," Val says coldly. And the white clad mage smiles at the dark one. \b "Trevalkian," Lorekosi says congenially. "How interesting to find you here." And he almost sounds truthful. "If you interfere, I will happily kill you." \b 'How do you do? It's a lovely day out here. I'm going to kill you...' all in the same dulcet tones. \b "This one is mine," says Val and his eyes never leave the other mage. \bNM,>" NP,"I believe I saw him first," says Lorekosi as if bargaining over the last slice of pie. \b "Oh no," replies Val who bares all his teeth at the other. "He's mine from very long ago... and now you are too late. "NR, "Is that so? A pity...for you. So you even lack the good sense to consume him, Trevalkian. Well, he shall be free enough again when you are dead." And you sense it once, again, the power rising within the white mage. \b $%& NT,The two mages circle warily around each other and you can sense their foreign powers clashing with your own hold over the land. \bNV,>" /NX,#"Prepare yourself," Val warns. \bNZ,And then with a quick slash of movement it has begun. Spears of earth erupt from the ground, seeking to impale you or Val upon their spikes. The sky seems to shimmer and shatter into jagged pieces that fall lancing from the skies. ;N\,The air turns to liquid which clogs within your throat and drags down your wings. And then a streak of pure golden light blazes through the fields, crisping grass and anything else that may lay in its way. ^N^,\bVal reaches up into the air and heaves a lightning bolt over at the white mage. Lorekosi crosses his arms atop his chest and the strike is broken in two, reflected back at Val and back at you. It lands against your skin with a searing hiss. You really must thank the mages for that. 2N`,|A wild windstorm whips up, seeking to carry Lorekosi away in its clasp. Rain falls out of the sky, crimson and smearing. Nb,Black stones burst free from the ground, sending Val staggering as you pump your wings and take flight. The stones melt away into liquid that pools about the fields. "Nd,The dark liquid deepens expanding until it covers all save the small circle of ground where Lorekosi stands. Tendrils reach out towards you, grasp at Val's legs with stunted fingers. &Nf,Val calls forth the earth and a tall spire of stone heaves him upwards, yet the pool of dark liquid grows ever deeper as the tang of oil fills the air. Nh,Lorekosi waves a hand negligently at you, sending small balls of white light. Val is dragged down to the burbling oily surface by dark disembodied hands. Nj,N|,f\bAnd with a last scream Val is dragged under. For a moment you gaze down upon the circle of ripples upon the dark liquid and wonder if he will rise again. And then your attention is wrested away to Lorekosi, who sweeps his arms upwards, rising on his patch of earth up to you. \b And... you cannot pull away... \n your gaze upon... the white mage... \n ...mage... \n Lorekosi is... everything... \n ...he is... \n ...the world... \n and if... \n ... your powers... \n ...take... \n ...he only gains... \n ...power...\n ... to curdle cheese...\n ....\n ...\n .\b You have become the mid-day snack of a mage. \bCL 7G8  9MN,<KN,N,You swoop down and protect Val with the edge of a wing and then unleash your fiery rage. For a moment the flames dance lightly across the dark liquid, flickering twists of white and gold and red, and then all is a blazing inferno of heat, light and sound. It scalds, it burns... it feels wonderful. \b And then silence. You feel Val stirring beneath your wings and you open your eyes once again. For a moment all is a shimmering white afterglare of the fire within your eyes, and then you blink and see Val coming out from his shelter, hands cupped gently before him. A pale blue sphere, softly glowing, retracts into his open palms before winking out of existence. And then the both of you look about. \b The field has been seared into nothingness, a black flat plain barren of all... no rock, nor grass, nor any hint of the white mage. This dark burn forms a perfect circle beyond which the rest of your lands lie untouched. It was Val's barrier, which you had just beheld, which contained the devastation within this small area. It would be a simple thing to correct... \b "Leave it as it is," Val says, as if reading your mind. "As a testament to our battle. " And yes, that thought rather tickles you.\b Yet... it seems you are wrong. A change has been wrought upon the rest of your lands. The colors of the grass are already subtly changing, fading back to normal green. And all around you, you sense it... empty lands. As empty as if you had truly died. But you did not. Your bond with the land has been merely severed. Or rather... transfered. \b You walk to the edge of the burn and, kneeling upon the ground, pluck a piece of grass. Still a jewel green, yet dulling before your eyes. You do not realize you have shifted back to human form until Val reaches out and catches your hand. \b "It will be all right," he says. \b "Will it?" you ask and rise to your feet. You turn towards the mage... your mage. "All I know is that it will... not be boring." \b And so the two of you walk back to the tavern and to the road beyond, to the cities, and kingdoms, and adventures that await you. \b \b \n \(Congratulations, you have reached the Broken Cage Ending\)\b \nCC S |MN,<KVN,N,'With a roar you swoop down and unleash your fiery rage. For a moment the flames dance lightly across the dark liquid, flickering twists of white and gold and red, and then all is a blazing inferno of heat, light and sound, expanding ever and ever outward. \b It scalds, it burns... it feels wonderful. \b And then silence. You open your eyes once again and for a moment all is a shimmering white afterglare of the fire within your eyes. You blink and then wince. All is devastation. As far as the eye can see, your domain has been seared into nothingness. A black flat plain barren of all... no lake, nor vegetation, nor any trace of mages. You sigh and slowly stretch your wings. \b Oh, there's quite a bit of work to be done. \b \b \n \(Congratulations, you have reached the Scorched Lily Ending\) \b \nC C  \****)' Butterfly Plains \(Butterfly Plains\)+ eeThe scent of growing grass, faintly metallic and almost reminiscent of the smell of spilled blood. * llA pregnant silence has overtaken the plains. As if the land itself were holding its breath and waiting... eMN(\b Jewel-toned green grass grows thigh high here, unbroken and flawless as it undulates before your eyes. The plants slowly take on different hues, golden then sunset orange then crimson then violet and blue, as they near the edge of your domain. N(>" N(High above the plains, thousands of butterflies roil about the air in a frenzied storm. \b Beyond your borders lies the decimated remains of the Tree. N(High above the plains, thousands of butterflies hover indolently in the air. \b Beyond your borders you can see the hulking figure of The Tree. \bWMN(>9" N(You pump your dark wings furiously, dragging yourself back from the mage foot by painful foot. You can hear the cries all about you, the voices of the butterflies, of the grass, of the clouds, of all your creations crying out for you to flee and save yourself. \b And for once, it is their command that you obey. You soar away to the south straining with every fiber of your being as the mage's power grows ever stronger, seeking to pull you back. The sky rolls above you, the earth shakes tremulously, and a small dark figure rushes out to meet you. \b It is with an inelegant rustle and tumble that you half land, half fall to the grounds at the very edge of the plains. And before you stands the mage, Val.\b C)C>vN(>" SN(DThe mage has you too tightly in his grasp... you cannot pull away!N(VMN(>9" N(You pump your dark wings furiously, dragging yourself back from the mage foot by painful foot. You can hear the cries all about you, the voices of the butterflies, of the grass, of the clouds, of all your creations crying out for you to flee and save yourself. \b And for once, it is their command that you obey. You soar away to the south straining with every fiber of your being as the mage's power grows ever stronger, seeking to pull you back. The sky rolls above you, the earth shakes tremulously, and a small dark figure rushes out to meet you. \b It is with an inelegant rustle and tumble that you half land, half fall to the grounds at the very edge of the plains. And before you stands the mage, Val. \bC)C>vN(>" SN(DThe mage has you too tightly in his grasp... you cannot pull away!N(OMN(>9" N(You pump your dark wings furiously, dragging yourself back from the mage foot by painful foot. You can hear the cries all about you, the voices of the butterflies, of the grass, of the clouds, of all your creations crying out for you to flee and save yourself. \b And for once, it is their command that you obey. You soar away to the south straining with every fiber of your being as the mage's power grows ever stronger, seeking to pull you back. The sky rolls above you, the earth shakes tremulously, and a small dark figure rushes out to meet you. \b It is with an inelegant rustle and tumble, you half land, half fall to the grounds at the very edge of the plains. And before you stands the mage, Val. \bC)C>N(>" SN(DThe mage has you too tightly in his grasp... you cannot pull away!|N(>" hN(VYou turn your back on the sea of grass and return to the true waters of the lake. \bmS;MN(>" 9N(*The earth holds no santuary for you now!N(You sink into the embrace of the earth. Quiet serenity as your land cradles you close-- but now is not the time to rest. You climb cautiously to the surface, making certain no mortal eyes see you emerging from the earth.RMN(>" SN(DThe mage has you too tightly in his grasp... you cannot pull away!N({You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.HMN(>9" N(You pump your dark wings furiously, dragging yourself back from the mage foot by painful foot. You can hear the cries all about you, the voices of the butterflies, of the grass, of the clouds, of all your creations crying out for you to flee and save yourself. \b And for once, it is their command that you obey. You soar away to the south straining with every fiber of your being as the mage's power grows ever stronger, seeking to pull you back. The sky rolls above you, the earth shakes tremulously, and a small dark figure rushes out to meet you. \b It is with an inelegant rustle and tumble that you half land, half fall to the grounds at the very edge of the plains. And before you stands the mage, Val. \bC)C>;N(>" SN(DThe mage has you too tightly in his grasp... you cannot pull away!N(You hesitate for one moment and then grimly cross over your boundary. With the first movement you felt the wrongness... as if the earth itself was shrieking in ire. It was shrieking... something shrieking... someone shrieking... The air around you jellifies... something tearing...\b \t raw ragged...\b \t ripping...\b \t tearing...\b The Tree laughs. "You must be mad, coming over here," it says and you are pushed back to your side.(ZMO actorN((>" N((C)CN(()) MN((<(KN(N(\b With a resounding crash you are dragged to the ground. You dig your wings into the earth, claw at the grass, every muscle within your body straining and screaming to keep your distance from the figure in white. The mage. Another one, yes. You know. \b The mage strolls up to you, each step of his slippered foot precise and patient. "A dragon, is it? Perhaps you will have some challenge for me, better than bulls and trees. " and he laughs, a light, gentle sound that is all the more horrible for it. \b N( N(N(\b The white mage merely lifts his open hand to you, pale unwrinkled palm facing outwards. And you are drawn... drawn closer... rapidly approaching... closer and closer... sucked i--\b !> ! Lorekosi  The mage staggers back cursing as the horde of butterflies descends upon him. A storm of butterflies, whipped up into a frenzy, they swarm and attack, their fluttering multi-colored wings lashing and slashing out at the enemy. \b Thin trails of red blood appear across !> ! Lorekosi's the mage's unprotected skin and then his figure is lost in flames. Those butterflies too slow to pull away crisp and fall to the ground in darkened piles. The white mage reappears, whole once again, and his pale eyes glare at you. N( N(N($\b"I hope you have better powers for me than this," he sneers and raises his hand once again. So this is what it means, to be consumed by a mage. As you pump your dark wings, you draw forth all the scattered remnants of your powers, concentrating everything you are into defying this mage. N(N(\b!> ! LorekosiThe white mage waits patiently, not even deigning to come after you himself. He waits... for you to be drawn to him. Curls of dark smoke jet out of your nostrils in rage. N(N(\b Yet try hard as you might to draw back, its is all within your power to do to merely hold your ground. That your most powerful form would be denigrated to this!\b "Surrender..." !> ! Lorekosi  The mage says soothingly and while a small misbegotten part of you listens eagerly to these words, the greater part is renewed with fury. 0N(N)\b!> ! Lorekosi'sthe white mage's mage's eyes narrow in anticipation as he takes one-- merely one!-- step forward and yet seems to have crossed the entire field to reach your side. Or are you the one drawing closer to him?$N)N)8\The last of your butterflies succumbs to the aura of !> ! LorekosiThe white magew and crumples to the ground, wings beating feebly for a few heartbeats before they too fall still. "Not long now..." !> ! Lorekosi  The mage( murmurs perhaps to you, perhaps not. N)N)N)\b Against your will, closer and closer you are drawn towards the mage. Although you fight and snap, bite and claw at the wind and ground, it all seems... almost dream-like... like being swaddled in lengths of soft cloth...N )N )\\bIn one last desperate burst of power, you drag yourself back. It can't... end like this!nN )N)You are almost upon !> ! LorekosiThe white mage's ... or rather he is almost upon you... You try to spread wide your wings, yet they seem frozen to your sides and... the sight of the mage fills your entire vision... pale and pale and pale and eyes so cold... somewhere laughter... hard to think...\n ... if he must absorb your powers...\n ... then let him only...\n ... have your power to......\n curdle cream...\n You have been consumed by Lorekosi. \bN)rN)N)C)OL IftF 6 MN)ՠ<KN)iThe white mage staggers back underneath your assault and for the moment you are free of his influence. RN)!> ! LorekosiThe white mageP straightens up, his powers gathering around him in an almost visible nimbus. N!)!> ! Lorekosi'sThe white mage'sK pale eyes turn to you once again and the will is sapped from your body. =C)!9CUHnMN%)>  N&)ա<K0N')"9CC  *)|)|)DMMN2)<   N3)!> ! LorekosiThe white mageD waits patiently upon the plains for you to succumb to his power. N5)  white mage A pale figure of a man dressed in long white robes of silk embroidered with colorful patterns of mage design. His hair, curled about the nape of his neck, is all white as is his closetrimmed beard. He has a feeling of oldness about him, but his face and figure lack the wrinkles that time should have wrought. \b He looks a bit like someone's doting grandfather or uncle... all except for that pale blue eyes. Depthless like the eyes of some dumb animal, with no emotion or spark of humanity within them. MO actorN:)GMO actorN;)(Not even on your most masochistic day!1MO actorNT<)0rMO actorNx=)SYou dig your claws into the ground, refusing to be drawn any closer to the mage. MO actorN>)MO actorN?)Your muscles bunch as you are about to pounce upon the mage... yet suddenly a shiver runs through you. Perhaps it would not be wise to come any closer.LMO actorN@)NMO actorNA)Your great dark wings pump the air, as you launch yourself upwards, snarling and clawing at the white mage. Yet the closer you drift to him, the more a cold weakness seeps into your flesh. You drop back again, shivering. >  MO actorN B)QMO actorN1C)2You refrain from getting that close to Lorekosi!,MO actorND)-MO actorNE)You snort and billow your nostrils from where you stand. The white mage smells of sharp spices and powdered perfumes, the sweet sickly scent of death.MO actorNiF)JMO actorNG)+You would much prefer to avoid that fate!MO actorNH)6}MO actorNI)KYou snap your jaws at the white mage menacingly. He merely laughs at you.>  dMO actorNJ)eMOactordobjNK)~The white mage is not interested in anything you would willingly give in. He wants only all your powers and your very life. MO actorNR L)hMO actorNv M)IYou bare your teeth at the white mage, who smiles eagerly back at you. oMO actorN N)peMO actorN O)FThis mage is dark to his very soul. It is beyond your power to fix. MO actorNs P)DMO actorN Q)%He is most assuredly already awake!MO actorN R)DMO actorN T)The day around you darkens as you pull down abominable hexes, cursing the white mage and his kin to the ninth generation. If he even has kin. The mage merely laughs. \b "They always curse and cry at the end," he says and a hot flit of angry fire burns through your veins. >  /MO actorNO U).yMO actorNs W)> " Ns X)"There is no use fighting," !> ! Lorekosithe white mage croons. "It is far better this way, to become a part of the greater whole..." And you feel yourself being lulled down into a warm, dark-- YOU WILL NOT LISTEN! >  CNs Z)7You block the mage's seductive words from your mind. MO actorN [)`MO actorN\)AExcellent idea! But that would require a handy body of water...YMO actorN|])ZMO actorN^)You breath a great gout of fire at the white mage. Your breath dissolves into harmless wisps of mist within a handspan of its target. >  MO actorN`_)iMO actorN`)JYou bare your long draconian teeth and growl at the smiling white mage. MO actorNa)MO actorNb)?You summon forth the earth to bury and crush the enemy mage. !> ! LorekosiHem stumbles back a bit and sharply lashes out at the ground, which trembles and then stills beneath his feet.>  MO actorNc)MO actorNBd)CYou summon forth your glamour, to blind and bind the white mage. !> ! LorekosiHel stares intently at you, blinks, and shakes his head. "Your parlour tricks will not work on me," he says. >  aMO actorNLe)b'MO actorNpf)Never!MO actorNg)MOactordobjNi)H |Nj)mWhat madness has taken ahold of you? You give yourself a good shake and glare at the tricksome white mage. BNl)6The white mage is only interested in consuming you. MO actorNm)lMO actorNn)MYou give a roar of rage as your current form is not conducive to squawking.MO actorNFo)>MO actorNjp)That thought is unacceptable!PMOactorioNq) You defend !<  against Lorekosi.MOactorioNs) You defend !<  against Lorekosi.Nt)>" Nu)>  MO actorNv)MOactordobjNx) You defend !  against Lorekosi. Ny)>" Nz)>  de6TU6cYZYZn=LNLNLNLNLNJLKNLNLN LNLN[L\NLNPLQNLNRLSNVLWN44RMO quipnoN)KN)Who are you?N)Burn in the nine hells, mage!N)0And were you the one to destroy the other fey?N)(I will wrest the flesh from your bonesvN)(They say you are the worse... LorekosiAN).How dare you step foot within these lands...N)We needn't be so hasty...N)&So you intend to consume me as well?N)"I will not be easy meat for you!|N)Try and consume me...XN)L 3X? k MO quipnoN)KuN)\b"Who are you?", you demand as thick plumes of smoke pour forth from your nostrils. \b "My name is unimportant", the white mage replies."But if you wish to know who it is you shall soon be part of... then know the name Lorekosi." \b  N) N)"Burn in the nine hells, mage!" you roar defiantly. \bThe white mage gently laughs again. "Many have tried, but all have been consumed." \bN)  N) N)"And were you the one to destroy the other fey?" you demand. \b The white mage before you smiles. "Not destruction for destruction's sake. They and their powers are part of me now."\bN)  N)Z N)"I will wrest the flesh from your bones and suckle on your marrow!" you roar and bare your wicked curve teeth at the intruding mage.\b The white mage gently laughs again. "Many have tried, but all have been consumed." he replies.\bN)  N)N)"They say you are the worse... Lorekosi" you say.\b The white mage's pale eyes gleam as his lips quirk upwards in a smile. "So you know of me already. Good, then you shall know the one who defeats you. Aye, of that I am the best... and the worst of enemies to the fey." he says\bN)  N)N) "How dare you step foot within these lands." you growl at the white mage, black plumes of smoke rising from your muzzle. \b "You may believe that you control these lands now,"responds the white mage, "But soon enough they shall be free. And far better off for it."\bN)  N)N)"We needn't be so hasty." you try and sooth the white mage. "Perhaps a deal can be struck..."\b "Trying to strike a bargain with me, fey?"laughs the mage, "Beg for your life all you want, you shall soon be a part of something far greater. "\bN)  eN)"So you intend to consume me as well?" you say as the smile widens upon the pale mage's face. "Then try your worst and I shall return it a hundredfold!"\b And with that you rear up once more, your wings clashing into the heavens above. N)  1N)"I will not be easy meat for you!" you roar as you rear upwards once again. No games this time, nothing but the full brunt of your power.  iN)"Try and consume me!" you roar defiantly as you spring once more to your feet, your dark wings snapping open with a vicious 'BOOM'. The white mage goes back a mere step, the smile never wavering upon his face.   XN)L )nQ   !!.!.!.   counter wwA long wooden counter runs across the far end of the room. Behind the counter lies the open doorway to the scullery and several shelves full of tapped kegs, bottles in various stages of being drunken, and a paltry collection of books that you've read a thousand times over. \b Atop the counter, in his favorite resting spot, lounges Butterball the resident tavern fat cat. MO actorN# uMO actorN% VThe counter is wooden. You've become quite adept with feeling wood as time goes on. ,MO actorNL& -PMO actorNp' 1The counter has a distinct smell of cat to it. VMO actorN( WMO actorN* qYou absentmindedly scratch at the counter. Butterball mewls at you, wanting you to scratch him instead. dMO actorN+ eMO actorN- )You stealthily duck behind the counter.N. >" `N/ T"There's not that much interesting back there. " the tavern maid calls out to you.d2eMO actorNt1 SMO actorN2 4You brush a handful of cat hairs off the counter. TMO actorN3 UMO actorN5 >" jN6 [You sit atop the countertop pecking away assiduously as Butterball bats at you playfully.N8 )UGMO actorN9 HVMO actorN; >" QN> BYou curl up on the countertop across from Butterball. The tavern maid, pauses, stares at you and finally rolls her eyes and comes over. \b "Now get off before the missus sees you there!" she tells you. "It's bad enough with the cat doing it, now nevermind you! " and, unresisting, you are half helped, half dragged off. ND @You roost and preen your feathers right next to Butterball. The tavern maid notices this and rolls her eyes to the heavens. \b "Look at that cat, " she exclaims. "The supposed great mouser, the great chaser, bedding down right next to the animal he's supposed to be chasing! "\b "Don't that be one o' the signs," asks !>n "Of the end o' the world and the coming of paradise? " \b "Methinks its just the sign of a lazy cat," says !>F. NF 4EMO actorN> H FMO actorNb J >" Nb M You lean back and leverage yourself atop the long, narrow counter. \b "There are plenty of empty seats," the tavern maid tells you with a wave of her finger. Nb N >" Nb Q @You roost and preen your feathers right next to Butterball. The tavern maid notices this and rolls her eyes to the heavens. \b "Look at that cat, " she exclaims. "The supposed great mouser, the great chaser, bedding down right next to the animal he's supposed to be chasing! "\b "Don't that be one o' the signs," asks !>n "Of the end o' the world and the coming of paradise? " \b "Methinks its just the sign of a lazy cat," says !>F. Nb R MO actorN0 T dMO actorNT V >" E<4! NT ] In one fluid motion you leap atop the counter, balancing precariously along its edge, as Butterball gazes up at you inquisitively. From here you can almost touch the ceiling. \b With your back turned to the scullery entrance you never see the tavern keeper until she is sweeping your legs out from under you and unto the floor. You are only just able to pull up and land gracefully at the last moment. \b You scowl at the tavern keeper who scowls right back at you. \b "You pay for a drink at the counter or you pay for a bed to sleep on, " she says. "None of this funny business of you lolling all over the counter! " and she gives you one last warning glare before returning to the scullery. "4hNT _ >" E<4" NT ` You ready yourself to leap atop the counter once again... and then you catch sight of the tavern keeper peering out of the scullery with a large frying pan in hand. You decide perhaps this isn't so important after all. aNT a >" MNT b AYou perch atop the counter as Butterball playfully bats at you.JKMO actorNd MO actorNe f You knock on the wooden counter for luck. Not that someone such as you is ever in the need for it. MLONLNPLQNRLSNLMO actorNg NMO actorNi >" Nj With claws outstretches and gleaming, you dive at the counter again and again, raking it with beak and talon. Butterball continues to doze atop it, unperturbed. \bNl >"" ZNm KThings have taken far too interesting a turn for distractions right now. zNo >7" E >" 6Ns "That be enough of your shenanigans for today!" the tavern keeper declares and begins dragging you out by the ear. Or she tries, but you are far too quick to submit to a humiliation like that. \b For a moment you ponder bringing down a swarm of bees, or slavering dogs, or even simply setting the tavern keeper's hair on fire for her impudence. You finally decide not to risk destroying your disguise for generations to come with such a display, and so with quiet dignity you bid farewell to the tavern and walk out on your own. \b"8>'Nv >6" E >" Ny WButterball goes flying off the counter with a great yowl as you begin to pummel the offending piece of furniture with fists and kicks. The cat stands stiffly on the floor next to you, fur fluffed out in indignation, as the attack continues onward and the other tavern patrons gape at you in surprise. \b "What in the hell is he doing?" asks !>F and this thought is echoed quite emphatically as the tavern keeper comes storming out of the scullery as wth a final indignant lash of his tail, Butterball returns to his post atop the counter.\b "Now what be the problem?" says !>. \bN{  "7N WButterball goes flying off the counter with a great yowl as you begin to pummel the offending piece of furniture with fists and kicks. The cat stands stiffly on the floor next to you, fur fluffed out in indignation, as the attack continues onward and the other tavern patrons gape at you in surprise. \b "What in the hell is he doing?" asks !>F and this thought is echoed quite emphatically as the tavern keeper comes storming out of the scullery as with a final indignant lash of his tail, Butterball returns to his post atop the counter. "Have you gone mad?" the tavern maid stares at you. \bN  "6MO quipnoN KfN I..err... tripped?^N I saw a spider...?=N Quake before me!MO quipnoN KN \b"I...err... tripped?" you say, putting on your most innocently apologetic face. \b "Great gods," says the tavern maid. "Be more careful or you'll break your neck!" \b "He trips like that again and he'll be breaking all our necks!" !> exclaims.  N N I saw a spider," you explain. "A big furry hideous one nearly as large as a...as a..." you fumble around for a suitable spider size. "as big as this cup!" you say and point towards a random mug. \b The tavern maid lets loose a tiny shriek. "That's be a big bug," says !>f. \b "I hate spiders as much as the next person, but you may have overreacted just a wee bit." says !>F.  N "Quake before my awe-inspiring power!" you command the tavern patrons who gape up at you as if you've gone completely daft.\b "That be enough of your shenanigans for today!" the tavern keeper declares and begins dragging you out by the ear. Or she tries, but you are far too quick to submit to a humiliation like that. \b For a moment you ponder bringing down a swarm of bees, or slavering dogs, or even simply setting the tavern keeper's hair on fire for her impudence. You finally decide not to risk destroying your disguise for generations to come with such a display, and so with quiet dignity you bid farewell to the tavern and walk out on your own. \b"8   >:W  #.$MOvantageN""MO actorNE"  nothing 00It bears a remarkable resemblance to nothing.  x555#J$MOvantageN""MO actorNE" god ,,You have never seen anything of the sort. $MO actorN%dMO actorNEThe thought is laughable. You are the closest thing to a god here.   ) in out ofBMNu< Nv< Nw!NxCMN{!< , !< !< N|aMO verbosityN<N<N<N< NYMO objN)< ! D<N))N)< N)MO#actorvdobjprepioN! E<E + NN! E<E , E - NNGNYMO otherRoomNf%You% can't reach that from !< . Nf 1# ground It lies beneath %youm%. ,  the ground on off of NMN C  N <]N C N yMO actorN  Okay, %you're% now sitting on < . N  ]N &N E5MOmeActorNL  ]NL /MO actorN <N ^9MOactordobjN N _9MOactordobjN N  QMOactordobjN:  Thrown. N:  &N: 5&#MOactorioNMO actorNH UMOactordobjNl  (Nl &You lash out at the shadow dog with !< . It gives a surprised yelp of pain and backs off, confusedly. It looks at you, red eyes blinking, and as you draw back your arm once again it gives a snarling howl and then slinks off, tail dragging between its back legs. >TfTnfTnfT4bMrMNA<  BNA3shadow dog with teeth clamped tightly to your legNA shadow dogMNA`A dark hulking shadow of a dog, tall as a man's waist, with deep red eyes and slavering jaws. NA<  HNA<It currently has its jaws clamped tightly around your leg.+m ,)MNA< > NA]NA<,,NA<,<+ NA,NA<+<,@<h i !!\bA shadowdog stalks into view.WMNA>" E > < E >" NAՠ<K^NANA NAUNANAyThe shadow dog's muzzle twitches, every muscle within his body vibrating as his great red eyes glares straight at you. NANANAbWith a reverberating howl the shadow dog lunges at you and sinks his teeth into your right leg. <&C)CC)RNA>" E < > uNAiThe shadow dog chases after you, snapping his jaws and leaping straight into the air as you flap away. MMNA<  DNA5The shadow dog is clamped tightly to your left leg.)NA\bA shadow dog hunts prey. MNAC<-MO actorNfA MO actorNA>  E >" DNA5Creating that here would bring too much attention. NA<-" <NA-You've created enough hellhounds for today.NAFA shadow rises from the ground with rippling dark muscles and wild red eyes, pupils contracted to mere pinpricks. Slaver trails from a mouth too full of wicked sharp teeth to properly close. Ooooooh... that was not exactly what you were aiming for...\b The shadow dog turns upon you with a harsh snarl rising in its throat. > >&C)C"-NA> > E >  E >." NAVal's !>k @ eyes widen slightly as the shadow dog's muzzle swings in between the two of you. The flute music peters to a stop. \b "I have a sudden wondering for what lies over yonder hills," Val says airly to no one in particular. The silver flute disappears into his cloak and he saunters, very carefully, foot by foot and never glancing back at the shadow dog, over a shallow knoll to the north. NA>".>!>&>&NB> > E >  NBA moment before Val was drawing patterns in the sand and then suddenly he has shimmied up into the lower branches of one of the metal trees. You blink up at him, wondering how he managed to move so fast. "/>C0NB> > E >  NBVal glimpses the shadow dog on the hunt and with a flurry of his dark cloak, he has pulled himself up into one of the birch trees. >>N B> > E >  N BWithout a single break in his chant, Val gracefully scrambles up the smooth slope of a nearby hill and out of the shadow dog's reach. >N B> > E >  NB{Val curses slightly at the appearance of the shadow dog and then dives into cover in the depths of the hole his has dug. >NB> > E >  E >  E >  NBVal gazes at the snarling dog bristling at the center of the courtyard. \b "I believe that's the sign that we should be off," he tells you and then back away carefully, step by step, towards the northwest. >".!">&NB> > E >  E >  E >  N.BHe then swings around to Val, who narrows his own eyes as he gazes back, and then to the pale faced Layna. As if drawn to the scent of fear, the shadow dog lets loose with a snarling howl, and heaves himself at the stunned maiden. \b Val rushes forward and slams his shoulder into the dog, sending it stumbling widely to the right and away from the girl. Layna yelps and dives for the tavern door. \b The shadow dog regains his feet and stands there for a moment glaring at Val, dark throat vibrating as a low snarl rises in his throat. It springs forward once more. Val makes a slashing motion with his right hand and the dog freezes in midair, dangling helplessly for a moment before it's suddenly hurled away. \b You freeze, all your attention drawn to the pale haired young man. Or rather the man who has the seeming of being young. A mage... \b The dog scrambles to its paws once again, glaring evilly at Val before turning tail and loping off to the north. Layna, peeking around the edge of the tavern door, has turned an interesting shade of green. "You're a mage," she says to Val and it sounds half an accusation. \b "What's happenin' out there?" you hear faintly from the inside of the tavern. \b "Val's a mage!" Layna shouts back inside, as if that ought to explain everything. \b "I do know a bit of magic," Val says cooly as he runs his hand through his hair. \b "How very nice for you," says Layna and she disappears inside. The door slams shut with a boom of finality behind her. \b Val gazes after the girl and laughs softly, dryly. "I think she's more afraid of me now than she was of the fey!" \b "That sounds perfectly reasonably to me," you reply as you hesitate inside. This was turning out to be far more dangerous than you could have imagined. \b Val turns to you and raises a pale eyebrow, as if wondering if you would run off too. But you were never one to shirk a challenge. And there's been no one truly worthy of challenging you yet. >>".!">>&N0B> > E >  E >  E >  2N8BIts intense gaze wanders from you to Val to Layna to the Old Coot and back again. Its dark muscles ripples, its haunches bunches, and then it hurls itself with a gutteral snarl towards the throat of the Old Coot. Layna shrieks and scrambles atop the apple barrel, Val tenses as if on the point of running, and the door slams in the face of the shadow dog as the Old Coot disappears into the tavern. \b "Quick, isn't he?" Val says dryly. \b The dog sniffs around the tavern door, to the sounds of faint shrieks coming within, and finally circles around the building and out of sight. Layna half falls, half scrambles down from atop the barrel. "What in all the nine hells was that?" she asks. \b "I believe that was the welcoming gift from the fey," Val replies and glances over at you. >".N:B> > E > m *N;BVal waves his hand absentmindedly at the shadow dog. It pulls up suddenly with a yelp and looks about confusedly. Val's gaze remains on the north and the dog's soon follows suit. Its nostrils quiver and then, suddenly, it wheels about and lopes away as fast as its legs can carry it. N=B> > E >  KNAB)Biding your command, the shadow dog hurls itself at Val, its lips pulled back in a rictus snarl. It is caught in mid-leap, frozen in the air for one hapless moment before, with a shriek, it is flung halfway across the lake. \b It crashes into the water and, motionless, sinks beneath the waves. >NCB>   E >    LNEB*The shadowdog hurls itself towards the white mage, every sharp tooth within its maw bared wide, foam frothing free from its mouth. It manages only three strides before, with a shriek, it is lifted into the air and bent backward with a snap. It falls and sinks through the ground without a sound. >  3NGB>  E >   E >" NIBWith a great baying howl the shadowdog leaps past Val and straight for the white mage's throat. It manages to even close its teeth around its prey before it burst away into sea foam.@NKB>  E >   E >" NMBThe shadowdog leaps eagerly from mage to mage, head swiveling between the dark and light. Finally with a great baying howl it chooses its prey and leaps forward... and explodes into so much sea foam. You do not know which man it was who struck the thing down. MO actorN PBMO actorN RBFrom a distance comes a baying and a howling and then over a nearby rise comes the shadowed figure of a dog, responding to your summons. N TB> > E >  E >." N UBVal's !>k @ eyes widen slightly as the shadow dog's muzzle swings in between the two of you. The flute music peters to a stop. \b "I have a sudden wondering for what lies over yonder hills," Val says airly to no one in particular. The silver flute disappears into his cloak and he saunters, very carefully, foot by foot and never glancing back at the shadow dog, over a shallow knoll to the north. N WB>>&".!>&3N ZB> > E >  N \BA moment before Val was drawing patterns in the sand and then suddenly he has shimmied up into the lower branches of one of the metal trees. You blink up at him, wondering how he managed to move so fast. "/*N ^B> > E >  N `BVal glimpses the shadow dog on the hunt and with a flurry of his dark cloak, he has pulled himself up into one of the birch trees. >hN bB> > E >  N dBWithout a single break in his chant, Val gracefully scrambles up the smooth slope of a nearby hill and out of the shadow dog's reach. N fB> > E >  N gB{Val curses slightly at the appearance of the shadow dog and then dives into cover in the depths of the hole his has dug. > > E >  E >." N hBVal's !>k @ eyes widen slightly as the shadow dog's muzzle swings in between the two of you. The flute music peters to a stop. \b "I have a sudden wondering for what lies over yonder hills," Val says airly to no one in particular. The silver flute disappears into his cloak and he saunters, very carefully, foot by foot and never glancing back at the shadow dog, over a shallow knoll to the north. N jB>>&".>>&! N mB> > E >  N oBA moment before Val was drawing patterns in the sand and then suddenly he has shimmied up into the lower branches of one of the metal trees. You blink up at him, wondering how he managed to move so fast. "/>C0N rB> > E >  N tBVal glimpses the shadow dog on the hunt and with a flurry of his dark cloak, he has pulled himself up into one of the birch trees. >>N vB> > E >  N xBWithout a single break in his chant, Val gracefully scrambles up the smooth slope of a nearby hill and out of the shadow dog's reach. >N zB> > E >  N {B{Val curses slightly at the appearance of the shadow dog and then dives into cover in the depths of the hole his has dug. >MN }B>   E >    LN B*The shadowdog hurls itself towards the white mage, every sharp tooth within its maw bared wide, foam frothing free from its mouth. It manages only three strides before, with a shriek, it is lifted into the air and bent backward with a snap. It falls and sinks through the ground without a sound. >  N B>  E >   E >" N BWith a great baying howl the shadowdog leaps past Val and straight for the white mage's throat. It manages to even close its teeth around its prey before it burst away into sea foam.N B>  E >   E >" N BThe shadowdog leaps eagerly from mage to mage, head swiveling between the dark and light. Finally with a great baying howl it chooses its prey and leaps forward... and explodes into so much sea foam. You do not know which man it was who struck the thing down. N B> > E > m -N BVal waves his hand absentmindedly at the shadow dog. It pulls up suddenly with a yelp and looks about confusedly. Val's gaze remains on the north and the dog's soon follows suit. Its nostrils quiver and then, suddenly, it wheels about and lopes away as fast as its legs can carry it. [N B> > E >  5N B)Biding your command, the shadow dog hurls itself at Val, its lips pulled back in a rictus snarl. It is caught in mid-leap, frozen in the air for one hapless moment before, with a shriek, it is flung halfway across the lake. \b It crashes into the water and, motionless, sinks beneath the waves. >,MO actorN2B-@MO actorN2B!The smell of sweat salted fur. LMO actorN3BNlMO actorN,3B>" N,3ByYou swoop past and rake the shadow dog with your claws. It snaps at the air, missing your wings by mere fingerswidths. N,3B>" E <  XN,3BIYou kick at the shadow dog but he remains tightly clamped to your leg. JN,3B>" 6N,3B*With your bare hands? You'd rather not. MO actorN4BSMO actorN4B4You jump away from the dog as he follows closely. MO actorN5BMO actorN?5B<  HN?5B9You'd rather clean the dog off you than clean the dog. :N?5B.You'd rather keep your distance, thank you. MO actorN5BnMO actorN6B<  4N6B%Alas, you are already wearing him. mN6BaThe shadow dog appears that he'd put up quite the struggle if you tried to claim his fur coat. MO actorN6B>MO actorN7BIf it were only that simple. MO actorND7BMO actorNh7BaYou gaze at the shadow dog, who glares back at you, and you decide you'd much rather keep your !> wings hands to yourself. #MOactorioN!8BMOactorioNJ8B>" dNJ8BU"KRAW! KAK KAK KAW COA! " you squawk at the shadow dog. The dog growls back at you.wNJ8BYou ask Butterball about ! B. The shadow dog merely stares back at you with blood red eyes. #MOactorioNU9BMOactorioN~9B&" ,N~9B&You lash out at the shadow dog with ! . It gives a surprised yelp of pain and backs off, confusedly. It looks at you, red eyes blinking, and as you draw back your arm once again it gives a snarling howl and then slinks off, tail dragging between its back legs. !>gN~9B&You lash out at the shadow dog with ! ' and it gives a great barking laugh. MO actorNB;BMOactordobjNf;B<&" )Nf;B&You lash out at the shadow dog with !< . It gives a surprised yelp of pain and backs off, confusedly. It looks at you, red eyes blinking, and as you draw back your arm once again it gives a snarling howl and then slinks off, tail dragging between its back legs. !>dNf;B&You lash out at the shadow dog with !< ' and it gives a great barking laugh. MO actorN#=B^UMO actorNG=B6You glance at the shadow dog and decide against it. aMO actorN=BbMO actorN=BqThe shadow dog seems only interested on feasting on you. Perhaps if there was something else to distract him...+MO actorN\>B3@MO actorN>B!Dark fur over rippling muscle. MO actorN>BmMO actorN>BNYou howl at the shadow dog. It pricks its ears at you and howls right back. MO actorN]?BgMO actorN?BHYou whistle at the shadow dog. It pricks its ears at you in interest. "MO actorN?B#lMO actorN@BMYou bark and snarl at the shadow dog, who returns the favor with interest. MO actorN@BTMOactordobjN@B1" N@B@Slaver drips of the shadow dogs lips as it sniffs hungrily at ! {. It wolfs its meal down in one gulp, looks up at you and wags its tail a few times before loping off with a happy yowl. >!&<N@B0The shadow dog pays no mind to your offering. MO actorNBBMOactordobjN&BB1" VN&BB5The shadow dogs ears prick forward as he stares at ! . /N&BB#The shadow dog pays you no heed. oMO actorNBBp MO actorNCB<2" NCBThe shadow dog gives a yelp of surprise as it suddenly begins to shrink, folding in upon itself until it has returned to its original size. <2! ENCB9The shadow dog is perfect... a perfect terror that is. MO actorNDBgMO actorN8DBHMaybe when you're in a more masochistic mood. A lot more masochistic. /MO actorNDB.MO actorNDByYou hear a great rushing noise as the shadow dog breathes in and out. A low growl emanates from deep within its chest. MO actorNgEBRMO actorNEB3He already belongs to you, rabid slaver and all. MO actorNEBMO actorNFB>" NFC"Who's the prettiest rabid dog in all the land?" you coo at the shadow dog. "Yes he is! Yes he is!" \b The shadow dog snarls and leaps forward, trying to bite your head off. NFC> > ;NFC,Val stares at you as if you've done daft. bNFCV"COA COA COA!" you croak and coo at the shadow dog as it tries to bite you in half. MO actorNGCMO actorNGC<3" NG CYYou give the shadow dog a gentle shake. He awakens with a start and tries to snap your !> head hand off in thanks. 'NG CIts already quite awake. MO actorNHCAMO actorNHC"You squawk at the snarling dog.  MO actorNIC!MO actorN@IC<  N@ICrThe shadow dog blinks sleepily, yawns, walks around in a circle, once, twice, thrice, and curls up fast asleep. "3HN@IC<The shadow dog is too busy worrying at your leg to sleep. TMO actorN;JCUMO actorN_JC>" N_JC}You swoop down and dive upon the shadow dog, scratching and pecking for all you're worth. The dog snaps and snarls at you. N_JC)U MO quipnoNEK)CKNEK*C Oh really? I hadn't noticed...NEK+CYour perception astounds me!NEK,CWhat? What's on my leg?kNEK.CAye, it can't hurt...GNEK/CNo thanks...,)BhMO quipnoNWL5CKNWL6C\b"Oh, really? I hadn't noticed!" you snap back at the mage. Val tilts his head as he regards the snarling shadowdog, still tightly clamped to your leg but now its rolling eyes glare at the mage. "Do you need some help?" he asks.  NWL9C\b"Your perception astounds me!" you snap at the mage. Val ignores your tone of voice and tilts his head as he regards the snarling shadowdog, still tightly clamped to your leg but now its rolling eyes glare at the mage. "Do you need some help?" he asks. $NWLl Pookiebuttoh glorious mage!" you say as the newly grown dog tries to gnaw your leg off. \b Val clucks to himself. "The magics did not mix very well," he says as he edges away from the from you and the dog. >##NWLBC\b"No thanks" you say. "I am fine as I am." \b "If you say so," says Val as he edges carefully away from you and the attached dog. )b!4_^de5476VW}~=1"#$%@. ()MN/(<(KN0N8\b"The fey?" says the maiden. "Are they truly here?" \b "Aye," replies the old man. "All around us. Well, not here," he demurs when the maiden looks uneasy at his words. "But in the land that surrounds this here tavern." And it is all you can do not to laugh. \b "I've never been so close to the fey before," says the maiden. "But I've heard some terrible things..." \b "That they can make fire rain down from the sky, and the earth shake like a bowl of curds, they'll turn wood into water and water into air, and they'll steal the breath right out of your throats, all the while taking on the form of the thing you most desire... aye, tis all true!" says the old man with great satisfaction, as if he would even recognize a fey if it wandered up and said 'hello' to him. \b >vN:NG\bThe door makes no sound as it opens and so you are the only one to notice the stranger walking into the room. The cloaked figure pulls back its traveling hood to reveal a rather handsome face underneath curiously pale hair. Your attention is pulled to the youth as he strides forward to stand at the shoulder of the chattering old man. \b The geezer gives a start at the sudden appearance of the young man at his side. "You surprised me there, lad."\b "Spooking yourself with tales of the fey, are you...elder?" so says the stranger with a rather pleasing lilt his speech.\b "Foolishness," mutters the other old man.\b "It is not foolishness, by god's own breath tis all true!" exclaims the old man. "Although the fey hereabouts is supposed to more mischievous than evil. Or so they say. I haven't heard tell of anyone's eyeballs boiling out of their sockets or anything such around here, at least not lately anyways." \b "I believe you," the stranger soothes.  NINj\bHow can you ignore this invitation? They are calling out to you! And so unnoticed and unseen you sink through the floorboards, shifting past the tavern until you are well out of view outside. And then you solidify, the air twisting and darkening about you, as you grow shape and form, flesh and blood, or a close mimicry of such. You pull a shadow over you that falls into the folds of a dark cloak, and then you are human. \b With a toss of your newly formed head you wander jauntily back into the depths of the tavern.\b They still speak of you.\b "-- wealth of dreams," the old man is telling to the stranger. \b You make certain to create noise as you enter... the screech of the tavern door as it swings shut behind you, the fall of footsteps against the floorboards, the creak of the table that you lean against. Everyone's attention is drawn to you. The pale stranger's eyes rest on you for only a moment before he turns away, yet in that moment you sensed the depth of that gaze. Oh yes, you'll have to watch that one. \b "So it's a treasure hunt, is it?" you inquire spiritedly. \b The old man's face lights up. "Wouldn't that be something?" he says. "A good ol' treasure hunt like in all those stories..."\b "It sounds quite engaging," says the maiden. "If it's safe...?"\b "Quite safe," you assure her. "Probably."\b "Aye, I'm quite interested too," says the stranger and you feel his unreadable gaze on you once again.\b "And so you're all bound and determined to rush headlong into the fey's lands? You're all mad!" proclaims the other old man.\b "As I've been often told," says the young man, and the others begin to speak excitedly of this new adventure undertaken. \b And so the party is formed. Let the game begin. \bANmNpJAnd here's the end. Boot me over to the tavern to start the true game. !
\bGilded

The Lily and the Cage\b ____________\b_________\b_____



Press spacebar to continue
N}AN~N
New Players Please Type ABOUT \n to have a foggy clue what is going on
NANN!>\b>>F>>GH"!5C)C)"}{V/.  floorMN@!,MO actorNZB-MO actorN~D>" +N~EThe biting burn of ashes. N~GYou put your nose to the floor and sniff. You don't smell anything particularly interesting, but you do get quite a few odd glances from the other tavern patrons. ./01zy$/.  floorMN>" N|If a floor still remains underneath the smoldering embers that was once the tavern's front room it lays beyond your sight.tNhThe tavern floor is crafted from solid wood, swept clean yet scuffed from years of not-so-gentle use. ,MO actorNS-MO actorNw>" +NwThe biting burn of ashes. NwYou put your nose to the floor and sniff. You don't smell anything particularly interesting, but you do get quite a few odd glances from the other tavern patrons. MO actorN~MO actorN>" N Ashes. EN9The floor is hard, solid... and a bit gummy in places. /MO actorN*.MO actorNN>" ANN2Silence but for the far off chirping of a bird. NNsYou surrepticiously press your ear to the floorboards and the sound of footsteps reverberates through your head. 1MO actorN90MO actorN]>" jN][You dig through the remains of the tavern but discover nothing but ashes and more ashes. uN]iIt would draw far too much attention if you started pulling up floorboards in the middle of the tavern.yMO actorNgzMO actorN>" LN=Oh, you've quite closed the tavern enough as it is already!2N&The floorboards are already closed. >MO actorN4?wMOactordobjNX>" NXPeople are bound to come poking around the remains of the tavern eventually. You'd be better off burying anything somewhere else. NXIt would draw far too much attention if you started pulling up floorboards in the middle of the tavern. Perhaps you ought to go outside in order to bury ! ?@>A?.  wooden bird cageMNS!-,zy44   .  wooden bird cage3MN"An airy cage of light wood and woven reeds. Dried leaves covers its bottom and a lone birdperch dangles from its curved top. The cage opens with a simple square latch to its side. \bN#>I  UN$IA little songbird watches you intently from its perch within the cage. MO actorNt%GMO actorN'(The pale wood is rough and splintery. -MO actorN)iYou take a hesitant sniff of the cage. Eck... as you feared, the cage could do with a better cleaning. |MO actorNy+#MO actorN->I  N.With a joyful trill the songbird bursts free of its cage. The tavern maid gives a squawk of dismay and rushes after it. The bird circles about the room while the patrons whoop and holler and the maid chases after it frantically waving her apron, a nearby broom, or anything else at hand. \bWith a final flutter of wings, the little songbird swoops out an open window and flies out of sight towards the north.>I&!>&"|"I9-N0!You open the birdless birdcage."|yMO actorN1zMO actorN3>I  -N4It's already closed."|VN6D"Rather too late for that now," the tavern keeper grumbles at you.!|N74@MO actorN8An airy cage of light wood and woven reeds. Dried leaves covers its bottom and a lone birdperch dangles from its curved top. The cage opens with a simple square latch to its side. \bN9>I  UN:IA little songbird watches you intently from its perch within the cage. MO actorN<BCMO actorN-?>I  N-@With a joyful trill the songbird bursts free of its cage. The tavern maid gives a squawk of dismay and rushes after it. The bird circles about the room while the patrons whoop and holler and the maid chases after it frantically waving her apron, a nearby broom, or anything else at hand. \bWith a final flutter of wings, the little songbird swoops out an open window and flies out of sight towards the north.>I&!>&"|"I9N-A>" VN-BGYou will never be able to cram yourself inside of that in this form! iN-C>" UN-HIYou flit into the cage and proudly stand on the recently vacated perch. \b One of the old men notices this and bursts into laughter. "Look! The ol' crow thinks he's a songbird now!"\b The tavern maid comes along and gently shoos you out of the cage. It's just as well, you couldn't have borne being cooped up like that, anyhow.5mMO actorNu>" FCYou shouldn't overburden yourself with items while in this form. 'MO actorNu")    songbirdMNa!./23H     songbirdMNQ>I  NRA delicate little songbird with plain brown plummage and a smattering of black speckles. The bird's slender feet clasp its woven reed perch as it tilts its head and regards you with a bright beaded eye./MO actorN+S.BMO actorNOT#The songbird twitters to itself. MO actorNUMO actorNW>I  NXWith a joyful trill the songbird bursts free of its cage. The tavern maid gives a squawk of dismay and rushes after it. The bird circles about the room while the patrons whoop and holler and the maid chases after it frantically waving her apron, a nearby broom, or anything else at hand. \bWith a final flutter of wings, the little songbird swoops out an open window and flies out of sight towards the north. NY>I&!>&"|"I93MO actorN[2MO actorN]>I  N^With a joyful trill the songbird bursts free of its cage. The tavern maid gives a squawk of dismay and rushes after it. The bird circles about the room while the patrons whoop and holler and the maid chases after it frantically waving her apron, a nearby broom, or anything else at hand. \bWith a final flutter of wings, the little songbird swoops out an open window and flies out of sight towards the north.>I&!>&"|"I9MO actorN_ MO actorNa>" rNbcYou perch on the woven outer reeds of the bord cage, but the songbird remains out of your reach. rNdfYou reach through the wooden slats of the cage and stroke the soft downy feathers of the songbird. \\\.4  tavern tableMNm!u&u&u.4  tavern table A smattering of little round tables litter the room with a few of their longer brethren holding court in the center. The tables are wooden, half of them a light yellow wood while the others are darker and pitted. All of them clean, if not exactly sparkling. MO actorNEoMO actorNiPThe wood has been worn smooth of all splinters by years of use and polishing. -eMO actorNFThe table smells of beeswax... it must have been recently polished. EMO actorNIFkMO actorNm>" NmYou sit gingerly atop the edge of a table for all of two moments before the tavern maid comes bustling by and shoos you off. \b "There are empty chairs, you know. " she says. Nm>" rNmfYou perch atop a handy table top. The tavern maid eyes you warily and then heaves a great big sigh. GMO actorNHMO actorN>" NYou slump across one of the longer table tops. The tavern maid comes by and, taking you by the arm, drags you half off. \b "There will be none of that, now!" she says. "Pay for a bed if you need to lie down." \b "Yet he has no bed!" you protest as you point towards the softly snoring drunkard in the nearby darkened corner, head pillowed within his burly arms. \b "You never mind him, " says the tavern keeper. "That's not the type of man you'd be wanting to emulate!"N>" NYou roost atop one the darkened round tables. The tavern maid makes half hearted shooing motions at you. It seems you may have finally worn her down. MO actorNMO actorNThe tavern maid has done a pretty thorough job of cleaning the table. Any stains within its surface now are bound to remain there forevermore. MO actorNhMO actorN>" E<4! ONCIn one fluid motion you leap atop one of the little round tables.N>  "NThe two old men stop their jawing before the fire to gaze up at you in expectation. \b "Hark now, are you going to give a speech, lad?" asks !>F .\b "Nay, be dancin' for us!" !> calls out with a cackle. \bNThe stout tavern keeper bustles out of the nearby scullery and, with a a surprisingly quick motion for someone so bulky, kicks the table out from under you. You land lightly on your feet as the table goes bumping down an aisle. \b "That was rather vicious, my lady." you say to her. \b The tavern keeper rights the table once again with a solid thunk. "I'll be having none of this silly business," she says with a huff, "With you getting boot prints all over my tables."\b Next time you should try a larger table not so easily kicked away."IN>" E<4" NYou ready yourself to leap atop one of the larger rectangular tables at the center of the room... and then you catch sight of the tavern keeper peering out of the scullery with a large frying pan in hand. You decide perhaps this isn't so important after all. N>" rNfYou perch atop a handy table top. The tavern maid eyes you warily and then heaves a great big sigh. JKMO actorNg MO actorN e You knock on the wooden tables for luck. Not that someone such as you is ever in the need for it. MLONLNPLQNRLSNLMO actorNUNiMO actorNy>" Ny~In a wild flapping of wings you scratch, peck, and beat at the nearby table. \b "That bird tis awfully mad at that table, " !>, comments as he takes a puff at his pipe. ~Ny>"" ZNyKThings have taken far too interesting a turn for distractions right now. Ny>7" E >" 4Ny With a mighty push and kick you send the tavern table crashing down the floor, knocking over chairs, benches, and other tables in its wake. The other tavern patrons gawk up at you in surprise. Even the drunkard raises his head to peer around blearily.\b "That be enough of your shenanigans for today!" the tavern keeper declares and begins dragging you out by the ear. Or she tries, but you are far too quick to submit to a humiliation like that. \b For a moment you ponder bringing down a swarm of bees, or slavering dogs, or even simply setting the tavern keeper's hair on fire for her impudence. You finally decide not to risk destroying your disguise for generations to come with such a display, and so with quiet dignity you bid farewell to the tavern and walk out on your own. \b"8>Ny>6" E >" RNy With a mighty push and kick you send the tavern table crashing down the floor, knocking over chairs, benches, and other tables in its wake. The other tavern patrons gawk up at you in surprise. Even the drunkard raises his head to peer around blearily.\b "Now what be the problem?" says !>. \b "7RNy6With a mighty push and kick you send the tavern table crashing down the floor, knocking over chairs, benches, and other tables in its wake. The other tavern patrons gawk up at you in surprise. Even the drunkard raises his head to peer around blearily.\b "Have you gone mad?" the tavern maid stares at you. \b "6TMO actorNUkMO actorN >" 8N )With quite a bit of relish you peck at the wooden tables. The tavern maid gives a squawk that any bird would have been proud to lay claim to and comes rushing over to you, hands outreached in murderous rage. \b You lazily flap away from the maid and take shelter atop one of the tavern rafters. N )UVMO actorN}WMO actorN >" IN#:You idly scratch at the table's surface with a fingernail. You find yourself doodling a little picture of a happy smiling dragon, curls of smoking pouring out of its nostrils as it bares all its fangs in glee. \b The reactions of the tavern maid and keeper when they find the drawing ought to be amusing to see. cN%WAs the tavern maid turns her back, you claw frantically at the wooden table surface. ^^^.4  tavern benchesMNu!)$)$).4  tavern benches The benches are backless, made of rough hewn wood, and are mostly tucked under the longer tables or set before the hearthfire. MO actorN0MO actorN2Although some effort has been made to sand down the top of the benches, its back, underside, and legs remain ragged and splint worthy. -MO actorN4jThe scent of trees and sap still lingers faintly around the benches. They must have been recently made. EMO actorN%5FMO actorNI7sYou gingerly perch atop the wooden bench, carefully avoiding the rougher parts where splinters still lie in wait.GMO actorN8HMO actorN:>" N;You lounge across the rough hewn bench, crossing your long legs elegantly before you. You may look the picture of leisure, but this pose is actually rather uncomfortable, and so you soon rise to your feet once again. N<>" {N=oYou roost atop a rough wooden bench, watching the peaceful scene of the tavern playing out before your eyes. MO actorN> MO actorN@>" E<4! LNCYou easily step atop a nearby low lying bench. The other tavern occupants blink up at you in surprise for a moment before returning to their conversations. "Did I ever tell y' about the gold in that there nearby forest?" asks !>X. \b "You mean the treasure you were too afrightened of the fey to look for?" replies !>.\b \^!>F gives a sniff. "Well I twasn't the only one! There was this time that a true and blue knight was a'stayin' here..." \b "Aye, aye... a true knight"\b "That's right, " continues !>. "Dressed all up in that metallic armour from eye to toe! And he went gallumphing out into that there forest--"\b "And probably got himself stuck out in that there foliage wearing a ridiculous outfit like that. " interjects !>F. \b "And he came back the next mornin' pale as cream milk and naked as a baby. Said a dragon came and stole all his clothes! " exclaims !>. \^!>Fd snorts in derision. "A dragon here that we've never seen. Probably hiding up in a tree all this time. And he steals people's clothes to boot! "\b You step off the wooden bench and wander over to the two old men. \b "So there is no dragon around here?" you ask them casually. \b "The only dragon I ever seen is the one on the sign hanging outside!" says !>F. NX>" {NYoYou roost atop a rough wooden bench, watching the peaceful scene of the tavern playing out before your eyes. JKMO actorN [MO actorN0 \d You knock on the wooden bench for luck. Not that someone such as you is ever in the need for it. MLONLNPLQNRLSNLMO actorN ^N* MO actorN `>" mN cYou circle around the room, flapping past the old men, the maiden sitting in shadows, and the beckoning opening to the outer world. And then suddenly you dive down in a sneak attack, scratching and clawing and pecking at the offending bench. \b \^!>X gives his own crow of amusement. "The bird's gone and mistaken the bench for the cat!N d>"" ZN eKThings have taken far too interesting a turn for distractions right now. ,N g>7" E >" N pqYou easily pick up the wooden bench in both hands and send it hurtling through the tavern. It skids and screeches across the floorboards, knocking down chairs and other benches in its path and shoving tables out of its way. \b Every pair of eyes turns to look at you in shock. Even the drunkard props up his head and looks about absentmindedly. \b "That be enough of your shenanigans for today!" the tavern keeper declares and begins dragging you out by the ear. Or she tries, but you are far too quick to submit to a humiliation like that. \b For a moment you ponder bringing down a swarm of bees, or slavering dogs, or even simply setting the tavern keeper's hair on fire for her impudence. You finally decide not to risk destroying your disguise for generations to come with such a display, and so with quiet dignity you bid farewell to the tavern and walk out on your own. \b"8>}N s>6" E >" N x~You easily pick up the wooden bench in both hands and send it hurtling through the tavern. It skids and screeches across the floorboards, knocking down chairs and other benches in its path and shoving tables out of its way. \b Every pair of eyes turns to look at you in shock. Even the drunkard props up his head and looks about absentmindedly. \b "Now what be the problem?" says !>. \b "7N You easily pick up the wooden bench in both hands and send it hurtling through the tavern. It skids and screeches across the floorboards, knocking down chairs and other benches in its path and shoving tables out of its way. \b Every pair of eyes turns to look at you in shock. Even the drunkard props up his head and looks about absentmindedly. \b "Have you gone mad?" the tavern maid stares at you. \b "6TMO actorNMUMO actorNq>" uNqfYou peck at the wooden benches, pulling and yanking at at the splinters that lay within your reach. Nq)UVMO actorNWMO actorNC>" !NCYou idly scratch at the wooden bench and end up jabbing a ragged splinter up under your fingernail. You glare at the offending slender pick of wood and it dissolves away without a sound. You give a sniff and turn your head away as the flesh on your hand immediately heals.NCAs the tavern maid turns her back, you claw frantically at the wooden bench surface, relishing the scads of splinters that your talons dig up. \\\.4  tavern chairsMN~!> OOO.  wallsMN!!!P   .  walls The walls are made of fitted wood, sanded down to a proximity of smoothness that the floor obtained naturally over the years. One wall is taken up nearly entirely by the the tavern's hearth, and another lies behind shelves where the counter lays. The longest wall is decorated with simple paintings and the front wall is inset with windows and door. Pairs of unlit lanterns adorn each wall save for the one that holds the greatest lantern in the room, the hearth.MO actorNMO actorN)Still a bit rough and splintery after all these years. Although there'd not be much rubbing up against the walls to wear it down in the first place. -MO actorNYou drink in a deep breath of warm tavern air. It smells of smokey wood, and cooking food with the slightest edge of burning, of old dying flowers, and the musty scent of old men. MO actorNMO actorNd You knock on the wooden walls for luck. Not that someone such as you is ever in the need for it. MLONLNPLQNRLSNLMO actorNN; MO actorN>" KNYou fling yourself at the surrounding walls, squawking, pecking, and scratching up a fury.\b "The balmy bird's gone completely daft!, " !>: exclaims. \b "I think it simply wants to go outside, " !>F_ replies. "Well, the windows are open for it, yet here it still is, " sighs the tavern maid. N >"" ZN KThings have taken far too interesting a turn for distractions right now. _N >7" E >" dN CYou rear back and punch the nearby offending wall with all your might. The entire wall vibrates with the force, yet it does not crack nor splinter. Better made than what you first expected. The other tavern denizens gawk at you as if you were insane. They are more right than they probably realize. \b "That be enough of your shenanigans for today!" the tavern keeper declares and begins dragging you out by the ear. Or she tries, but you are far too quick to submit to a humiliation like that. \b For a moment you ponder bringing down a swarm of bees, or slavering dogs, or even simply setting the tavern keeper's hair on fire for her impudence. You finally decide not to risk destroying your disguise for generations to come with such a display, and so with quiet dignity you bid farewell to the tavern and walk out on your own. \b"8>N >6" E >" bN You rear back and punch the nearby offending wall with all your might. The entire wall vibrates with the force, yet it does not crack nor splinter. Better made than what you first expected. The other tavern denizens gawk at you as if you were insane. They are more right than they probably realize. \b "Why are the pretty ones always so daft?" sighs the tavern maid. \b "They go hand in hand," says !>w with a knowledgeable nod. \b "That must make this old codger the prettiest thing in the whole danged land! " laughs !>F! as he gestures to his friend. N "7_N You rear back and punch the nearby offending wall with all your might. The entire wall vibrates with the force, yet it does not crack nor splinter. Better made than what you first expected. The other tavern denizens gawk at you as if you were insane. They are more right than they probably realize. \b "Why are the pretty ones always so daft?" sighs the tavern maid. \b "They go hand in hand," says !>w with a knowledgeable nod. \b "That must make this old codger the prettiest thing in the whole danged land! " laughs !>F! as he gestures to his friend. N "6TMO actorN! UMO actorN6# >" N6& You flap up to a nearby wall and begin assiduously pecking at it. \b "Lord, the crow thinks its a woodpecker now," exclaims the tavern maid. N6( )UVMO actorN) WMO actorN2+ >" eN2, VYou idly scratch at the wooden walls and nearly get a splinter for your efforts. \b JN2. >You life a taloned claw and scratch delicately at the wall. "rrr.  shadows in the tavern,  the shadowsMN!##.  shadows in the tavern,  the shadows The bright sunlight pouring in through open doors and windows leaves a dim greyness pooled beneath chairs, benches, and tables and puddled around the edges of the room. MO actorN [MO actorN& <How to catch a shadow...a famous riddle around the lands. -kMO actorN LThe shadows smell of the tavern, or perhaps the tavern smells of shadows. LMO actorN NlMO actorN MYou are far more comfortable taking refuge in shadows than attacking them. MO actorN 6MO actorN ;You stand within the shadows of the tavern and open your !> beak mouthg mouth, letting the darkness fill it. However, these are normal shadows who taste of nothing at all. 6LNPLQNRLSN$fff.   sunshine, the sunshineMN!%%l***.   sunshine, the sunshine xxThe day outside is gloriously clear and bright overspilling into the tavern and filling the room with a golden light. MO actorN MO actorN You raise your !> wings hands4 to the light, basking in the warmth if provides. N >" XN LYou feel the presence of not a few eyes admiring the profile you provide. -fMO actorN GThe light smells of warmth, of summer, of sweet hay and ripe apples. LMO actorNJ NNMO actorNn /A hopeless cause, trying to fight the light. MO actorN 6MO actorN ;You stand within the shadows of the tavern and open your !> beak mouth mouth, letting the sunlight fill it. However, while pleasantly warm, these sunrays are merely normal and taste of nothing at all. 6LNPLQNRLSN&hhh.   paintings, the paintingsMN!''.   paintings, the paintings Three simple paintings hang evenly spaced apart upon the tavern's longest wall. They are all drawn in black and white inside plain unadorned wooden frames. A tree to the left, a dragon to the right, and a man in the middle. MO actorN/ MO actorNS bThe parchment is rough, not of the highest quality at all, and yellowing slightly at the edges. -JMO actorN +The paintings smell of must and old ink. LMO actorN* NMO actorNN vSimple as they are, you rather like the paintings and they don't look like they could withstand any sort of attack. LNPLQNRLSNMO actorN 2MO actorN= >" wN= hYou grasp the painting frames within your talons but they are too heavily wedged to the wall to move. N= You carefully tilt the painting's frame away from the wall. And hidden beneath it is... a square of lighter tinted wall.\b \^!>c gives a hoot of laughter. "Lookin' for gold?" he asks. "Then you be lookin' in the wrong place!"(\\\.  painting of a treeMN!)).  painting of a tree A simple painting of a strangely flowering tree, little more than black squiggles really. If you squint and hold your head at such and such an angle that blob along one of the branches might be a bird. MO actorN  MO actorN1 bThe parchment is rough, not of the highest quality at all, and yellowing slightly at the edges. -JMO actorN +The paintings smell of must and old ink. LMO actorN NMO actorN, vSimple as they are, you rather like the paintings and they don't look like they could withstand any sort of attack. LNPLQNRLSNMO actorN 2MO actorN >" wN hYou grasp the painting frames within your talons but they are too heavily wedged to the wall to move. N You carefully tilt the painting's frame away from the wall. And hidden beneath it is... a square of lighter tinted wall.\b \^!>c gives a hoot of laughter. "Lookin' for gold?" he asks. "Then you be lookin' in the wrong place!"*\\\.  painting of a treeMN!++.  painting of a dragon A crude painting of a round little potbellied dragon with itty bitty wings that probably would have trouble lifting a bird into the air. It looks to be the archetype for the tavern sign hanging outside.MO actorN MO actorN3 bThe parchment is rough, not of the highest quality at all, and yellowing slightly at the edges. -JMO actorN +The paintings smell of must and old ink. LMO actorN  NMO actorN. vSimple as they are, you rather like the paintings and they don't look like they could withstand any sort of attack. LNPLQNRLSNMO actorN 2MO actorN >" wN hYou grasp the painting frames within your talons but they are too heavily wedged to the wall to move. N You carefully tilt the painting's frame away from the wall. And hidden beneath it is... a square of lighter tinted wall.\b \^!>c gives a hoot of laughter. "Lookin' for gold?" he asks. "Then you be lookin' in the wrong place!",\\\.  painting of a treeMN!--.  painting of a man A black and white painting of a wavy haired young man dressed in a flowing cloak. It's not a very good likeness, otherwise you would never have allowed it to hang on the wall like this.MO actorN MO actorN bThe parchment is rough, not of the highest quality at all, and yellowing slightly at the edges. -JMO actorN +The paintings smell of must and old ink. LMO actorN NMO actorN vSimple as they are, you rather like the paintings and they don't look like they could withstand any sort of attack. LNPLQNRLSNMO actorN 2MO actorN  >" wN  hYou grasp the painting frames within your talons but they are too heavily wedged to the wall to move. N  You carefully tilt the painting's frame away from the wall. And hidden beneath it is... a square of lighter tinted wall.\b \^!>c gives a hoot of laughter. "Lookin' for gold?" he asks. "Then you be lookin' in the wrong place!".RRR.   cauldronMN!//x555.   cauldron }}A large lidded black cauldron hangs inside the hearth, curls of white smoke drifting up from its belly every now and then. LO actorN [NO actorN NYou reach out and scald yourself upon the steaming hot sides of the cauldronN >" N The tavern maid clucks at you and bustles back into the kitchen. She returns shortly with a cool cloth for your hand. You graciously accept the offering, even though you skin has already healed. b&-MO actorN9! sYou sniff the steam rising from the pot. It smells of cooked meat, perhaps a bit burned, and scalded vegetables. LNPLQNRLSNL=N LN[L\NMO actorN1# 6MO actorNU% >" GNU& 8The lid of the cauldron is too heavy for you to lift. UNU*  You carefully lift up the cauldron's heavy lid and inhale the scent of the stew inside. A ladle rests within, which you use to sip at the broth. It tastes of overcooked meat, soft potatos, and some unidentifiable vegetables. \b "I'd be careful of that there stew," !>1 warns. "Its been sitting there for days now. "u4xMO actorN,, MO actorNP. >" GNP/ 8The lid of the cauldron is too heavy for you to lift. fNP1 ZYou carefully lift up the cauldron's heavy lid and inhale the scent of the stew inside. 60QQQ.   bottlesMN!11\.   bottlesMNV ICorked bottles line the shelves, most of them clear and easily displaying the liquids inside, but some green and blue ones, as well as the odd red, are mixed in as well. Some of the bottles sport peeling parchment labeling them 'rye whiskey' or 'brandywine', but you suspect all of them contain a liquor of some form or other. NW c @ ENX 9Half hidden behind the bottles is a small rounded tin. MO actorNY 4MO actorNZ You gaze through the distortion of the glass to the liquids within the bottles. Golden yellow, clear, many in different shades of red, darker brown, and even an odd blue one simply labeled 'blueberry'.+34_`4,MO actorN\ -MO actorNC] zYou sniff at the bottles. There's the faint bite of alcohol in the air but most of the scent remains bottled up within. MO actorN_ MO actorN&a cThe bottles are mostly cool and smooth to the touch, with a few flawed dimples within the glass. MO actorNb &MO actorNd >" pNk  You have a cork within your beak and, with much flapping of your wings, you have nearly opened the bottle when the tavern maid notices you. \b "Away from there, you bird!" she calls at you and swats you with a broom. \b You draw back again, giving her a good peck in your passing. \b \^!>4 laughs. "The bird knows where the good stuff is!"Nm As you reach out towards the bottles, the tavern maid calls out to you. "If you want anything, just ask me to serve you," she says.62^^^.  kegs,  the kegsMN!33.  kegs,  the kegs wwRound wooden kegs, looking like nothing so much as little miniature barrel, each one tapped with small black spigot.MO actorNw 4iMO actorNx JYou can not see through the solid wood of the kegs to the liquid inside.+34_`4,MO actorNmz -MO actorN{ wYou sniff at the kegs. There's the faint bite of alcohol in the air but most of the scent remains bottled up within. MO actorNM} ]MO actorNq >The slats of the wooden kegs are a bit ragged to the touch. MO actorN MO actorN >" N You clutch at the tap poking out of a nearby keg and are just at the point of turning it when the tavern maid notices what you are doing and shoos you away.\b \^!>0 laughs. "The bird just wants a bit o' a nip!"N As you reach out towards the kegs, the tavern maid calls out to you. "If you want anything, just ask me to serve you," she says.64PPP.  hearthMN!55.  hearth The hearth is made of uneven gray stone and takes up nearly the entire side wall of the tavern. A low fire burns bright gold atop thick chunks of wood in its mouth. Hanging from an iron pole within is a large black cauldron, wisping steams of smoke rising from it every now and then. MO actorNS 4MO actorNw `Within the hearth hangs a large black cauldron that any witch would be proud to call her own. YMO actorN ZEMO actorN  &Alas, someone has beaten you to it. 14+34,MO actorN -tMO actorN UThe hearth smells of burning wood and coal, of flames and smoke, and cooking meat. MO actorNI MO actorNm oThe stone of the outer hearth is warm to your touch. You decide not to burn yourself by reaching further in. MO actorN MO actorN% That would fry you to a crisp. Or that's what the others would expect and it would raise their suspicions to find you prancing amongst the flames, and coal, and wood unharmed and unsinged.JKaMO actorN( bkMO actorNL LThe fire pops and crackles as you toss a few more pieces of wood into it. 6WWW.  upstair stepsMN!77  .  upstair steps The steps upstairs are wooden and blocky, banisterless as the walls rise up quickly on either side, and otherwise completely uninteresting. Their upper half is hidden in shadows.MO actorN |MO actorN ]Wooden. The center of each step is slightly dipped and smoother than either of the sides. JKMO actorN  You drift up the stairs and along a darkened, narrow hallway bordered by empty doorways. The sleeping quarters manage to be both barren and cramped at the same time, thin-walled and tucked up under the eaves with nothing but straw pallets, wooden washing bowls, and chamberpots to occupy them. There's nothing of interest, no one would leave anything of value up here. You return to the tavern below. S ^^You wander down the few narrow wooden steps that lead into the cellar. It's slighter cooler here and smells of dank earth and potatoes. Crates and barrels full of vegetables and bottled liquor are piled up in the shadows. You find the spuds sitting and gossiping around the fire far more entertaining than these, and so return to the tavern above. 8PPP.   counterMN!> 9rrr.  tavern windows, the tavern windowsMN!::.  tavern windows, the tavern windows The tavern windows are simple squares cut into the outer walls, bare of glass or ornament save for its painted outside shutters and the thick black cords used to pull them closed. MO actorN  VMO actorN1 7You pop your head through the window. Nothing there. -[MO actorN <A faint scent of sweet apples drifts through the windows. LMO actorN NMO actorN >" N =You throw a punch at the empty space that is the window. \^!>F^ glances up at you."Shadowboxing, eh?" "Now that remind me o' that shadow prince..." begins !>. \b "Him again?" says !>Fc. \b "Well they say that he could slay a man by jus' giving his shadow a little poke!" exclaims !>L. \b "Then obviously everyone ought to have fought him in the dark!" says !>F. N UYou flutter about the window, scratching and clawing at it. \b "Lookit that!" says !>|. "The bird can't figure out how to fly through the window! " \b "Maybe he thinks there ought to be glass in it?" replies !>F.N MO actorN vMO actorN WThe courtyard can be glimpsed through the window and past that the winding dirt road.42MO actorN MO actorN >" N xYou fly through the window to the courtyard outside. As you pass by you hear the tavern maid mutter "Thank goodness,".>N cAs the other tavern occupants gape at you, you take a running leap and jump out the window. \b \^!>FJ chuckles. "Well, that's one way to escape from your stories," he tells !>. >BCz(MO actorN >>;J  road,  the road YYThe small snatch of road spotted from the window curves round the tavern to the south. <J   courtyard, the courtyard ggA side of the stable and a small stretch of the pebbled courtyard can be seen from this vantage point=VVV.  shutter cordMN!>>  .  shutter cord SSA thick knotted loop of rope acts as the pull cord for each red painted shutter. MO actorN ~MO actorN _The shutter cords are rough and scratchy, with frayed ends of twine along its entire length. -MO actorN6 gA bit musty, a bit moldy... perhaps the windows had been left open in the rain a few times too many.  MO actorN MO actorN FYou pull on the cord and the window slams shut with a low screech.\bN >" N "Please keep those open," the tavern maid calls out to you. \b You give the window shutter a little push and it swings open once again. N >" yN mThe tavern maid sighs in exasperation as she shoos you away and pushes open the window shutter once again. ?QQQ.   shelvesMN!@@$./   shelves 88The shelves are little more than thick wooden boards that have been nailed securely to the walls behind them. The longer shelves contain an assortment of glass bottles in various stages of being drunken mixed in with a few straggly books while the shorter, more widely spaced shelves house tapped wooden kegs. MO actorNp8 wMO actorN: XThe shelves are a bit dusty in the crevasses and holes between the objects it carries.-kMO actorN< LYou drink in a deep breath and cough from the dust you have just inhaled. MO actorN= MO actorN> f You knock on the wooden shelves for luck. Not that someone such as you is ever in the need for it. MLONLNPLQNRLSNLMO actorNq@ NP MO actorNB >" NE With a squawk you sweep down under the shelves and ram headfirst into them. You fall to the floor with a soft 'FLUMPH' where you lay in a dazed pile of flutered black feathers. "Completely balmy!, " the tavern maid sighs.\b; NG >"" ZNH KThings have taken far too interesting a turn for distractions right now.  NJ >7" E >" NQ With a graceful twirl you stretch your arm out to your side and then lash out straight at the upper shelf before you. The bottles clank and clatter against each other as ll the shelves vibrate with the force of your blow. \b And then with a bright red bottle tips over and crashes over your head. It splinters into little bits that falls all around you as the red wine it once contained sloshes all over you. \b "That be enough of your shenanigans for today!" the tavern keeper declares and begins dragging you out by the ear. Or she tries, but you are far too quick to submit to a humiliation like that. \b For a moment you ponder bringing down a swarm of bees, or slavering dogs, or even simply setting the tavern keeper's hair on fire for her impudence. You finally decide not to risk destroying your disguise for generations to come with such a display, and so with quiet dignity you bid farewell to the tavern and walk out on your own. \b"8>NT >6" E >" NY With a graceful twirl you stretch your arm out to your side and then lash out straight at the upper shelf before you. The bottles clank and clatter against each other as ll the shelves vibrate with the force of your blow. \b And then with a bright red bottle tips over and crashes over your head. It splinters into little bits that falls all around you as the red wine it once contained sloshes all over you. The tavern maid gives a cluck as she ushers you away from the shelves. \b "If you want a drink call me to serve you," she says as she bustles about sweeping the glass shards off your head and shoulders and the floor. "The missus will be tossing you out on your rear if you break anything else." "7`XN` With a graceful twirl you stretch your arm out to your side and then lash out straight at the upper shelf before you. The bottles clank and clatter against each other as ll the shelves vibrate with the force of your blow. \b And then with a bright red bottle tips over and crashes over your head. It splinters into little bits that falls all around you as the red wine it once contained sloshes all over you. The tavern maid gives a cluck as she ushers you away from the shelves. \b "If you want a drink call me to serve you," she says as she bustles about sweeping the glass shards off your head and shoulders and the floor. "The missus will be tossing you out on your rear if you break anything else. "6>`XTMO actorNe UMO actorNg >" Nj You flap up to a nearby wall and begin assiduously pecking at it. \b "Lord, the crow thinks its a woodpecker now," exclaims the tavern maid. Nl )UVMO actorNm WMO actorN o >" eN p VYou idly scratch at the wooden walls and nearly get a splinter for your efforts. \b JN r >You life a taloned claw and scratch delicately at the wall. Addd.   rafters,  the raftersMN!BB@.   rafters,  the rafters ''The ceiling, twice again as tall as you, is supported by a crisscrossing of wooden rafters that lie half in shadow. A faint haze seems to hang around what can be seen of the rafters, perhaps from a draft of the hearth, or the kitchen, or from the pipes that the old men smoke before the fire. MO actorNp MO actorN >" >N /That's a bit beyond your reach in this form. N! You fly up to the rafters and settle down in a good perch. The rafters are covered in fine wood dust and smell faintly of smoke.,-JKTMO actorN# UMO actorN% >" >N& /That's a bit beyond your reach in this form. HN* <You flutter up to the wooden ceiling rafters and begin pecking at them furiously. The tavern keeper hears the noise even above the sounds of pots and pans clanging and wanders out to see what's happening. She puts fists on hips as she glares up at you. \b "Now the bloody bird thinks he's a woodpecker!" she says. LTNUPTQUMTOUVTWUCaaa.  doorway to the sculleryMN!DDd$$$.  doorway to the scullery A warm golden light illuminates the open doorway into the scullery. From here you can see several tables piled with food, bowls, and utensils, along with the edge of another smaller hearth that has many silvery pots dangling within it.MO actorN3 4(MO actorNW !<+344,MO actorN -MO actorN eThe scullery has the mouth watering smell of cooking vegetables and crisping meat wafting from it. .MO actorNS gThe sounds of clashing cutlery, banging bowls, and pinging pots and pans emanates from the scullery. cMO actorN MO actorN MO actorN' >" VN' GYou flap into the kitchen, circling round and round the tables and shelves full of washbowls and cutlery and various foods in various states of preparation. The tavern keeper gives a shriek of outrage and immediately begins chasing you, heavy iron pan and long butcher knife in hand. \b One of her swings with the butcher knife gets too close for comfort and you decide that the front room of the tavern might be a more comfortable place to explore. The tavern keeper chases you out of the door... \b "You come back in and we'll be having crow stew tonight!" she shouts after you. N' sYou wander into the depths of the warm, smokey scullery. Or you would if the lumbering form of the tavern keeper hadn't loomed within the doorway, blocking your passage. \b "May I help you?" the tavern keeper as she eyes you up and down. Usually when someone does that when you're in your human form, they are admiring you... but for this woman... \b "I... was wondering where I would go find the food?" you ask innocently. \b The tavern keeper simply sniffs. "Just ask the maid about food, " she tells you. "That's what I pay her for. And don't go trying to serve yourself either." and she withdraws back into the scullery. EH.   cage latch, the cage latch kkA simple latch formed by cross-sections of wood and reed. It would be easy to pull open and close again. -,zyFIHaHaH !MMNT<!" NT Old ManNTthe other old manOMNT<!" NT the Old ManNTanother old man,OMNT<!" NT the Old ManNTanother old man QMNT<!" NT the Old ManNTthe other old manM h i 5476 An elderly gentleman with gray hair that has not quite lost its darkness and a neatly trimmed beard. His skin is sun darkened and wrinkled yet the high color of health still blooms within his cheeks.MO actorNTMO actorNT>" NTYou flap up to !>F/ and land neatly upon his forearm. Then amongst much cooing and fluttering of feathers you wrap your wings around him in a birdly embrace. \b "I have no inkling if this bird has himself confused with some strange hunting falcon or if he thinks he's a snake and is trying to squeeze me to death," says !>Fk as he holds his arm as far away from his body as possible.\b "I reckon its simply fallen in love!" says !> with a cackle. NT>" NTYou wander up to !>F and wrap your arms around him. He stiffens a bit and looks up in some surprise at you. \b "Either your starved for affection or you have damnably strange tastes." he says as he pats your arm. NT> > 2NT&\b"And now I'm jealous," teases Val.NT> > E> > :NT"O' which one?" asks !> slyly. MO actorNoTMO actorNU>  rNUfLobbing random people around the place might raise a few suspicions about your presence. Just a few.MO actorN4U4zMO actorNXU<With your minds eye you peer into the contents carried by !<... !.MO actorNUMO actorNU>" kNU)With a loud "KRAWK!" you flutter up to !>F and perch upon his raised forearm shoulder. He holds you up to the light and stares at you.\b "Now I've been hawking a time or three," says !>F "Yet this is the strangest hunting bird I've ever seen."\b "Mayhaps even a bird would like t' change its feathers, sometimes," says !>F. "Reminds me o' the story of the firebird..."\b "Oh lords," groans !>F. "Not that one again! Here, sic him!" says the old man as he points you towards his friend.\b "No appreciation for a fine story," says!> with a sniff. NUzYou amble aimlessly around the room and on your third circle past the hearth you halt and plop yourself right down atop !>FL's lap.\b "What in the nine hells..?!" says the slightly muffled voice of !>F/.\b "Now he's gone and made a mistake," says !>. "Why don't y' come and sit over here?" he says and indicates his own lap.\b "Not neither of us is your grandpappy," !>Fj tells you as you stand up again. "And you are rather too old to be dandled on someone's knee as it is!"NUNMO actorN U>" E >  N UWith a cackling croak you sweep into the air, criss crossing the room as you carefully build up speed, faster and faster until you suddenly swoop down and attack, pecking and scratching at !>F. \b There is sudden pandemonium in the tavern as the tavern maid screams, the two old men leap shouting to their feet batting wildly at you and overturning benches and tables in their wake, and !>' dives into her travel satchel to pull out a SOMETHING. "The demon bird is attacking! " the tavern keeper comes lumbering into the room, her handy scullery skillet in hand. \b You merrily lead everyone in a chase round and round the room, stopping every now and then to divebomb your prey. \^!>  runs face first into a wall, several pots and plates are thrown, some of them even hitting (others, ofcourse, never you), and everything is in shambles, all except for the lone table where the drunkard still slumbers peacefully. \b "DEMON!" the tavern keeper shrieks as you are finally chased out of the tavern window. With a BOOM of finality the shutters are slammed closed behind you. \b You wing your way back to perch on the window ledge and carefully preen your feathers. Looks like you might have to avoid the tavern for a little bit. N U"i>N U>  rN !UfIn front of everyone? That's not quite the reputation you were hoping to build for your human form. JMO actorN$UI MO actorN&U>" N'UH"KRAK KAK KAK COA!" you screech at the top of your avian lungs within !>FL's ear. \b "The bird is saying he wants to be part of the meat pie!" says !>F as he makes a grab at you. N(U>" N)U&You rant on about meddling mages to !>FP as he stares quietly at you. "You aren't alone in your opinion about mages," !>F\ tells you calmly. \But there's little to be done about it and no reason to get so upset. MO actorN,U <MO actorN-UYou agree with !>F\MO actorN).U[?MO actorNM/UYou disagree with !>FMO actorN1UMO actorN3U>" N4U<UN6UYou lean out and give !>F a good poke in the chest. \^!>F* looks at you and pokes you right back. MO actorN}8UMO actorN:U>v" N;UYou flutter up to !>F| and rub your feathered head against him. He is equal parts scratchy and soft with a good deal of fluff mixed in as well. N" N=UYou boldy walk up to !>F^ and begin running your hands over him. He cloak and vest are scratchy and rough, but his overtunic is soft enough, and his bare skin is rather nubbly... and then he is slapping your hands away.\b "If you are looking for treasure," he says. "Then you are looking in the wrong place!"\b "Mayhaps he simply wanted to get a good grope in y--off" says !>) as his friend elbows him in the side. N?UMO actorNXAUMO actorN|CU>" NN|DU/\^Your great beaky grin goes by unnoticed by !>F nN|EU>" ZN|FUYou smile enigmatically at !>F$, who waves slightly back at you. uMO actorNcHUU#MO actorNJU>" NKUYou flutter atop !>F's knee and begin to peck and scratch enthusiastically at his leg. "There's nothing to be found for you there, balmy bird," says !>F as he he bats at you. 'NLU>" NMU<[MO actorNOU\<MO actorNQU>" NRUYou flap over to !>F< and give him a good pinch in the rear with your claws. \^!>FB lets loose with a roar and tries to bludgeon you with his cane.UNTUYou wander past !>F7 and surrepticiously reach out and pinch her rump. \^!>Fa looks up at you in surprise. "You are a strange, strange man," he tells you. \b "Aye," agrees !>W "Pinching your rump when he could be pinching mine!"\b "And you are even stranger!" !>F turns to his friend.NVUMO actorNXUBMO actorN:YU#That thought is rather confusing./MO actorN[U.MO actorN\U&You hear the great deep breathes of !>Fr, the whuffle as he sucks upon his pipe, and a soft crinkling of clothes as he shifts position before the fire. ,MO actorNp^U-MO actorN_UaHe smells of pipe smoke, of cured meat and roasted potatoes, and faintly of some spicy perfume.MO actorN aU[MO actorN> cU>" N> dUYou flutter over to !>F, fluff your feathers, and proceed to coo up a storm as you pepper his face and neck with soft pecks. \b "What the...?" says !>F in exasperation as he tries to pry you off. \b "Tryin' to get a little taste o' y' to see if your worth eatin' up later," says !>B.\b "Well, that explains why it's with me and not you," retorts !>F<. "Cause not no one can be eating at your old tough hide!"N> gU>" GN> hUStealthily you stalk your prey, skulking in shadows, patiently waiting for the perfect, the perfect opportunity to pounce and... you see your opening! You swoop down upon the oblivious man and brush your lips against his as !>/ gapes over at you. \b "You're very pretty," !>Fm tells you when you finally pull away. "If only you were a girl," he says and sighs somewhat wistfully, as !> and !> still gape at you silently.\b "Why do the pretty ones always have such odd tastes?" the tavern maid complains as she bustles past.N> jUMO actorN$lU0MO actorN$mUMaybe later... @MO actorN$oUMO actorN%qU>" N%rUYou stride up to !>Fk and begin tugging on his vest and shirt. "May I help you?" he snaps at you as he slaps your hands away. N%sU>" N%tUYou land atop !>Fg and begin pecking and clawing at his clothes. "The bird wants y' to take your clothes off!" cackles !>1. "Then the bird is as balmly as you," replies !>F as he tosses you away.wMO actorN&xUMO actorN 'zU>  E >" )N '{UYou !> perchsit] in stillness, eyes demurely cast down, not a single twitch of a muscle nor a flutter of a !> feather cloakS to bring a bit of attention to you. And yet you sense the intensity of the gaze !>F turns upon you. >N '|U>  (N '}UYou !> perch stand] in stillness, eyes demurely cast down, not a single twitch of a muscle nor a flutter of a !> feather cloakS to bring a bit of attention to you. And yet you sense the intensity of the gaze !>F turns upon you. xMO actorN)UAMO actorN)U>" N)U""KAK KAK KRAK COA!" you sing to !>FO. "Can't rightly say that I'm impressed with the new songbird," he comments. N)UYou !<@ to !>FV. "Well," the old man finally says, "You're not a bard, we know that much at least!"sing a little ditty lilt out a love songcroon a soft lullabye chant an ancient lament !warble out a high pitched tune %sing about a bird in a gilded cage yMO actorN+UMO actorN+U>" .N+UYou flutter atop !>FU's gray head and begin to fuss and claw with the neatly trimmed strands of hair. \^!> bursts into laughter as his friend tries to pull you off without ripping his hair out of his head.\b "Mistaken your head for its nest!" he howls in mirth. uN+U>" aN+U8Before he realizes what is happening you slide behind !>Fo, run your fingers through his hair, and with a few deft twists have plaited a neat little braid into it. \^ !>F holds your handiwork before his eyes and gazes at it critically. "Never been much of a one for braids," he says apologetically as he unravels it. zMO actorN.U^MO actorN.U>" RN.UYou flutter your wings as !>F watches you carefully. MN.UYou wave slightly at !>F, who nods and waves back. {MO actorN/U'MO actorN/U>" ^N/Uk"You are the cuddliest wuddliest oogie foggy little wittly man I've ever seen!" you croon at the started !>FX. "The cutie patootiest..."\b "Good gods, I think the fey drove him insane!" exclaims !>Fc. \b "He must be insane to be sayin' those thing to you when I'm sittin' right next to y'!" says !>. N/U>" N/U)"kak kak krak coa coa coa!" you coo at !>F..\b "The ol' crow has found his true love!" !> laughs. N/U+34JKBLCNLNJI6P[Q\[\}[~\R[S\bMOwordlstN2UKMN2UN2UN2UN2UN2Ua"I've never seen the ocean myself. The closest one is many leagues upon leagues far from here. "N2UN2UN2U\b"Bird made of fire. You'd be better off asking the Old Coot over there about these things. He's the storyteller of fantastical tales and magical creatures. ""N2UN2UN2U0\b"Half lion and half eagle... or was it hawk?"N2UN2UN2UN2U2"That? That's what comes of too many idle days.""N2UN2UN2U6\b"Lords, that's one of his favorite stories!" says !>FB as he points to his friend. "All sound and fury about nothing.""N2UN2U\\b"Southern city of the mages. Or was it western? A long distance from hereabouts anyway. "N2UN2UN2U5\b"Might be a bit early in the season for roses. " !>F mumbles to himself. N2U"N2UN2UN2UV\b"I used to grow lilies in my garden. Far too much effort for such fragile plants."N2U"N2UN2UN2UH\b"She just arrived this morning. Beyond that, I can't say very much.""N2UN2UN2UN2Uo\b"You know about as much about them as I. Humans with great powers taken from the fey. It can't bode well if they've started to come here. I have no great love of the fey, but we've lived in harmony, more or less, with them for all these years. If they were gone... what would happen?" And he has no way of knowing just how closely he has been living with the fey."N2UN2U\b"Don't be swayed but such foolishness. There's no such thing as a werewolf... or at least a man who can turn into a wolf. Even the mages have yet to master shape shifting."\b"N2UN2UN2UN2UcFor a moment you are suddenly overtaken by the urge to blurt forth your true name. Utter madness!"N2UN2UN2UN2U>"" .N2U"As daft as the rest of you!"vN2Uj"And so he is a mage, is he? Well and truly? I don't know... I just don't know what this means for us. ""N2UN2UN2UN2UN2UN2V "Men and woman, although I suppose you could call the women hedge witches, knowledgeable in crafts of herbs and healing. With a dollop of magic mixed in as well, but mostly common sense. Now that is what we need round here, no mages on parade but a good hedge wizard."N2VN2VN2V."I'd keep my lips to myself if I were you." !> grins cheekily. "N2VN2VN2Vg"Aye, I was married too once upon a time. Buried her seven years ago come next fall, bless her soul.""N2 VN2 VN2 V"Oh yes, we're supposed to have dragons 'round here as well. Yet somehow only drunk farmers and merchants ever see the thing." !>F chortles."N2VN2VN2VN2VN2VN2VN2V3"I think you'd know more about yourself than me.""N2VN2VN2VN2VN2Vm"Ah yes, we haven't been properly introduced, have we? I am--"\b "Dont be throwin' your name around here!" !> hushes the other man. \b "Oh for god's sake, not that 'names have power' nonsense again!"\b "They do have power and there be a bloody fey on the prowl here!"\b "If the bloody fey doesn't know my name already after all this years... fine, fine..." !>F= turns back to you. "You can simply call me Old Man, then.""F!"N2VN2V,"A horse with a horn on its head..." says !>F. "Blasphemy!" cries !>."N2 VN2!VN2"VN2#V"I suppose you can tell what kind of place our village is that this is the center of the entertainment. And it's been quite a busy day today!""N2%VN2&Vi"It seems to me that the fey don't bother you if you don't bother them, and that sit just fine with me."N2(VN2)VN2*VN2+VN2,VN2-V\"That bird, or something like it, has been pestering this tavern ever since I can remember"N20VN21VN22VThat sounds far more like !> specialty than mine. "N25VN26VN27V"I grew up with him in the nearby village. Was old enough to babysit him a time or two. And I have no bloody clue where he picked up that crazy accent! I swear it gets worse with each passing year! It must be crazy old man speech...""N2:VN2;VN2 tavern maid7keepertavernkeepertavern keeperN2CV!c **"There's not much I can say about that."G&&]&]&  tavern keeper ..The tavern keeper wide as a door and stout as a tree, with stone gray hair pulled tightly back into a bun. A thickly lined face scowling face that any gargoyle would have been proud to claim. As many years as you have been haunting the tavern, you still have no conception what her true name may be. M h i 5476MO actorNYyMO actorNY>" ~NYoYou flutter up to the tavern keeper who flails away at you with her heavy metal ladle. No snuggling for todayNY>" NYStealthily you sneak up behind the tavern keeper... who then whirls upon you with a frying skillet in hand. "Oh, tis not the outhouse!" you exclaim as you back out of the scullery.MO actorNEYMO actorNiY>  rNiYfLobbing random people around the place might raise a few suspicions about your presence. Just a few.MO actorN Y4zMO actorN.Y<With your minds eye you peer into the contents carried by !<... !.MO actorNYMO actorNY>" NYWith a loud "KRAWK!" you flutter up to the tavern keeper who begins to take wild swings at you with the bearny cheese grater. You decide to find safer places to roost.+NYYou are not that masochistic.NMO actorNY>" E >  "NYWith a cackling croak you sweep into the air, criss crossing the room as you carefully build up speed, faster and faster until you suddenly swoop down into the scullery, pecking and scratching at the tavern keeper.\b "The demon bird is attacking! " the tavern keeper comes lumbering out of the scullery, her handy scullery skillet in hand. \b There is sudden pandemonium in the tavern as the maid screams, the two old men leap shouting to their feet batting wildly at you and overturning benches and tables in their wake, and !> dives into her travel satchel to pull out a SOMETHING. You merrily lead everyone in a chase round and round the room, stopping every now and then to divebomb your prey. \^!>  runs face first into a wall, several pots and plates are thrown, some of them even hitting (others, ofcourse, never you), and everything is in shambles, all except for the lone table where the drunkard still slumbers peacefully. \b "DEMON!" the tavern keeper shrieks as you are finally chased out of the tavern window. With a BOOM of finality the shutters are slammed closed behind you. \b You wing your way back to perch on the window ledge and carefully preen your feathers. Looks like you might have to avoid the tavern for a little bit. NY"i>NY>  zNYnYou fear for your life at the thought of attacking the tavern keeper in human form without using for power. JMO actorN YIMO actorN Y>" N Y"KRAK KAK KAK COA!" you screech at the top of your avian lungs into the ear of the tavern keeper. She proceeds to chase you out into the front room while waving a carving knife. "Fresh blackbird pie!" is her battlecry.wN Y>" cN YWYou take one look at the tavern keeper scowling darkly at you and decide against it. MO actorN{ Y BMO actorN Y#You agree with the tavern keeper.\MO actorN Y[EMO actorN Y&You disagree with the tavern keeper.MO actorNVYMO actorNzY>" NzY<UNzYYou reach over and give the tavern keeper a good poke. You jerk back in time to avoid the meat fork aimed at you hand. "Hold them or lose them," the tavern keeper threatens. uMO actorNwYU MO actorNY>" NYQuickly you dart out of the air, swooping down and landing a few pecks upon the tavern keeper's thick shoulders and arms before she chases you out with a breadroller in hand. 'NY>" NY<MO actorNYMO actorNY>v" }NYnYou flutter over to the tavern keeper but are kept at bay by her wild swings with the large frying skillet. NY>" NYYou stealthily approach the tavern keeper with her back turned to you, stealthily you lurk, stealthily you stalk, stealthily you whistle and walk the other way as the tavern keeper glares at you and shakes her frying skillet back and forth. MO actorNYMO actorNY>" SNYD\^Your grin beakily at the tavern keeper who scowls back at you.. kNY>" WNYKYou smile enigmatically at the tavern maid who scowls darkly back at you.[MO actorNY\OMO actorNY0Maybe when you're in a more masochistic mood. MO actorNYZMO actorN6Y;Love is confusing... but you aren't that confused./MO actorNY.MO actorNYWaiting outside the scullery, you hear the thunk of the tavern keeper's knige biting into the cleaning board, the sizzle of the food she is making, and the tread of her heavy footsteps as she comes to the doorway to glare at you. ,MO actorNY-MO actorNYShe probably smells of the scullery, of basting meat and roasting potatoes of vegetables cooked and fruits cleanly sliced. You are not about to get close enough to verify this however. MO actorNY]MO actorNY>Maybe when you are in a more masochistic, and insane, mood. MO actorNRYDMO actorNvY%You are not that masochistic. Ever.@MO actorNYDMO actorNY%You are not that masochistic. Ever.wMO actorN.YPMO actorNRY1Maybe when you are in a more masochistic mood. xMO actorNY"MO actorNY>" NY"KAK KAK KRAK COA!" you sing to the tavern keeper. Who's knife thunks sharply into her vegetables as she stares back at you. oNYYou !<@H to the tavern keeper as she drags you out of the scullery by an ear. sing a little ditty lilt out a love songcroon a soft lullabye chant an ancient lament !warble out a high pitched tune %sing about a bird in a gilded cage yMO actorNZPMO actorN Z1Maybe when you are in a more masochistic mood. zMO actorN  Z^MO actorNDZ>" `NDZQYou flutter your wings at the tavern keeper who waves her skillet back at you. lNDZ>" XNDZLYou gaily wave at the tavern keeper who humphs and turns her back to you. {MO actorN;ZMO actorN_Z>" PN_ZA"You are the prettiest wittiest--" no, you simply can't do it. uN_Zi"kak kak krak coa coa coa!" you coo at the tavern keeper as she tries to hit you with her cooking pot. +34JKBLCNLNJI6P[Q\[\}[~\R[S\bMOwordlstNO(ZKNO*ZNO+ZNO,ZNO-ZNO.ZNO/ZNO0ZNO1ZNO2ZNO3ZNO4ZNO5ZNO6ZNO7ZNO8ZNO9ZNO:ZNO;ZNOZNO?ZNO@ZNOAZ>" E >H" KNOBZ?"If it be food that you be wanting, just talk to the maid."\b"NODZNOEZNOFZNOGZ;"Now you just leave him be to whatever peace he may find."NOIZNOJZNOKZNOLZcFor a moment you are suddenly overtaken by the urge to blurt forth your true name. Utter madness!"NONZNOOZNOPZNOQZ>"" NORZy"As long as he pays, I don't care if he is the ruddy prince of the seven kingdoms or the bloody king of the nine hells!"NOUZNOVZNOWZNOXZNOYZNOZZNO[Zd"You are the pest hovering in the doorway holding up the preparation of the midmorning breakfast.""NO^ZNO_ZNO`ZNOaZA"Tis exactly what it appears to be... a tavern and a wayhouse.""NOcZNOdZd"The fey?\ As long as they don't come in here and make trouble they can do whatever pleases them.""NOfZNOgZNOhZNOiZNOjZNOkZ5"I've been craving fresh blackbird pie for awhile.""NOmZNOnZNOoZ["If it's food you be wanting, just call her over. Otherwise, don't you be bothering her!""NOqZNOrZNOsZNOtZ$"Me? I'm the Queen of the kingdom!"A4foodWfoodsVdrinkUdrinksSmilkS brandywineM redwineJwineJrumK potatorumFpotatoDciderC applecider=apple<beans;ale<beer<fish< meatpie9pie:stew:order9served7nobdrunk drunkardxyzzy yournamemynameValS strangerOpookieM snugglebumsyou yourselfmemyselfself wayhouseLinnMtavernKfeyraven crow crows ravens  blackbird tavernmaidA tavern maid:keepertavernkeepertavern keeperNOuZ!c 33"\bStop bothering me, and be off with you now... H SRbRbR  Pretty in a plain way, with middling brown hair pulled back beneath her cap and a scattering of freckles across her cheeks and the tip of her nose. M h i   tavern maid5476bkMOwordlstNWKF NWNWNWNWNWNWN WN WN WN WN WNWNWNWNWNWNWNWNWNWNWNWNWNW>" E >H" ?NW0You wave slightly at the tavern maid who comes bustling up to your side. \b "May I serve you?" she asks politely and begins a reel that seems recalled from memory. "Today we have stew, meat pie, and a delicacy-- fresh fish from a pure stream several leagues over. We also have several choices in liquors... brandywine, red wine, potato rum, ale, apple cider... oh and milk, if you don't like any of that."\b The tavern maid lowers her eyes and fiddles with her apron in seeming embarrassment. "Because of some err... difficulties" her eyes stray over to the corner where the drunkard sleeps obliviously, "I'm afraid I shall have to ask for payment ahead of time. Tis err... only a few coppers." she says and blushes.\b "If you decide you want something just slip me the payment and tell me what you'll be wanting."NW>" E >H" NW"Thank you for your pa--patronage," says the tavern maid with a small curtsy. "May I serve you?" she asks politely and begins a reel that seems recalled from memory. "Today we have stew, meat pie, and a delicacy-- fresh fish from a pure stream several leagues over. We also have several choices in liquors... brandywine, red wine, potato rum, ale, apple cider... oh and milk, if you don't like any of that."\bH"N WN!WN"WN#W@"Our best customer," says the tavern maid with great big sigh."N%WN&WN'W&\b"One of our guests for the night.""N)WN*WN+WN,WcFor a moment you are suddenly overtaken by the urge to blurt forth your true name. Utter madness!"N.WN/WN0WN1W>"" 6N2W'"He came in a few moment before you."AN4W5"He was a mage?!" the tavern maid squeaks in alarm."N6WN7WN8WN9WN:WN;W-"Haven't seen one of those in many a year. "N=WN>WN?WDThe tavern maid turns a deep crimson as she gazes at you silently."NAWNBWNCWNDWNEWNFWNGWL"You are you." the tavern maid says distractedly before rushing off again."NIWNJWNKWNLWNMWK"Those two come here most bright, sunny days. Most cold, rainy days too.""NOWNPWNQWNRW"Very busy today!""NTWNUW|"The fey?" the tavern maid gives a jump and looks about her. "I try to avoid the places where people say they congregate.""NWWNXWNYWNZWN[WN\WV"That balmy bird! Its greatest pleasure is making a pest of itself, or so it seems!""N^WN_WN`WNaWNbWNcWt"Me? I am just--" the tavern maid gives a jump and scurries off as the tavern keeper calls out to her once again.""NeWNfWNgWNhWS"The sole owner of this place. Its been nearly two years since I first came here."Dfoodfoodsdrinkdrinksmilk brandywine redwinewinerum potatorumpotatocider appleciderapplebeansalebeerfish meatpiepiesteworderservednobdrunk drunkardmaidenlaynaxyzzyB yourname>myname<Val strangerpookiewizard1hedge-wizard) wizardry%hedge wizardhedgekissW kissingT snugglebumsyou yourselfmemyselfself oldcootcootoldmanman wayhouseGinnHtavernFfeyiravencrowcrowsravens blackbirdnamesMnameMmaidM tavernmaidG tavern maid@keepertavernkeepertavern keeperNiW!c //"\bThe tavern maid bustles past you unheeded.uMO actorNoWUkMO actorNqW>" NrWYou land atop the tavern maid's head, perch easily within her starched white cap, and begin to scratch and peck enthusiastically at her hair. "Demon bird!" she cries out and tries to shoo you off with a broom, only ending up hitting herself in the head for her trouble. 'NsW>" NtW<MO actorNCwW7MO actorNgyW>" jNgzWYou flutter up to the tavern maid, land upon her shoulder, and amongst much cooing and fluffing, you wrap your wings around her neck. \b "Ack! The balmy bird is attacking me!" the tavern maid yells in a panic as she flails away at you. \b "Aww, methinks it like y'!" says !><. "Well I don't bloody like it!" the tavern maid retorts. Ng|W>" Ng}WStealthily you sneak up behind the tavern maid and slip your arms around her. "Oy," she says "You be disrupting my work with these shenanigans!" she protests and snuggles into your embrace before you finally release her.Ng~W> > 2NgW&\b"And now I'm jealous," teases Val.NgW> > E> > :NgW"O' which one?" asks !> slyly. MO actorNWMO actorNW>  rNWfLobbing random people around the place might raise a few suspicions about your presence. Just a few.MO actorNiW4zMO actorNW<With your minds eye you peer into the contents carried by !<... !.MO actorN WMO actorN1W>" N1WWith a loud "KRAWK!" you flutter up to the tavern maid and sit prettily atop her capped head. "I'll put you in the meat pie if you don't stop being a pest!" she threatens you as she shoos you off her head. N1WAlas, there is no opportunity with the tavern maid is bustling all over the place, rushing hither and thither, not accomplishing much, but not accomplishing it in a busied way. dMO actorNWeMOactordobjNW" NW}The tavern maid takes your coin with a slight curtsy. "Just beckon me over once you have decided what you want," she says. ":NW.The tavern maid bustles past you unheeding. NMO actorNW>" E >  NWWith a cackling croak you sweep into the air, criss crossing the room as you carefully build up speed, faster and faster until you suddenly swoop down and attack, pecking and scratching at the tavernmaid. \b There is sudden pandemonium in the tavern as the maid screams, the two old men leap shouting to their feet batting wildly at you and overturning benches and tables in their wake, and !>' dives into her travel satchel to pull out a SOMETHING. "The demon bird is attacking! " the tavern keeper comes lumbering into the room, her handy scullery skillet in hand. \b You merrily lead everyone in a chase round and round the room, stopping every now and then to divebomb your prey. \^!>  runs face first into a wall, several pots and plates are thrown, some of them even hitting (others, ofcourse, never you), and everything is in shambles, all except for the lone table where the drunkard still slumbers peacefully. \b "DEMON!" the tavern keeper shrieks as you are finally chased out of the tavern window. With a BOOM of finality the shutters are slammed closed behind you. \b You wing your way back to perch on the window ledge and carefully preen your feathers. Looks like you might have to avoid the tavern for a little bit. NW"i>NW>  rNWfIn front of everyone? That's not quite the reputation you were hoping to build for your human form. JMO actorNWIMO actorN W>" N W"KRAK KAK KAK COA!" you screech at the top of your avian lungs within the tavern maid's ear. "Tis a demon bird, it is!" she half shouts as she chases after you with a broom.N W>" N WYou rant on about meddling mages to the sympathetic looking tavern maid. "It's quite a confusing, wicked world out there," she tells you. MO actorN!W @MO actorN!W!You agree with the tavern maid.\MO actorN"W[CMO actorN7"W$You disagree with the tavern maid.MO actorN"WMO actorN"W>" N"W<UN"WYou reach over and give the tavern maid a good poke in the chest. She squeals and makes a fluttering motion towards you face as !> gazes on in disapproval. MO actorN#W+MO actorN#W>v" N#WYou flutter over to the tavern maid and rub your body against hers. Her skin is soft but her clothes are quite scratchy and the fingers that swat you off to the floor are callused.AN#W>" -N#W!You slip up behind the tavern maid and run your hands over her body. Her skin is soft but her clothes are quite scratchy and the fingers that swat at your head are callused. The tavern maid yelps and shakes her apron at you.\b "Mind your manners!" she tells you in a half affronted huff.MO actorN%WMO actorN&W>" dN&WU\^Your grin beakily at the tavern maid you gazes back at you with great suspicion. mN&W>" YN&WMYou smile enigmatically at the tavern maid who smiles brightly back at you.[MO actorN'W\MO actorN5'W>" N5'WYou flap over to the tavern maid and give her a good pinch in the rear with your claws. She jumsp nearly a foot in the air then begins chasing you about the room, all the while ranting on about blackbird pie.N5'WYou wander past the tavern maid and surrepticiously reach out and pinch her rump. \^ She gives a little shriek and drops the crockery she had been carrying upon the floor amidst a great clatter. \b The tavern keeper pops her head out of the scullery. "What be going on out there?" she demands. "No one better be bothering my tavern maid," she threatens.\b "Oh, n-nothing," says the tavern maid as she sweeps up the broken pots and plates and gives you a little glare. MO actorN#*WBMO actorNG*W#That thought is rather confusing./MO actorN*W.MO actorN*WYou listen to the shallow breathing of the tavern maid, the sound of her wooden shoes pitter pattering across the floor, and the shasurring of her clothes rubbing together as she bustles about. ,MO actorN+W-MO actorN+WYou wander past the tavern maid and give a surrepticious sniff. She smells of roasted meat and cooked potatoes, of vegetables and faintly underneath, the scent of violets. MO actorN,W`MO actorN,W>" N,WYou flutter over to the tavern maid, fluff your feathers, and proceed to coo up a storm as you pepper her face and neck with soft pecks. \b "Lords," she mutters. "What is wrong with this balmy bird?" she says she she tries to oush you off. N,W>"  N,W;You lurk in the shadows, watching the tavern maid go about her innocent way, patiently waiting, watching, for the opportunity, the moment, and you see your opening and pounce! You swoop up to the oblivious tavern maid and press your lips against hers. She gasps against your lips as you pull her closer.\b "Woo!" !> hoots. "The tavern is heatin' up!"\b The tavern maid's face is suffused with red when you draw back. She straightens her clothing and goes bustling about the room at a pace twice as frenetic as before.N,WMO actorN0W0MO actorNA0WMaybe later... @MO actorNw0WMO actorN0W>" N0WYou stride up to the tavern maid and begin tugging at her apron and dress. "Mind your manners" she tells you as she yanks her clothes away from your graspN0W>" N0WYou land atop the tavern maid's shoulder and begin pecking and clawing at her clothes. "The bird wants y' to take your clothes off!" cackles !>L. "The bird is looking to become part of the blackbird pie." she retorts. wMO actorNy2WMO actorN2W>  E >" *N2WYou !> perchsit] in stillness, eyes demurely cast down, not a single twitch of a muscle nor a flutter of a !> feather cloaks to bring a bit of attention to you. And yet you sense the intensity of the gaze the tavern maid turns upon you. ?N2W>  )N2WYou !> perch stand] in stillness, eyes demurely cast down, not a single twitch of a muscle nor a flutter of a !> feather cloaks to bring a bit of attention to you. And yet you sense the intensity of the gaze the tavern maid turns upon you. xMO actorN>5XMO actorNb5X>" Nb5Xq"KAK KAK KRAK COA!" you sing to the tavern maid. "Its infernal racket is giving me a headache!" she complains. VNb5X*The tavern maid blushes prettily as you !<@ to her. sing a little ditty lilt out a love songcroon a soft lullabye chant an ancient lament !warble out a high pitched tune %sing about a bird in a gilded cage yMO actorN7X3MO actorN97X>" N97XYou flutter atop the tavern maid's head and begin fussing with her cap and hair. She begins to flail at you all the while muttering about blackbird pie.eN97X>" QN97XEAlas, the tavern maid's hair is tucked neatly away from your reach.zMO actorNr8X^MO actorN8X>" YN8XJYou flutter your wings at the tavern maid who watches you suspiciously. *N8X>" E >H" ?N8X0You wave slightly at the tavern maid who comes bustling up to your side. \b "May I serve you?" she asks politely and begins a reel that seems recalled from memory. "Today we have stew, meat pie, and a delicacy-- fresh fish from a pure stream several leagues over. We also have several choices in liquors... brandywine, red wine, potato rum, ale, apple cider... oh and milk, if you don't like any of that."\b The tavern maid lowers her eyes and fiddles with her apron in seeming embarrassment. "Because of some err... difficulties" her eyes stray over to the corner where the drunkard sleeps obliviously, "I'm afraid I shall have to ask for payment ahead of time. Tis err... only a few coppers." she says and blushes.\b "If you decide you want something just slip me the payment and tell me what you'll be wanting."N8X>" E >H" N8X"Thank you for your pa--patronage," says the tavern maid with a small curtsy. "May I serve you?" she asks politely and begins a reel that seems recalled from memory. "Today we have stew, meat pie, and a delicacy-- fresh fish from a pure stream several leagues over. We also have several choices in liquors... brandywine, red wine, potato rum, ale, apple cider... oh and milk, if you don't like any of that."\bH{MO actorND>!XMO actorNh>#X>"  Nh>%X"You are the prettiest wittiest bestest estest cutest patootiest maid ever, yes you are, yes you are! The snuggliest wuggliest..." you coo to the deeply blushing tavern maid. "Someone's had too much liquor to-day" says !>F to the empty air.Nh>(X"kak kak krak coa coa coa!" you coo at the tavern maid.\b "Don't you be trying to make nice now, after all the trouble you caused!" scolds the tavern maid. +34JKBLCNLNJI6P[Q\[\}[~\R[S\///MO quipnoNA9XKNA:XStewNA;X MeatpieNAX Red WineNA?X Potato RumNA@XAleuNAAX Apple Cider[NABXMilkHE ;GVbt 'MO quipnoNBJXKNBKX\bI shall try the stew," you tell the tavern maid. She gives a small curtsy, bustles off to collect a bowl, and ladles out several spoonfuls of the stew bubbling over the hearthfire. "I wouldn't eat that if'n I were y'" !> warns as the tavern maid hands the bowl to you. "That's been on the hearth for nigh a seven night now!"\b "Hush you, old man," says the tavern maid. "There's nothing wrong with our food!":&NBLX  NBOX$\bI think I shall have some of that meat pie," you tell the tavern maid. She gives you a slight curtsy before bustling off into the scullery and returning with a large plate piled high with a crusty pie oozing yellow cream and a side of red brown beans.\b "Be careful o' those beans," says !>. "They go right through y'!";&  NBQX"I shall try your delicacy then, the fish," you tell the tavern maid. "Very good," she says with a small curtsy. The tavern maid then bustles into the scullery and shortly returns with a steaming plate atop which rests a large fish, head and all. >&NBRX  NBTX"A glass of brandywine, please," you tell the tavern maid. She bustles over to the kegs and bottles littering the backshelf and empties a small bottle into a nearby mug. "May you enjoy it,"she says as she hands the mug over to you. <& wNBWX3"Just some red wine," you tell the tavern maid. She bustles over to an old looking bottle precariously balanced at the edge of the back shelves, blows dust off the bottle and pours a bit of it into a nearby mug. "Here you go, lamb" she says to you as she hands the mug over. "A good vintage, supposedly." =& NBZXC"I'll give a go to that potato rum," you tell the tavern maid. \^!>s gives a great cackle as the maid bustles over to a keg upon a nearby shelf. "Quite an adventurer, are y'?" says !>* as the tavern maid hands you your mug. >& NB\X"Ale, please" you tell the tavern maid. "Of course," she says and bustles over to a series of smaller kegs across the back shelves of the tavern. The mug she returns to you is filled with a bright golden liquid that foams heavily over its rim. ?& ]NB_X;"A mug of apple cider," you tell the tavern maid. She bustles over to a large keg lying across the bottom shelf and presses down upon the tap. A golden brown liquid tinkles into the earthenware mug she holds beneath it. The tavern maid fills the mug to the brim, sloshing some of it over, before returning to you.@& zNBaX"Just milk," you tell the tavern maid. She bustles into the scullery and shortly returns with a mug filled to the brim with chilled milk.>& HE C)" ID    9  songbird\MN?>I  N?A delicate little songbird with plain brown plummage and a smattering of black speckles. The bird's slender feet clasp its woven reed perch as it tilts its head and regards you with a bright beaded eye._N?SA delicate little songbird with plain brown plummage and a smattering of black speckles. It sings joyfully as it perches on a tree limb within your forest. \b Feeling your gaze, the bird bobs its head at you and then launches off into the sky once more. It wings its way to the east, past the borders of your land and beyond your sight. !>I&/MO actorN?.BMO actorN?#The songbird twitters to itself. MO actorN?MO actorN)?Feeling your gaze, the bird bobs its head at you and then launches off into the sky once more. It wings its way to the east, past the borders of your land and beyond your sight. !>I&MO actorN ?MO actorN.?>I  N.?With a joyful trill the songbird bursts free of its cage. The tavern maid gives a squawk of dismay and rushes after it. The bird circles about the room while the patrons whoop and holler and the maid chases after it frantically waving her apron, a nearby broom, or anything else at hand. \bWith a final flutter of wings, the little songbird swoops out an open window and flies out of sight towards the north. N.?>I&"I9"z)N.?>I  N.?<3MO actorNQ?2JMO actorNu?>I  Nu?With a joyful trill the songbird bursts free of its cage. The tavern maid gives a squawk of dismay and rushes after it. The bird circles about the room while the patrons whoop and holler and the maid chases after it frantically waving her apron, a nearby broom, or anything else at hand. \bWith a final flutter of wings, the little songbird swoops out an open window and flies out of sight towards the north.>I&"|"I9bNu?VThe songbird is no longer in captivity, it's not the one who needs to be freed now. qMO actorN?>" 9N?*You rub up against the cooing songbird. N?<MO actorN< ?MO actorN` ?~For some reason, raven form or not, the thought of mating with the plain little songbird does not fill you with enthusiasm. J  LM cMNa3<" E <  "Nb3ill fitting dress Nd3frilly white dress, an ill fitting dress KKYou shimmy into the lacy dress. Tis not exactly flattering your figure... 11With some relief you wriggle out of the dress. A frilly chemise, a few shades off white of ivory, with falls of lace down its wrists and chest. Tiny little pearls have been sewn unto the lacing of its full skirt. MO actorNi3tMO actorNk3UThe lace is quite itchy. You never quite understood people's fascination with lace.-FMO actorN~m3'It smells of stale perfume and musk. KF F FLM#  full suit of armour Piece by piece, bit by bit, you slip on the entire suit of armour until you are completely covered up. You either look like a dashing knight or a complete lunatic, either description would suit you well. (MN1(<(KN1N1It takes quite a bit of time to wriggle and unclasp and unclamp your way out of the suit. Perhaps next time you should just phase through it instead of going through all that trouble. N1N1^You phase through the suit of armour allowing it to fall into a pile at your reformed feet. N1N1N1^You phase through the suit of armour allowing it to fall into a pile at your reformed feet. (7v A full suit of burnished and etched steel, from helm and visor to greaves and pointed toecap. Impressive looking, if rather unwieldy. Leather ailettes on the shoulders display the coat-of-arms. MO actorN1-MO actorN1Cool metal. -;MO actorNH1A faintly metallic smell. MO actorN1MO actorN1wYou took this full suit of armour from some dandy idiot who was rushing about your lands trying to 'slay the dragon'.LbbbM F dinner knifeMNkA short supper knife made for cutting meat that's been long dead and roasted. At least it's sharper than !>'s MO actor8MO actorNIt's simple but sharp. -;MO actorN$A faintly metallic smell. M@@@@2 MO actorNuN.  The TavernMN!>-*MO actorNM!>+.*MO actorN}!>*O`N P`N Q  J  draftnMN>" LN=A faint wind send stirs of ashes drifting through the air.  NThe tavern is a bit warm, a bit stuffy, with air that seems almost palpable as a haze of smoke wreathes the wooden rafters. A mild draft that crisscrosses the room from open doorway to hearth keeps the room from devolving into something uncomfortable. 2MO actorNGentle and warm. -MO actorN>" 5N&The wind smells of ash and burning. CN7The wind smells of stone dust and faintly of apples. /MO actorN} .MO actorN >" JN ;The wind makes no sound as it blows through the wreckage.MNAThe wind makes no sound as it makes its paces around the room. MO actorNcTMO actorN>" HN9You spread your wings and hover easily within the air. NfWhile it would be amusing to see the faces of the tavern patrons if you started flitting around the !> wreckage,  ceiling,K that would utterly destroy the disguise that you have worked years upon.R`Q S`Q T.  dried leaves Layers of flaky dried leaves collected from the ordinary trees that grow alongside the road. They are liberally speckled with bird droppings. MO actorNoMMO actorNq.You refrain from touching the dirty leaves. -MO actorNDsiYou take a hesitant sniff of the cage. Eck... as you feared, the cage could do with a better cleaning. U`T V`T W.  bird droppings LLNay... there are more interesting things to stare at than bird droppings. MO actorNMO actorNmFor one insane moment you actually consider touching the bird droppings, but then sanity takes hold again. -MO actorNAnFor one insane moment you actually consider smelling the bird droppings, but then sanity takes hold again. X`W Y`T ZH.   cage latch, the cage latch kkA simple latch formed by cross-sections of wood and reed. It would be easy to pull open and close again. -,zy[|zzz.   birdperch DDThin strips of dried yellow reeds form the perch within the cage. MO actorN~GMO actorN(The pale wood is rough and splintery. -MO actorNiYou take a hesitant sniff of the cage. Eck... as you feared, the cage could do with a better cleaning. \`[ ]`[ ^eee5MD pottery shards, pottery shards TTA few thin fragments of broken pottery that the tavern maid neglected to sweep up.MO actorN5MO actorNSurprisingly sharp. -\MO actorN=A faint trace of stew, burned meat and steamed vegetables. _X$$.4  tavern chairs The tavern chairs are stiffbacked and simply crafted from pale wood, with faint grooves at the center of their seats from generations of posteriors being rested there.MO actorNOMO actorN0The wood is smooth and pleasant to the touch. -kMO actorNdLThe chairs smell of tavern smoke, of pipes and hearths and cooking fires. EMO actorNFMO actorN>" lN]You take a seat on the edges of the tavern shadows and watch the peaceful scene before you.NCarefully folding your wings against you and fluffing each feather in place, you roost in the center of one of the tavern's wooden seats. \b "Heh," says !>F?, "Look at that bird there, sitting as pretty as you please. GMO actorNHMO actorN>" NwWhile it may be possible to lounge elegantly on the chair, its still far to small to lie in. At least in this form. N>" NCarefully folding your wings against you and fluffing each feather in place, you roost in the center of one of the tavern's wooden seats. \b "Heh," says !>F?, "Look at that bird there, sitting as pretty as you please. MO actorN_MO actorN>" E<4! NYou easily step atop a nearby seat. The other tavern occupants blink up at you in surprise for a moment before most of them return to their conversations. "Something interesting up there?" !>6 asks as she cranes her own head up to the ceiling. N>" lN`You roost atop the tavern chair, watching the peaceful scene of playing out before your eyes. JKMO actorNyMO actorNd You knock on the wooden chair for luck. Not that someone such as you is ever in the need for it. MLONLNPLQNRLSNLMO actorNfNT MO actorN>" NIn a flurry of dark feathers you attack the offending chair, unleashing all your bird-y fury amidst great peckings, clawings, and squawks. \b "The bird has gone balmy," !>+ comments dryly as she sips at her brew. =N>"" ZNKThings have taken far too interesting a turn for distractions right now. N>7" E >" NYou grasp the tavern chair by the wooden beams that crisscross its back and hurl it at the opposite wall. It hits with a resounding clatter, knocking over a nearby table and bench in its ricochet. \b The tavern drunkard sits up with a start as the table he had been sleeping on wobbles wildly in the chaos. All the others turn to gape at you as the tavern keeper comes thundering out of the kitchen. \b "That be enough of your shenanigans for today!" the tavern keeper declares and begins dragging you out by the ear. Or she tries, but you are far too quick to submit to a humiliation like that. \b For a moment you ponder bringing down a swarm of bees, or slavering dogs, or even simply setting the tavern keeper's hair on fire for her impudence. You finally decide not to risk destroying your disguise for generations to come with such a display, and so with quiet dignity you bid farewell to the tavern and walk out on your own. \b"8>N>6" E >" NYou grasp the tavern chair by the wooden beams that crisscross its back and hurl it at the opposite wall. It hits with a resounding clatter, knocking over a nearby table and bench in its ricochet. \b The tavern drunkard sits up with a start as the table he had been sleeping on wobbles wildly in the chaos. All the others turn to gape at you as the tavern keeper comes thundering out of the kitchen. \b "Now what be the problem?" says !>. \b "7NYou grasp the tavern chair by the wooden beams that crisscross its back and hurl it at the opposite wall. It hits with a resounding clatter, knocking over a nearby table and bench in its ricochet. \b The tavern drunkard sits up with a start as the table he had been sleeping on wobbles wildly in the chaos. All the others turn to gape at you as the tavern keeper comes thundering out of the kitchen. \b "Have you gone mad?" the tavern maid stares at you. \b "6TMO actorNUMO actorN>" NCawing happily to yourself you scratch and peck at the wooden chair. The tavern maid gives a sigh and then rushes at you, shooing you away from the chair. N)UVMO actorNWMO actorN>" 6N'You idly scratch at the wooden chair.NCawing happily to yourself you scratch and peck at the wooden chair. The tavern maid gives a sigh and then rushes at you, shooing you away from the chair. `RRRJ lingering scent of red wine eeThe smell of red wine still hangs heavily around you from when you broke the bottle in the tavern. ,MO actorNM -MO actorNO eThe smell of red wine still hangs heavily around you from when you broke the bottle in the tavern. a  .   lanterns, the lanterns Elongated glass lanterns with rounded bellies, their wicks unlit yet already half burnt. A thin sheen of oil rests at the bottom of each lamp. MO actorN =MO actorN Cool and smooth to the touch-UMO actorNC 6They smell of char of the sharp acrid scent of oil. YMO actorN ZMO actorN Not necessary as the tavern is quite well lit already. Besides the lanterns flickering into life on their own might spook the occupants too much. MO actorN{ MO actorN They are pretty firmly attached to the wall and it would bring far too much attention if you started yanking them down. Your own light sources are far more elegant than these pitiful lanterns anyway. b(  5M  wet cloth TTA faded red cloth soaked in cool water. Or perhaps its a white cloth stained pink?MO actorN9 <MO actorN; Cool and wet to the touch. ,MO actorN< -HMO actorN> )The cloth smells of...well, wet cloth. ]MO actorN^? ^cMO actorNA DYou wave the cloth about sprinkling wet drops hither and thither. #MOactorioNB uMOactorioND  You attack !<  with the soaked rag. \^!<  is not impressed. UMO actorNE Alas, !< # does very little damage at all. cP6 @ small tin of oil PPA rounded metal tin stained with several dark blotches but otherwise unmarked.MO actorN 4MO actorN dYou peek inside the tin to find it half filled with the oil used to replenish the tavern lanterns.N <" FN :A small flame dances atop its own miniature lake of oil.,MO actorN -`MO actorN AYou sniff at tin. It smells strongly of the acrid bite of oil. MO actorN$ MO actorNH <" {NH lThe tin is burning hot to the touch. If you had true flesh and blood, it would scald you to even hold it. 6NH *The tin is smooth and cool to the touch.YMO actorN" ZMO actorNF You gaze down upon the tin of oil and it obediently bursts into flame, the tongues of fire licking upwards in shades of orange, red, and gold. "ux4dl+++J food within the scullery QQMostly vegetables, from what you can see, and an inordinate amount of potatoes.,MO actorN -tMO actorN UThe scullery has the mouth watering smell of cooking vegetables and crisping meat. e`J tables within the scullery AAThe tables lining the narrow scullery are of stout plain wood. ,MO actorN -tMO actorN UThe scullery has the mouth watering smell of cooking vegetables and crisping meat. f\\\J bowls within the scullery Bowls of varying sizes litter the scullery tables, clean and empty or half filled with foods in various states of preparation. ,MO actorN -tMO actorN UThe scullery has the mouth watering smell of cooking vegetables and crisping meat. gJ utensils within the scullery Mostly wooden spoons and forks with a few metal ones scattered amongst them. All the cutting knives look silver, however, and glinting appear to be quite sharp.,MO actorN -tMO actorN  UThe scullery has the mouth watering smell of cooking vegetables and crisping meat. hJ ##pots and pans within the scullery Many pots and pans of various shapes and sizes hangs within what you can see of the scullery hearth. Many are black iron but a few have the silvery gleam of the more expensive burnished steel.,MO actorN  -tMO actorN. UThe scullery has the mouth watering smell of cooking vegetables and crisping meat. i<  .  downstair steps These few steps tucked around a corner are hewn out of stone, different from the rest of the wooden tavern. They are bumpy and chipped and lead directly into the cool darkness of the cellar below. MO actorN 6MO actorN) Cool and rough stone.MO actorNu  ^^You wander down the few narrow wooden steps that lead into the cellar. It's slighter cooler here and smells of dank earth and potatoes. Crates and barrels full of vegetables and bottled liquor are piled up in the shadows. You find the spuds sitting and gossiping around the fire far more entertaining than these, and so return to the tavern above. jJ  road,  the road YYThe small snatch of road spotted from the window curves round the tavern to the south. kJ   courtyard, the courtyard ggA side of the stable and a small stretch of the pebbled courtyard can be seen from this vantage pointl\    )' Beast's Territory \(The Beast's Territory\)MN@ 1\bThe lands of the Beast stretch out before youNA > m NB and they are empty and dying. The dark green grass is grows pale and shriveled before your eyes, the once forboding forest looks nothing more than shady, and the outlines of the far distance mountains seem to almost fade away. }ND q. The grass is a green so dark that it almost appears brown or black and rises to knee length for a full grown man. No other vegetation, neither flower nor tree, grows here until the edges of a dark forest to the west. In the far distance the faint outline of gray craggy mountains can be seen. Even the skies here appear to be grayer than on your side of the border.* A breathless silence+MNH > m 4NI %The scent of the Beast is fading...FNK :The land is saturated with the musky scent of the Beast.OxMNL `You stagger out of the lands of the Beast and into the bright sunlight of your own meadows. \bPxMNM `You stagger out of the lands of the Beast and into the bright sunlight of your own meadows. \bVpMNN XYou stagger out of the lands of the Beast towards the cool waters of your own lake. \bmNxMNO `You stagger out of the lands of the Beast and into the bright sunlight of your own meadows. \bTtMNP \You stagger out of the lands of the Beast and into the cool shadows of your own forest. \bnMNR RYou wander further into the territory of the Beast.\b \(The Beast's Territory\) !<S You try to sink into the embrace of the earth but it burns like a thousand flaring whips as you descend... The land... rejects you... You stagger painfully up to the surface once again.R nnAs you reach skyward you feel your consciousness fray away... You are far too weakened to chance that here. pMO actorNV > m NW NY (NZ C)N[ )3MO actorN^^ C)N^_ )()xMNc (<(KDNd Ne =\bA tremor flickers through you and resonates to the west. Nf Ng Nh D\bThe day around you darkens. Something...something is coming.... Ni Nj Np M\bThe Beast rushes out of the forest, a dark nothingness that descends upon you, filling your entire view, ramming into you at full force. You are sent flying away, your form shattering, your consciousness fragmenting... breaking... away...\n \t...you\n \t.....land...\n \t\t........dying\n \t... lost ...\n \t... \ ..\ .\nNq Nr C)qmH    )' Lake \(The Lake\)+ __The tang of water is in the air and beneath that a faint woodsy smell from the bonsai trees. * 99The lake is still and quiet, its waters remain silent. /MN\b A perfectly circular lake lies before you, its still waters so pure that you can see unhindered into its deepest depths. A small dark island awaits at the center of the lake, barren except for a single black tree bearing azure blossoms. \b The verdant shores extend northward into further plains, while dark trees take form to the west and light trees to the south. A slight shimmer of rainbows can be seen to the east. \bN> m ]NQ\bThe blue petals of the dark tree tremble and whisper fitfully to each other. O_MNGYou turn about and begin the long trek back to the southern woods. \bWV/MN>vg" NAs you head to the northeast, grass gives way to barren red earth. Before you stand the red archway, nearly entirely blocked by a tumble of red stones. You give a slight shrug and phaze through the rock and into the surrounding red hills. NN}MNeYou edge around the lake and press onwards, towards the north, to the very edge of your domains. \b U|MN> m QN<To the northwest there is... emptiness. The Beast is gone!lNlT You hesitate for one moment and then grimly cross over your boundary. With the first movement you felt the wrongness... as if the earth itself was shrieking in ire. It was shrieking... something shrieking... someone shrieking... The air around you jellifies... something tearing...\b \t raw ragged...\b \t ripping...\b \t tearing...\b The Tree laughs. "You must be mad, coming over here," it says and you are pushed back to your side.PMNvYou chase after the rainbows to the east. As you approach closer, the rainbows shimmer and wink playfully at you. \bQoMNWYou follow the stark spike of shadow to the east that is the grove of black trees. \bMNYou wade into the lake, the chilled waters rising up to your knees, and then walk down the slight incline, the waters rising higher and higher until they are above your head and you are breathing in the cool waters into your lungs, filling you with a crispness that no air could ever hope to achieve. Bubbles float around you, above you, the plants reach out to caress you, and all colors seem brighter than ever before. You drift down to the bottom of the lake. \b>R {{You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.nJ l forest, forestMMN| > m pN} aAn ordinary forest full of ordinary shadows and limbs, as if it never knew the touch of a fey. N The distant shadowy forest appears distinctly uninviting with the foliage a morass of twisted branches and barren protruding limbs. It suits the Beast's temperment quite admirably. o8J l  mountain,  mountainMN > m N Even as you gaze upon the mountains they seem to fade before your eyes. One moment they are there in all their stark glory and in a blink there is nothing but empty pale sky. N Starkly pale mountains that appear, even from this distance, to be barren of all vegetation. You've always heard that mountains were supposed to be beautiful to look upon but these are merely depressing. p===J l sky,  the skyMN > m EN 6Bits of blue have begun to bleed back into the sky. N The sky here is a dull gray mottled with white shapeless clouds. One should think that the Beast could at least put some artistry into his skies. r  . l ground,  the ground;MN > m xN iOrdinary grass, if a bit on the dark side. Even as you watch more and more green is bleched from them. N The tall blades of grass growing here appear, appropriately enough, to be sharp to the touch. It would probably be very painful for a mortal to tread here.MO actorN MO actorN > m N You brush your !> claws hands= through the grass to find its nothing but ordinary grass. N >" N }The grass slices sharply into your fingers causing blood to well up. A single drop falls to the ground with a soft tinkle. > s&5N )The grass cuts sharply into your beak. -=MO actorN4 A faint metallic undertone. sxxx5Mf  blood drops crystalized blooddrop A drop of deep ruby blood, smoothly crystalized into a flawless gem. Little sparks of red and orange fire glint deep within the depths of the crystal. MO actorN aMO actorN BThe blood drop is perfectly smooth and cool beneath your touch. tvvv5  blood dropsf crystalized blooddrop A drop of deep ruby blood, smoothly crystalized into a flawless gem. Little sparks of red and orange fire glint deep within the depths of the crystal. MO actorN aMO actorN BThe blood drop is perfectly smooth and cool beneath your touch. u g g g )' Traveler's Road \(Traveler's Road\) \bThe road is long and winding, wide enough for two carts to pass, and unpaved, comprised instead of hardpacked earth that has grown warm in the heat of the sun. Ruts pock its surface here and there, caused by the passing of generations of wheels. \b From here the countryside that you can see belongs to you or the Beast with a bit of the empty lands visible to the far east. Yet you know that further along this road, beyond your farthest gaze, lie lands belonging to other fey and those that belong to men as well, villages and towns and cities, kingdoms and mountains and oceans, things that you hear about but will never be able to see. Just beyond this road... \bQgMN OYou quickly leave behind man's road and walk into the welcoming red hills. \bTWMN ?You walk out of the road and up to the tavern's courtyard. \bN}MN vg" N As you head to the north, grass gives way to barren red earth. Before you stand the red archway, nearly entirely blocked by a tumble of red stones. You give a slight shrug and phaze through the rock and into the surrounding red hills. \N PYou quickly leave behind man's road and walk into the welcoming red hills. \bUtMN \You leave behind the unpaved dirt of the road to enter the cool shadows of your forest. \bwMN [Carefully dragging foot over foot, you wander further up the road.\b \(Traveler's Road\) !<S 77The earth here is barren and offers you no sanctuary.R nnAs you reach skyward you feel your consciousness fray away... You are far too weakened to chance that here. KMO actorN (N C)N )3MO actorN6 C)N6 )* >>It's quiet and peaceful here, far from the bustling tavern. + QQIt smells of dust and toil and sweat, of something very ephemeral, very mortal.()PMN (<(KN N You step upon the barren road. And though the road is empty it does not have the feel of empty lands to it. Instead it feels a bit like the tavern, which can't be right since the tavern belongs to you. N JN N ;\bThe emptiness of the road seems to seep inside of you. N N N R\bA faint feeling of nothingness is worming its way through your consciousness. N N N ;\b You feel the edges of your mind begin to fray apart...N %N N Q\b Your physical body...dissolves away... almost pleasant... not... thinking...N N N O\b \tFade.....\n \t \tnothingness\n \t\tno...thing...\n \t...no...\n \t...\nN N C)04Zv.:  Sculpted Hills, the red sculpted hills$MN4 The hills rise barren and flowing all around you. They curl, swirl, and fold one upon each other, forming secret niches and alcoves before rising up into ever wilder shapes. The slopes of most hills are steep and smooth, with nary a foothold nor handhold to be seen.N4"gN4\bThe hills surrounding the red arch have collapsed upon themselves in a rather violent rockslide, blocking the entranceway to all those mortals who tread on feet. The messy tumble of stones annoys you with its un-artful sloppiness. oMO actorN4pYMO actorN4>vg" N4You glare are the chaotic tumble of stones and it trembles, slowly sinking into the rocky ground, as the hills around you quietly lengthen, stretching outwards arms of earth and stone until they are perfectly curved and smooth once again. !g.N4"The hills are fine as they are. MO actorN4RMO actorN(43The hard-baked ground is warm beneath your feet. ,MO actorN5-*MO actorN5 Dusty... MO actorN5MO actorN5uCarrying around and entire hill may be a tad too conspicuous. How about just taking that chunk of rock over there? /MO actorN5.MO actorN5Breezes blow through cracks and niches, hidden clefts and chinks, through the curves and spirals of the Unicorn's Horn and a melody is risen, keening high and then low. Something beautiful but very lonely. The sound dies away with the wind. +MO actorN53+MO actorN5!MO actorN#5MO actorNG 5eWith not a negligible amount of effort you manage to scramble up the smooth sides of the hills. \b >wJ u the Beast's lands, the Beast's lands WWThe lands of the Beast are filled with long black-green grass that lead into the depths of a nearby shadowed forest. Mortals, both human and animal alike, have been taught a heavy lesson to never enter such a forest. \b Your forest, on the other hand, is far more pleasing to the eye and far safer. Usually. When you're not in an ill temper.xYYYJ u ""empty lands beyond your boundary, &&the empty lands beyond your boundary/MO actorNu .MO actorN }Your senses do not extend to the empty lands. Undoubtedly normal sounds fill the normal lands from its normal inhabitants.  Uninhabited fields and trees stretch out before you. Undoubtedly there are animals and humans who live somewhere on this land, but no fey has possessed it for many years. You've been steadily pressing your influence upon it, in a contest between you and the other surrounding fey. y\  . l road, road ::The road is long and winding, wide enough for two carts to pass, and unpaved, comprised instead of hardpacked earth that has grown warm in the heat of the sun. Ruts pock its surface here and there, caused by the passing of generations of wheels. The grass growing by the side of the road is sparse and yellowed. MO actorNy& 0MO actorN( Dusty and warm -qMO actorN* RIt smells of dust and toil and sweat, of something very ephemeral, very mortal. MO actorNJ+ MO actorNn- You bend over to pluck a blade of grass from the side of the road but a wave of dizziness overcomes you. Perhaps you oughtn't tarry here. zd###J u your surrounding lands, your surrounding lands your surrounding lands The most prominant feature of your lands visible from the road are the soaring red hills set back a ways from the sparse vegetation that edges the road. From this vantage point little can be seen of the hills save for smooth red lumps and the spiral of the Unicorn's Horn standing like a sentinel over the surrounding lands. It must be quite a sight to behold the Horn from the road, glowing brightly in the moonlight. {J u the Beast's lands, the Beast's lands WWThe lands of the Beast are filled with long black-green grass that lead into the depths of a nearby shadowed forest. Mortals, both human and animal alike, have been taught a heavy lesson to never enter such a forest. \b Your forest, on the other hand, is far more pleasing to the eye and far safer. Usually. When you're not in an ill temper.| P  P P *.  nearby stableMNi>" NkThe nearby wooden stable is not large at all. Wide windowed and open doored, it once provided shelter for the horses of the few travelers that pass by this way. \b The thatched roof of the stable has been burned away with scorch marks crawling down its sides.VNnJThe nearby wooden stable is not large at all. Wide windowed and open doored, it provides shelter for the horses of the few travelers that pass by this way. \b Gazing through the open doorway you catch the sight of flicking tails and twitching ears, the restless stirring of bodies and the bright gleam of intelligent dark eyes. MO actorNo&MO actorNq>" NrThe wooden slats of the stable are smooth to your touch and slightly warm from the early sun. Or perhaps from the not-so-early fire.lNt`The wooden slats of the stable are smooth to your touch and slightly warm from the early sun. -.MO actorNvGWith not a little bit of trepidation, you take a whiff of the stable.Nw>" PNxAIt smells of burning wood and hay, and faintly still of horse. hNz\The sweet scent of hay and cedar can't quite drown out the smell of hot horse and manure. /MO actorND{.MO actorNh}>" %Nh~Silence from within.FNh:You can hear the rustle of restless horses from within. MO actorNMO actorN">" ,N"You slip into the shadow of the stable and are greeted by the pungent scent of sweet hay and grains, alfafa, cedar chips, and the heady musk of horse. Yet above all lies the smell of wood and burning. \b Where the horses who once lived within these walls have gone, you do not know. =N"1You casually slip into the sheltered warmth of the stable and are greeted by the pungent scent of sweet hay and grains, alfafa, cedar chips, and the heady musk of horse. The body heat of the animals permeates the air and envelopes you. \b For a moment there is silence as the horses become aware of your presence. Silence and then... madness, a cacophony of sound as hooves pound against wooden walls and wild whinnying, squeals, and trumpeting fills the air.\b You quickly skulk out of the stable before the cries of the horses bring the stablemen running. CMO actorN >" 'N You flap your way into the stable and are greeted by the pungent scent of sweet hay and grains, alfafa, cedar chips, and the heady musk of horse. Yet above all lies the smell of wood and burning. \b Where the horses who once lived within these walls have gone, you do not know. ?N 3You flap your way into the sheltered warmth of the stable and are greeted by the pungent scent of sweet hay and grains, alfafa, cedar chips, and the heady musk of horse. The body heat of the animals permeates the air and envelopes you. \b For a moment there is silence as the horses become aware of your presence. Silence and then... madness, a cacophony of sound as hooves pound against wooden walls and wild whinnying, squeals, and trumpeting fills the air.\b You quickly flutter out of the stable before the cries of the horses bring the stablemen running. }.   scorchmark hhA large irregular mark the color of overcooked bread has been burnt into the center of the courtyard. MO actorNMO actorN"Suit flakes off as you run your !> claws  fingers over the pebbled ground,MO actorNK-?MO actorNo The odd smell of burnt stone. ~ W W W /. m groundMNThe ground is covered with pebbles and stone, gray and chalky white near the tavern but flecked with color and crystal the further along you walk. N<m" QNE\b A pile of pebbles surrounds a small hole dug within the ground. 1MO actorNE0MO actorNiSNiDYou scrabble in amongst the pebbles but find nothing of interest. RNi/You scrabble in amongst the pebbles and find !."myMO actorNBzMO actorNf<m" fFYou smooth over the pebbles until the ground is pristine once more. !m7Nf+There are no holes to be filled in here. ?MOactordobjN!2You dig a little hole amongst the pebbles, drop ! ( into it, and quickly smooth it over. &>MO actorN@>A?MO quipnoN KN Oh, are you volunteering?N Rather presumptious...`N Naturally, I wonder if !> will help...pMO quipnoNKN4\b"Oh, are you volunteering then?" you tease. \b "Mayhaps... what is the price?" Val counters. "Probably far too much for you to ever hope to pay," you reply, and remembering what the mage truly is, you back off. \b "You'd be surprised what I'm sometimes willing to pay..." Val murmurs, mostly to himself. >##HN\b"Rather presumptious, aren't you?" you say cooly. \b"Bold is my middle name," says Val. "Yet you never said what your full name is in the first place." you reply. \b Val presses a single finger to his lips and winks at you. "After you, Snugglebums," he says.  N)\b"Naturally," you reply. "I wonder if !>^ would be willing to help?"\b "Cruel, cruel, Snugglebums," sighs Val. "Beautiful but cruel.">##Q MO actorN~MO actorN_The ground is full of hard little pebbles that leave a fine dust behind when you touch them. mMO actorN~ >" FCYou shouldn't overburden yourself with items while in this form. UMO actorO  selectionN <n@N nE.  groundyMO actorN1zMO actorNU>~m" ZNUFYou smooth over the pebbles until the ground is pristine once more. !~m8  .  dull pebbles plain pebbles EEJust some plain pebbles... far from your most noteworthy creations.MO actorNNLMO actorNP-The ground is full of hard little pebbles. mMO actorN Q>" FCYou shouldn't overburden yourself with items while in this form. wMO actorO~xNT*You reach down and snag a plain pebble. NUZNV&L   .  pretty pebbles pretty pebbles RRThese pebbles are prettier than normal with iridescent flecks of color in them. MO actorN;LMO actorN=-The ground is full of hard little pebbles. mMO actorN>>" FCYou shouldn't overburden yourself with items while in this form. xMO actorOxNA+You reach down and snag a pretty pebble. NBZNC&T  5M  pretty pebble RRThese pebbles are prettier than normal with iridescent flecks of color in them. MO actorN KMO actorN ,Shockingly the pebble feels like a pebble.+MO actorN  MO actorN-> m N-You toss the pebble into the lake. It skips across for a few paces, each little jump leaving behind perfect concentric circles in its wake, before vanishing under the water without a sound. <&N->  N-You toss the pebble away without a thought. It plinks against an expanse of colored glass within the trees, and luckily falls away without a scrape nor scratch. N-)l, , ,5M   dull pebble Just some plain pebbles... MO actorNW$MO actorN{&eShockingly the pebble feels like a pebble. It also leaves a smudge behind from where you touch it. +MO actorN (MO actorN/*> m N/+You toss the scrap of turquoise into the lake. It skips across for a few paces, each little jump leaving behind perfect concentric circles in its wake, before vanishing under the water without a sound. <&N/,>  N/-You toss the scrap of turquoise away without a thought. It plonks against an expanse of colored glass within the trees, and luckily falls away without a scrape nor scratch. N//).  round-mouthed well xxA stout round-mouthed well, no taller than your waist, made of crumbling gray stone and full of dark shadows. It is beyond you if there is anything else in the well besides shadows. \b On the wide lip of the well rests a battered wooden wheel and handle, presumably attached to a bucket below. Presumably, as you have never managed to get the forsaken contraption to work. ,MO actorNa-qMO actorNcRThe well smells far more strongly of dirty old stone than it does of any water. oMO actorNTepMO actorNxgYou have never actually been able to force this well to work and give up the water that supposedly rests within its belly. However, it was the mortals who dug this well, let them deal with it.MO actorN_iMO actorNk>" VNlGThe thought of jumping into this darkened well does not enthuse you. @Nn4You swoop down into the dark innards of the well. >MO actorNNp=MO actorNrqWith a great creaking you turn the wooden wheel. You hear a cranking sound below, yet no bucket rises into view, no matter how long you work at the wheel and handle. MO actorN?t_rMOactordobjNcu You drop ! ( into the gaping darkness of the well.&lll)' Belly of the Well \(Belly of the Well\)+ ((The smell of wet rock and stale water.* <<Silence from within, the softest echo of wind from above. &&A few feet of water lies at the bottom of the well, mostly clear but with a few flecks of stone and dirt, and even the occasional dried leaf, swirling about in it. The stone this far down is moist and slippery, covered in a fine white sludge. Above you the bucket hangs on its slender chain. ~MNfWith a few mighty pumps of your wings you soar away of the stale scent of water and out of the well.t4 4 4.  bucket and chain A large battered bucket, color long leached away, dangles at the end of a slender chain whose links have gone to rust the further along they go. The bucket and chain looks serviceable, you can see no reason why they should not work, besides the delight in defying you. oMO actorNNpMO actorNrYou have never actually been able to force this well to work and give up the water that supposedly rests within its belly. However, it was the mortals who dug this well, let them deal with it.MO actorNYMO actorN}>" ?N}0The bucket is too heavy to carry in this form.8N},The bucket hangs a bit beyond your reach. ,MO actorN-NMO actorNC/The bucket and chain smell of moss and rust. MO actorNvMO actorNWThe bucket is smooth, if a bit slimy, to the touch. Red flakes off the rusted chain. Y Y Y.  debris,  the debris The stone is dry higher up, but is quite moist down here within the base of the well. A white mineral deposit coats the surface of the stone, mixed in with what might be a low growing fuzzy mold.MO actorN CMO actorN0$You really have no need for this. ,MO actorNy-[MO actorN<It smells of wet rock and faintly perhaps of moss or mold.MO actorN4MO actorN"Slimy to the touch.dccc<&MO actorNv<6(MO actorNKv!<y&MO actorNyv<(MO actorNv!<uu That was refreshing!qMO actorNv< "FNv:Not necessary... you can create better drinks than this.  .   well water, the well water There is not much to discover about the well water beyond what can be beheld in the first glance. Despite your suspicions, the well water is truly here, mostly clean but with a bit of debris mixed in with it. MO actorN$MO actorNHThe water tastes a bit stale, although there is an almost pleasant aftertaste to it... the mineral of the rock must have seeped into the waters. ,MO actorN-HMO actorN$)The scent of wet stone and stale water.MO actorNr@MO actorN!The water is cool to the touch.p/ / /.  debris,  the debris A bit of debris swirling about at the bottom of the well. It is much as expected, small bits of chipped rock, waylaid leaves, and other random bits of detritus.MO actorNCMO actorN $You really have no need for this. ,MO actorNV-HMO actorNz)The scent of wet stone and stale water.MO actorN@MO actorN!The water is cool to the touch.J  sky,  the sky The sky above you is a deep, deep blue; the color, perhaps, of polished lapis lazuli. A smattering of clouds can be seen in the far distance. yyyJ  clouds,  the clouds 55The clouds are too far off to make any shapes out. |:::J ,  the sun sunMNfThe sun is rising over the roof of the stable. Perhaps you oughtn't stare directly at it like this. N> > E >q" NA"Lad, y' don't want to be looking right at the sun like that," !>s cautions you. "I heard o' a man who stared at that there sun too long and plum burned the eyes out o' his head!""qN> > E >q" `NT"Tis dangerous to stare at the sun like that," Val says he gazes at you sideways. "q0  J  wind>MNfA gentle cool wind comes now and again through the pebbled courtyard. For a moment it scatters away !>the stench of burning !the scent of apples and hay { and instead brings to you the scent of green things growing or fainter still, the floral smell of newly budded flowers. 6MO actorNqCool and refreshing. -oMO actorNPIts laced with the scent of growing things, green leaves and honeyed flowers. /MO actorN".RMO actorNF3The wind whispers of a disturbance to the north. MO actorN)MO actorNt3 3 3J  breeze 99Only the gentlest tendrils of of wind touch your skin. :MO actorNnSoft as a baby's breath. -OMO actorN0The wind smells of living wood and sweet sap. /MO actorN.CMO actorN'$The wind sighs through the trees. MO actorNpMO actorN}You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor. \b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.HHHJ  thatched and shingled roofjMN>" \^!< = has been lost within the darkened wreckage of the tavern. NThe thatched portion of the roof of the tavern is a dirty straw gray, drab but serviceable, with not too many holes that will allow moisture to drip in on rainy days. Nothing much else can be seen of it from this perspective. oMO actorNpnMO actorNGThe loose shingles on the tavern roof meld back with their brothers. !rG G G5MrqMNo<" +Nopile of shattered shingles0No$loose shingles pried from the roofMNo<" PNoAA shattered pile of wooden splinters and half broken sheathes. TNoHSheathes of roughly rectangular wood, thin and splintery to the touch.MO actorN^oBMO actorNo#Thin and splintery to the touch. MO actorNopVMO actorNo1The broken wooden shingles become whole again. !(  .E  horse troughrMN>" \^!< = has been lost within the darkened wreckage of the tavern. NTravelers' might stop to water their horses at this old trough before stabling them or continuing on their way. The trough has seen better days, pitted, cracked and stained a mottled green and gray, yet it still holds its water half-filled. ,MO actorN-MO actorN>" \^!< = has been lost within the darkened wreckage of the tavern. tNhYou surrepticiously pop your head into the trough and inhale. It smells of old wood and dried leaves. MO actorNMO actorN>" \^!< = has been lost within the darkened wreckage of the tavern. MNAThe old wood of the trough feels smooth in between its cracks. sttMO actorN">" #\^!< = has been lost within the darkened wreckage of the tavern. N%>" N&You dunk your head in the warm waters and, spluttering, raise it up again. Alas the horse trough is far too small to do anything else. N'>" N*With a mighty squawk and a great flapping of feathers you dive into the horse trough and begin paddling about. The water is warm and smells faintly of stagnance and old leaves. When you finally claw your way out again your dark feathers are fully waterlogged and bedraggled.\b That won't do at all. You give yourself a good shake and evaporate the excess moisture from your body. With a bit of preening, your glossy black feathers are as pretty as ever. L L L  trough water,  some waterMN5>" 6\^!< = has been lost within the darkened wreckage of the tavern. 7N8+This water looks distinctly unappetizing.u8MN:>" ;\^!< = has been lost within the darkened wreckage of the tavern. N=You take a cautious sip of the warm trough water. Mmm.. just the barest hint of dried leaves with an aftertaste of mud. Maybe next time you'll splurge on some drinks from the tavern. ,MO actorN5>-MO actorNYA>" YB\^!< = has been lost within the darkened wreckage of the tavern. NYDYou lean close and disdainfully sniff the troughwater. The water smells stale, not like the crisp clean scent of your fountain and lake. MO actorNvEMO actorNG>" H\^!< = has been lost within the darkened wreckage of the tavern. /NJ#The water is warm to your touch. O O OE.  apple barrelMNV>" WNW\^!< 9 has been lost in the darkened wreckage of the tavern. NZThe wood of this barrel has been bleached by too many days in the sun and, with several missing slats, its balance is precarious.,MO actorN;[-MO actorN_]>" WN_^\^!< 9 has been lost in the darkened wreckage of the tavern. sN_`gThe faint scent of the barrel wood is overwhelmed by the perfume of the overripe apples it contains. MO actorNTaMO actorNxc>" WNxd\^!< 9 has been lost in the darkened wreckage of the tavern. [NxfOYou probe the wood of the barrel and nearly get a splinter for your trouble. +MO actorNUg3MO actorNyi>" yj\^!< = has been lost within the darkened wreckage of the tavern. SNylGYou peek inside the wood barrel and find it overflowing with apples.   .  hill of sweet applesMNv>" w\^!< = has been lost within the darkened wreckage of the tavern. DNy8An untidy heap of apples piled high within the barrel.,MO actorNz-MO actorN|>" }\^!< = has been lost within the darkened wreckage of the tavern. sNgThe faint scent of the barrel wood is overwhelmed by the perfume of the overripe apples it contains. MO actorNMO actorN;>" ;\^!< = has been lost within the darkened wreckage of the tavern. IN;=You poke an apple at random and find its flesh a tad soft. MO actorN <v LN =You decide that you have pilfered enough apples for today. ZN >" FCYou shouldn't overburden yourself with items while in this form. MO actorO selectionN<v@N<vvN!w NvGGG w ##You find a sweet smelling apple. www w SSYou root around the apple barrel and finally come up with a large bruised apple. MMM w ))You pull forth another overripe apple. T   <M  rotten apples rotten apple AAEww, there's nothing left of this apple but a brown mushy mess!y ggFeeling rather a bit masochistic, you decide to snarf the rotten apple. The taste isn't too bad... perhaps a bit like apple cider that has been left out too long. But the texture... oh, that delightful slurpy, squishy texture. You're not certain, but you think there might have been something wriggling around when you were chewing and swallowing... -UMO actorN6A sickly sweet smell of decay reaches your nostrils.MO actorN]GMO actorN(The apple schlurps as you poke at it. w 99Your hand closes around a rotten apple with a squelch. CCCw ''You take a slightly shriveled apple. > > ><M  mottled apples mottled apple ddA middling sized apple with a green curled leaf still attached. Its skin is mottled green and red.y ssYou crunch into the mottled apple. Tangy and crisp, perhaps a few more days would have ripened it to perfection. -BMO actorN3#The apple smells slightly sweet. MO actorN{LMO actorN- The apple is smooth and hard to the touch w JJYou reach deep into the barrel and randomly pull forth a mottled apple. eeeM w ??Feeling around the barrel, you finally grab a bruised apple.   <M  perfectly red apples perfectly red apple <<A perfectly shaped apple, deep red and gleaming in the suny You bite into the gleaming apple and its sweet juices fill your mouth. Crisp and the perfect blend between tanginess and sugary sweetness. You couldn't have done better if you made it yourself. ,MO actorNh-TMO actorN5The apple's pungent scent is quite mouth watering. MO actorNXMO actorN 9The flesh of the apple is smooth and slightly springy. w 22To your delight you find a perfectly red apple.   <Mx  small green apples small green apple 55A hard, little apple still green from stem to skin.y DDYou gnaw at the unripe apple. Its flesh is still hard and bitter. ,MO actorN-\MO actorN=The smell of the apple is very faint as it's not ripe yet. MO actorNi?MO actorN The apple is hard and unripe. 'MO actorN"x)wMN<x" #NYou toss it back. PNDYou reach into the apple barrel and pull out a small green apple.   < bruised apples bruised apple LLThis apple is large and fragrant, but its sides have gone soft and bruisedy You bite into the overripe apple and grimace a bit at how soft it is. Perhaps this one would have been better suited for a sweet cider. ,MO actorN(-MO actorNL`The apple does not even need to be held close for its overwhelmingly sweet aroma to reach you.MO actorNMO actorNq You bruise the apple even further by poking at it. Its skin rips and juice wells up and rolls down its sides. +  < shriveled apples shriveled apple JJWith skin deeply wrinkled, this apple is only a shriveled husk of itselfy KKSurprisingly good, the apple is very sweet if a bit soft for your taste. -MMO actorN.The apple smells heavily of sweet ripeness. MO actorN>TMO actorNb5 The apple feels rough and wrinkled to your touch. +KKK.  tavern's back wall,  the wall MN >" !\^!< = has been lost within the darkened wreckage of the tavern. N#The wall is composed of uneven blocks of drab gray stone. Upon closer inspection tiny specks of color can be seen embedded in its surface. MO actorN]$MO actorN&>" '\^!< = has been lost within the darkened wreckage of the tavern. GN);The surface of the wall is cool and rough to your touch. \J;   tavern signWMN2>" 3\^!< = has been lost within the darkened wreckage of the tavern. N5Although its paint has long faded, you can make out the form of a red rampant dragon on the tavern sign. Or rather a fat, potbellied lizard-thing with itty bitty malformed appendages that were supposed to be wings./MO actorN6.MO actorN8>" 9\^!< = has been lost within the darkened wreckage of the tavern. :N;.The sign creaks every so often in the wind. MO actorNw<~MO actorN>>" ?\^!< = has been lost within the darkened wreckage of the tavern. NA>" NBYou swoop up to the faded wooden sign. Brushing your feathers against it reveals that its surface has been long worn away to smoothness due to the wind, sun, and rain. 3ND'The sign is a bit beyond your reach. e e e.  tavern:MNO>" ^NP\^!< @ is nothing but a twisted pile of darkened timbers and ashes. NRFrom the outside the wayhouse tavern is not impressive as it crouches beside the road. It's a plain rectangular building with drab gray walls of stone and a roof half thatched, half shingled, where the second floor rooms are tucked under the eaves. There's no glaze to the windows, nor any colored tiles to the roof, nor flower gardens gracing the grounds. Nothing out of the ordinary at all. It's your favorite spot in all your demesne. MO actorNoSMO actorNU>" V\^!< = has been lost within the darkened wreckage of the tavern. GNX;The surface of the wall is cool and rough to your touch. -wMO actorN`Z>" `[\^!< = has been lost within the darkened wreckage of the tavern. N`]The outside of the tavern has the faint smell of old wood and muddy ground and quarried stone. The smells to the inside where people are smoking and meat is roasting and drinks are being quaffed are bound to be far more interesting. /MO actorN^.aMO actorN_BThe faint sounds of talk and laughter can be heard from inside. l,,,J  road The road is an unnatural dark streak that wends it way through the surrounding hills and valleys. Although this part of the road is seldom traveled, its magic keeps it pristine and unblemished from the encroaching territories of the surrounding fey. J  forest  From this far away not much can be confirmed about the forest besides its mere existence to the north. However there seems to be something peculiar about the coloring of the trees that even the hazy intervening distance cannot claim. /MO actorN"p.8MO actorNFqThe forest is too far. \J  tavernMNy>" iNzZNothing remains of > has but a twisted pile of darkened timber and ashes. MN|ATo the south lies the tavern, hunched along the long dirt road J  meadow OOThe ground turns a lush green towards the northwest, the edge of the meadows. J  meadow You can sense, at the edges of your lands, the line where your influence ends and the Beast's begins. The Beast presses ever inward but you easily hold your border steady. X.@+*Q*Q*4Mf| herd of proud stags  lordly stag A tall, lithesome stag with coat of creamy pale brown and a tangled crown of antlers that arches several feet above his head. Every line and graceful movement bespeaks of a quiet pride. MDMN D<| N!DN#D< > E <| $DL\nThe stag faces down the shadow dog, rack of antlers menacingly lowered. N&D< > E <|  N'DFOO!2>&ZN*DN\nThe ears and tail of the stag flick gently as he grazes amongst the trees.MO actorNe,DMO actorN.D=The graceful form of the stag comes bounding to your call. N0D>  E> > E >z" E >" YNADIt majestically wheels about, tilts forward its tangled crown of antlers, and charges straight at Val. \b The music of the flute cuts off sharply as the mage adroitly leaps out of the way. The stag pulls up atop a nearby incline and wheels round again, its dark eyes watching the mage's every movement. As Val raises the flute to his lips once again, the stag leaps forward, flower petals breaking free and fluttering through the air around the rapid pound of his hooves. \b Val dives away once again but his cloak flares out, catching on the many grasping tips of the stag's antlers, and he is dragged back several paces before the cloth rips free. Val crouches, breathing slightly hard, eyes locked upon the stag, who wheels about to face him once again. \b "He does not seem to like your music," you call to the mage. \b Val's head tilts back slightly towards you, but his eyes remain upon the deer. "You think so? And here I thought myself a rather good musician," he says and carefully tucks the flute away within his torn cloak. \b The stag's dark expressionless eyes takes this all in. He snorts to himself, flicks his ears towards you, waves his tail like a banner, once, twice, thrice and then bounds off towards the forest to the east. \b "Has no proper ear for music," says Val and his eyes flit over to you. \b "I can't say I was all that impressed myself," you tell the mage. \b "On no?" Val's lips twitch upward. "I shall endeavor to do better next time," he says and then drawing his cloak about him he begins walking towards the north. >"z>>&>&! NED>  E> > E >z" E >" NND\It majestically wheels about, tilts forward its tangled crown of antlers, and charges straight at Val. \b The music of the flute cuts off sharply as the mage adroitly leaps out of the way. The stag pulls up atop a nearby incline and wheels round again, its dark eyes watching the mage's every movement. As Val raises the flute to his lips once again, the stag leaps forward, flower petals breaking free and fluttering through the air around the rapid pound of his hooves. \b Val dives away once again but his cloak flares out, catching on the many grasping tips of the stag's antlers, and he is dragged back several paces before the cloth rips free. Val crouches, breathing slightly hard, eyes locked upon the stag, who wheels about to face him once again. \b With a small shrug, Val carefully tucks the flute away within his torn cloak. The stag snorts to himself, flicks his ears towards you, waves his tail like a banner, once, twice, thrice and then bounds off towards the forest to the east. \b "Has no proper ear for music," says Val and then drawing his cloak about him he begins walking towards the north. >>&"z>>&"NRD>  E >  NWDzIt majestically wheels about, tilts forward its tangled crown of antlers, and charges straight at Val. \b The mage lifts his pale head and the stag stumbles over a roll of sand that emerges suddenly beneath its hooves. The stag heaves itself to its feet, staggers a few strides closer to Val once more, and then plows head first into another dune. The stag's eyes roll wildly as it flails about with its legs, trying to find stable ground that will not shift and change beneath it. Finally it gathers its legs beneath itself and bolts over the dunes, away and to the north. Val has long since returned to his drawings in the sand. >:NZD>  E >  N[DA new shadow takes form within the forest. The stag steps out from beneath the trees and begins nibbling upon the buds along the low growing branches. A bloody lot of good that did.>IN]D>  E >  NaDiFrom out of the red dust a pale form rises, coat of creamy brown with sharp flint hooves and a crown of tangled antlers. The stag tilts forward its head and charges straight towards the chanting Val. For a moment the mind numbing song halts as Val quickly scrambles out of the way and up a nearby hill. \b The stag bounds after him as Val climbs ever higher and then makes the leap to the red arch. The deer circles around beneath the arch as Val once again begins his chant, but the mage is far above his reach. The stag turns towards you, gives a slight shrug of his brown shoulders, and wanders off to the west. >NdD>  E >  NgDIt makes a feint at Val, who merely ducks down into the hole he was digging. \b The stag flicks it ears about and them ables off to the southwest. >NjD> m E >  cNkDJThe deer sniffs at the moist air and begins grazing on the green grass. m>SNnD>  E >  0NqD$From twists of light and shadow the graceful shape of a stag bounds forth. It tilts its tangled crown of antlers towards the mage and charges forward... managing only a few strides before it's slammed backward. \b The stag crashes into the ground and disintegrates into flits of darkness. ,MO actorNGsD-SMO actorNktD4The sharp scent of the woods mixed in with earth. LMO actorNvDNNMO actorNwD/There is no need to attack your own creation.MO actorN<yDMO actorN`{D>" jN`|D[You perch along the stag's shoulder and rifle through his soft brown fur with your beak. BN`~D6The stag nuzzles you as you brush dust off his coat.MO actorN7DNMO actorN[D/You are most certainly not holding the stag. MO actorNDXMO actorND9His cream brown coat is soft and velvety to the touch. TMO actorN1DUMO actorNUD>" RNUDCYou perch within the rack of antlers and desultorily around you. NUD)U#MOactorioNDMOactorioN D>" BN D3"KRAW! KAK KAK KAW COA! " you squawk at the stag.]N DYou ask the stag about ! * who merely stares back at you blankly. #MOactorioNDTMOactorioND0There is no need to attack your own creation. MO actorN[D^OMO actorND0You glance at the stag and decide against it. aMO actorNDbWMO actorND8The stag seems quite capable of finding his own meals.MO actorNUDMO actorNyDrYou howl at the stag. It freezes, ears flicking straight up, until it realizes you are the source of the sound. MO actorNDMOactordobjN4D ?N4D:The stag takes the kisei blossom from your outstretched !> beak hands, crunching it delicately between its flat teeth. The stag has hardly swallowed when it suddenly bucks, half rears, and falls over to its side thrashing. Within a few short moments it is dead. !<> &N4D E> > mN4D:The stag takes the kisei blossom from your outstretched !> beak hands, crunching it delicately between its flat teeth. The stag has hardly swallowed when it suddenly bucks, half rears, and falls over to its side thrashing. Within a few short moments it is dead. \b Val watches on expressionlessly.N4D!<> >&N4D" CN4DThe stag delicately takes !< . !&N4D>" PN4DAThe stag nuzzles your hand but otherwise ignores the offering. -N4D!The stag ignores the offering. MO actorN"DMOactordobjN;"D1" QN;"D0The stag's ears prick forward as he stares at ! . 5N;"D)The stag sniffs idly at your offering. MO actorN"DMO actorN#DYou wrap your !> wings arms8 around the stag's neck and give it a gentle squeeze. /MO actorN#D.zMO actorN#D[The soft whuffle of the stag's breathing and the soft click of its hooves against stone. MO actorNK$D<MO actorNo$DHe already belongs to you. MO actorN$DMO actorN$D>" /N$D You coo lovingly at the stag. ;N$D/"COA COA COA!" you coo lovingly at the stag. MO actorNj%DMO actorN%D>" 3N%D$You squawk at the befuddled stag. :N%D."KRAK KAK KAK COA!" you squawk at the stag. MO actorN&&D4MO actorNJ&DHe's already awake! MO actorN&D!PMO actorN&D1You decide that it would be a waste of effort. MO actorN&DwMO actorN"'DXYou poke the soft coat of the stag. It lowers its head and pokes back with its horns. VO actorN'DWO actorN'D>" gN'DXYou land upon the stag's withers and give it a good, gentle scratch with your talons. NN'DBYou scratch the stag beneath its chin as it snorts in pleasure. MO actorN(DMO actorN(D6You lean forward and give the surprised stag a good !> peck smooch on its muzzle. MO actorNW)D<MO actorN{)DHe already belongs to you. MO actorN)DFMO actorN)D'Now is not the proper time for that. 5476_^de}~"#h i %%\nA graceful stag bounds into view.,)'  Fountain \(The Fountain\)+ HHThe tang of sweet water is in the air, a very lightness to the scent. * ;;The soft whir and tinkle of falling water fills the air. MN,\b A slender plume of water bubbles from the earth and cascades many lengths into the sky. Sunlight glimmers on the droplets and a myriad of rainbows flicker through the faint mist that hangs in the air.\b N,>  aN,UA long slender ditch has been digged underneath one of the fountain's many rainbowsN,>|" N,A large uneven hole opens directly into your treasure room below. The largest of the fountain's rainbows plunges giddily deep within. N,Beyond your borders to the north and east lies empty land and to the west a further glint of water can be seen. A red arc of rock stands to the distant south, through which the sculpted red hills rise. \bOMN,>vg" N,The red arch looms ever larger as you approach it, nearly entirely blocked by a tumble of red stones. You give a slight shrug and phaze through the rock and into the surrounding red hills. N,The red arch looms ever larger as you approach it. You tilt your head up as you pass under it and the large span of rock many lengths above your head glitters with a sprinkling of crystals in the sun. \bWVuN You hesitate for one moment and then grimly cross over your boundary. With the first movement you felt the wrongness... as if the earth itself was shrieking in ire. It was shrieking... something shrieking... someone shrieking... The air around you jellifies... something tearing...\b \t raw ragged...\b \t ripping...\b \t tearing...\b The Tree laughs. "You must be mad, coming over here," it says and you are pushed back to your side.U  Uninhabited fields and trees stretch out before you. Undoubtedly there are animals and humans who live somewhere on this land, but no fey has possessed it for many years. You've been steadily pressing your influence upon it, in a contest between you and the other surrounding fey.QmSOMN,7You drift down through the earth and into darkness.\bR {{You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.MO actorNc ->  Nc -q\bYou stumble across Val digging away knee deep within a large hole that lies in the shadow of the fountain. \b)Nc -)  MO quipnoNO -K4NO -Are you digging for gold?:NO -!Are you digging your own grave? NO -'What in the nine hells are you doing?NO -3Oh very well, keep your plots to yourself then...NO -(But why are you digging a hole?cNO -#Are you purposely being annoying?30E~MO quipnoN -KN -H\b"Are you digging for gold?" you ask as you wander up to the edge of the ditch that Val is so assiduously working upon.\b "You know what they say about rainbows," Val replies and points behind him to the edge of the rainbow that disappears within the hole. "But nay, I am looking for something far more precious than gold,"\bfN -\b"Are you digging your own grave?" you ask as you stand upon the lip of the ditch that the mage works so assiduously upon. \bVal glances up at you and wipes away a streak of dirt from his forehead. "Hopefully not," is all he says in reply. \b>##!N -\b"What in the nine hells are you doing?" you ask the mage as you wander up next to the widening ditch.\b "Digging a hole," says Val with a impish grin. "I rather thought that was obvious."\bN -N -\b"Oh very well," you huff. "Keep your bloody plots to yourself then," you say and wander off a few steps. You hear the mage laugh softly behind you as the sound of shoveling earth continues. \bN "-\b"But why are you digging a hole?" you ask, somewhat annoyed by the damage the mage is inflicting upon your lands. And of all the places to choose to dig!\b "I am looking for something..." Val replies. "Something I lost... a long time ago."\b "And you think it's buried here?" you ask, your eyes narrowing. "Possibly, you never know until you try," says Val as he resumes his digging. \bN $-\b"Are you purposely being so irksome?" you ask in exasperation and then blink down in surprise as the mage bursts into laughter. \b "Pleased to meet you, kettle," Val says. \b0G3-NNN.  forestMN!> j j j *.  willow Pale gray and deeply wrinkled, the trunk of the white willow splits into many ascending branches that form a crown high above the forest floor.MN<   lounging in offYVMN>You drop out of the tree to land gracefully on your feet. \bSVMN>You drop out of the tree to land gracefully on your feet. \bOTMN>" NYou drop out of the tree to land gracefully on your feet. Padding out of the forest, you return to the remains of the tavern to the south.\bNYou drop out of the tree to land gracefully on your feet. Padding out of the forest, you return to the waiting tavern to the south.\bW 99That would require you to stop lounging in the tree. \bV 99That would require you to stop lounging in the tree. \bNMNYou drop out of the tree to land gracefully on your feet. Wandering northward, you follow the glint of water that lies ahead . The trees fall away as the ground begins to gently slope downwards. \bmUVMN>You drop out of the tree to land gracefully on your feet. \bTVMN>You drop out of the tree to land gracefully on your feet. \bPMN You drop out of the tree to land gracefully on your feet. As you travel east, the green of growing things gives way to barren red earth. Smooth curved hills rise all around you as you pass underneath an arch of red rock. \bQwMN _You slip out of the trees and into a low-lying meadow that stretches far into the horizon.\bR {{You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.MO actorN/ MO actorNS >" wNS ^You shimmy up the white willow until you reach a suitable crook in the trunk for resting. \b>XNS BWith a flutter of feathers you perch upon a pale willow limb. \b>EFL " " *.   birch tree UUA slender tree with striated white bark and branches that dip gently at their ends.MN"<   resting in offYVMN$>You drop out of the tree to land gracefully on your feet. \bSVMN%>You drop out of the tree to land gracefully on your feet. \bONMN'>" N(You drop out of the tree to land gracefully on your feet. Padding out of the forest, you return to the remains of the tavern to the south.\bN*You drop out of the tree to land gracefully on your feet. Padding out of the forest, you return to the waiting to the south.\bW 88That would require you to stop resting in the tree. \bV 88That would require you to stop resting in the tree. \bNMN-You drop out of the tree to land gracefully on your feet. Wandering northward, you follow the glint of water that lies ahead . The trees fall away as the ground begins to gently slope downwards. \bmUVMN.>You drop out of the tree to land gracefully on your feet. \bTVMN/>You drop out of the tree to land gracefully on your feet. \bPMN0You drop out of the tree to land gracefully on your feet. As you travel east, the green of growing things gives way to barren red earth. Smooth curved hills rise all around you as you pass underneath an arch of red rock. \bQwMN1_You slip out of the trees and into a low-lying meadow that stretches far into the horizon.\bR {{You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.MO actorN4MO actorN 6>" iN 7PYou grab a low lying branch and haul yourself up into the white birch tree. \b>cN 9MWith a flutter of feathers you perch within the a lowlying birch branch. \b>O actorN :yO actorN- ;PYou grab a low lying branch and haul yourself up into the white birch tree. \b>BCEFLN `   .  forest of trees BB Unnaturally pale with petaled flowers too colorful to be real. MO actorNMO actorNcSmoothly soft birches, rough and ragged willows, and weeping ones that are somewhere in between. -IMO actorN,*The trees smell of living wood and sap. /MO actorN{.NMO actorN/The trees whisper their secrets to the wind. MO actorNMO actorN^You shimmy up the white willow until you reach a suitable crook in the trunk for resting. \b>MO actorNMO actorN>  N If the warded sutras remain beyond your reach than the trees that they are attached to can be dealt with instead, you reason to yourself. And so you call out to your creations and command the trees to destroy themselves. And with shudders and groans they comply, first one tree than another wrenching its pale roots free from the stony ground to come crashing down to the accompaniment of grinding wood and breaking branches. The trees claw and tear at their neighbors as they list from side to side before succumbing to the inevitable fall. \b Val stands wide-eyed in the middle of a new and vast clearing, his sutras long buried underneath a mass of timbers and splinters. "Good lords, that was a bit of an overeaction, wasn't it?" he says. "I rather liked this woods." \b !>D>You squawk angrily as you perch atop a newly fallen trunk.\b"Now you say that?" you exclaim as you scramble atop a newly fallen trunk. \b "There's an old wives tale about the folly of using a woodaxe to slice a piece of parchment... yet this is the time I've seen a woods destroyed to be rid of a parchment. " says Val. !>\I'd best be off"I think we should be off before the fey decides to set the entire forest on fire to be certain the sutras are gone." And so edging around the fallen trees. Val strides off to the east. \b As soon as the mage is out of sight, the trees begin to sway and drunkenly drag themselves upright once again. Although they look a lot more crooked and sickly than they had once before. Oh well, you'll have enough time to work with them once you're done playing with the mage. N>!!>&8N,Destroy your precious trees? I think not! LN  Z "Z "Z *.  weeping willow The weeping willows are the smallest of the trees in the forest and this one standing before you is no exception. Its trailing branches are widely spread, creating a minature waterfall of translucent leaves. MNI<  precariously balanced in offYVMNK>You drop out of the tree to land gracefully on your feet. \bSVMNL>You drop out of the tree to land gracefully on your feet. \bONMNN>" NOYou drop out of the tree to land gracefully on your feet. Padding out of the forest, you return to the remains of the tavern to the south.\bNQYou drop out of the tree to land gracefully on your feet. Padding out of the forest, you return to the waiting to the south.\bW 88That would require you to stop resting in the tree. \bV 88That would require you to stop resting in the tree. \bNMNTYou drop out of the tree to land gracefully on your feet. Wandering northward, you follow the glint of water that lies ahead . The trees fall away as the ground begins to gently slope downwards. \bmUVMNU>You drop out of the tree to land gracefully on your feet. \bTVMNV>You drop out of the tree to land gracefully on your feet. \bPMNWYou drop out of the tree to land gracefully on your feet. As you travel east, the green of growing things gives way to barren red earth. Smooth curved hills rise all around you as you pass underneath an arch of red rock. \bQwMNX_You slip out of the trees and into a low-lying meadow that stretches far into the horizon.\bR {{You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.MO actorN} [FMO actorN ]>" N ^You duck underneath the canopy of leaves and manage to scramble a little ways up the weeping willow. These branches were not made for climbing. \b>tN `^With a flutter of feathers you perch within along a slender branch of the weeping willow. \b>BCEFLN < " " *.  oak A juvenile white oak tree with wide spreading limbs, little larger than the willows that surround it. Its trunk and leaf coloring is paler than usual but it still stands out amongst the albino willows and birches. A scattering of young acorns can be seen amongst the oak's branches.MNq<  lounging within offYVMNs>You drop out of the tree to land gracefully on your feet. \bSVMNt>You drop out of the tree to land gracefully on your feet. \bONMNv>" NwYou drop out of the tree to land gracefully on your feet. Padding out of the forest, you return to the remaind of the tavern to the south.\bNyYou drop out of the tree to land gracefully on your feet. Padding out of the forest, you return to the waiting to the south.\bW 88That would require you to stop resting in the tree. \bV 88That would require you to stop resting in the tree. \bNMN|You drop out of the tree to land gracefully on your feet. Wandering northward, you follow the glint of water that lies ahead . The trees fall away as the ground begins to gently slope downwards. \bmUVMN}>You drop out of the tree to land gracefully on your feet. \bTVMN~>You drop out of the tree to land gracefully on your feet. \bPMNYou drop out of the tree to land gracefully on your feet. As you travel east, the green of growing things gives way to barren red earth. Smooth curved hills rise all around you as you pass underneath an arch of red rock. \bQwMN_You slip out of the trees and into a low-lying meadow that stretches far into the horizon.\bR {{You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.MO actorN tMO actorN >" N While the oaks sturdy limbs grow high out of reach from the ground, its trunk is roughly furrowed and easy to climb. You make your way up the tree and find a comfortable perch high atop its crown. \b>mN WWith a flutter of feathers you perch within the a sturdy branch high atop the oak. \b>BCEFLN .   birch trunk 55The birch tree trunks are all white striated bark. MO actorNoMO actorNWThe wood of the tree is slightly soft. Small white strips of bark peel off unto your !> talon tips fingertips. -IMO actorN@*The trees smell of living wood and sap. >>>.  willow trunk DDThe trunks of the willow trees are pale gray and deeply fissured. MO actorNMO actorNOThe wood of the tree is extremely rough to your touch and flakes off on your !> hands  feathers. lll.  weeping willow trunk ddThe weeping willow trunks are rough with many shallow ridges and their bark is unnaturally white. MO actorNOMO actorN0The wood of the tree is coarse to your touch. -IMO actorN *The trees smell of living wood and sap. .   oak trunk The trunk of the white oak is the palest of beige colors, almost as white as its name implies. The bark is scaled with many deep fissures and split ridges. MO actorNOMO actorN0The wood of the tree is coarse to your touch. -IMO actorNO*The trees smell of living wood and sap. ,  .  tangle of willow branches \\The branches of the willow trees contort and twist around each other high above your head.MO actorNGMO actorN(They are currently out of your reach. -IMO actorN*The trees smell of living wood and sap. MO actorNd`MO actorNAYou'll have to climb higher in the tree to reach its branches. <  . D tangle of willow branches \\The branches of the willow trees contort and twist around each other high above your head.MO actorNMO actorN1The twigs of the tree flex easily beneath your !> claws  fingers< and are surprisingly soft compared to the furrowed bark. -IMO actorN*The trees smell of living wood and sap. mMO actorN>" FCYou shouldn't overburden yourself with items while in this form. tMO actorOGxNW'You snap off a twig of white willow. NWZNW&  MD  twig of white willow twigs of white willow CC A twig of white willow with several pale leaves still attached. MO actorN$MO actorN&1The twigs of the tree flex easily beneath your !> claws  fingers< and are surprisingly soft compared to the furrowed bark. -IMO actorN(*The trees smell of living wood and sap. +> > >.  spray of birch branches //The birch branches are slender and knotfree. MO actorNu2aMO actorN4BThe twigs of the birch tree are soft and seem easily breakable. -IMO actorN6*The trees smell of living wood and sap. mMO actorNO7>" FCYou shouldn't overburden yourself with items while in this form. yMO actorOxN:,The birch branch breaks free with a snap. N;ZN<&  5MD  broken birch branches broken birch branch 44 A long birch branch that ends in a ragged break. MO actorNGMO actorNI9The birch tree branch is soft and pliable beneath your !> claws  fingers.-IMO actorNCK*The trees smell of living wood and sap. +  .  $$drapery of weeping willow branches LLThe branches of the weeping willow gracefully dangle to the forest floor. MO actorNVMO actorNX8The weeping willow branches seem fragile beneath your !> talon tips fingertips. -IMO actorNOZ*The trees smell of living wood and sap. mMO actorN[>" FCYou shouldn't overburden yourself with items while in this form. vMO actorOxN!^)You pull down a weeping willow branch. N!_ZN!`&  5MD  !!single branch of weeping willow ##single branches of weeping willow == A thin, sinuous branch that trails long leaves behind it. MO actorNlXMO actorNn9The weeping willow branch seems fragile in your grasp. -IMO actorN<p*The trees smell of living wood and sap. +T  .  crown of white oak branches A thick cluster of heavy branches growing high along the trees crown. They extend outwards above the tops of the neighboring trees. Nestled along some of the branches are spouts of little green acorns. MO actorNzYMO actorN:|:The oak branches are tough and hard beneath your touch. -IMO actorN~*The trees smell of living wood and sap. mMO actorN>" FCYou shouldn't overburden yourself with items while in this form. MO actorO[xNkgYou shake an oak branch back and forth and with some effort manage to snap it off clean at its base. NkZNk&  5M   oak branch oak branches A thick oak branch high as your shoulder and with a good weight to it. Bereft of its leaves it would make a good quarterstaff or walking stick. MO actorN2MO actorNStout and tough. -IMO actorN;*The staff smell of living wood and sap. +  .  living birch leaves, the birch leaves The leaves of the birch trees are toothed and triangular, the size of a man's palm and touched with only the slightest hint of green.MO actorN5MO actorNFluttery and bumpy. -IMO actorN@*The trees smell of living wood and sap. mMO actorN>" FCYou shouldn't overburden yourself with items while in this form. zMO actorOxN-You pluck a single birch leaf from a tree. NZN&n n n5MD   birch leaf birch leaves jj A single triangular leaf, the size of a man's palm, and touched with only the slightest hint of green. MO actorN5MO actorNFluttery and bumpy. -IMO actorN*The leaf smells of living wood and sap. +  .  growing willow leaves, the growing willow leaves XXThe willow leaves are long and slender with pale silvery hairs along their undersides.MO actorNbMO actorNCThe leaf feels silky and almost insubstantial within your grasp. -IMO actorNI*The trees smell of living wood and sap. mMO actorN>" FCYou shouldn't overburden yourself with items while in this form. MO actorO xNHYou scurry up a willow tree and return with a single leaf as a prize. NZN&  5MD   willow leaf willow leaves ss A slender leaf with pale silvery hairs along its undersides. A single bead of sap wells up from its broken stem.MO actorNRMO actorN3The leaf is a soft feathery thing in your grasp. -IMO actorND*The leaf smells of living wood and sap. +0 0 0.   dangling weeping willow leaves, $$the dangling weeping willow leaves The leaves of the weeping willow are exceedingly long as they trail against the ground. They lack even the pretense of color with the willow's unnaturally white branches and bark spied easily through them.MO actorNF_MO actorNj@The feel of the weeping willow leaf against you is ephemeral. -IMO actorN*The trees smell of living wood and sap. mMO actorN>" FCYou shouldn't overburden yourself with items while in this form. MO actorOxNOYou carefully snap off a weeping willow leaf that nearly touches the ground. NZN&  5MD  a narrow weeping willow leaf weeping willow leaves :: A simple leaf, long and elegant. And utterly colorless.MO actorN_MO actorN@The feel of the weeping willow leaf against you is ephemeral. -IMO actorN1*The leaf smells of living wood and sap. +0  .   oak leaves, the oak leaves ssThe oak leaves are palely tinted green with white undersides. The grow thickly along the tops of the oaken trees.MO actorNsMO actorN*The leaf is thick and waxy between your !>talons  fingers. -IMO actorN_*The trees smell of living wood and sap. mMO actorN>" FCYou shouldn't overburden yourself with items while in this form. MO actorO!xN1XIts quite a trek up the trunk of the willow before you reach the first row of leaves. N1ZN1&,  5MD  oak leaf  oak leaves The leaf is long as your hand, palely tinted green with white undersides. It has nine wavy lobes with rounded tips, widest along the leaf's middle where the longest lobes grow.MO actorN(sMO actorN**The leaf is thick and waxy between your !>talons  fingers. -IMO actorN,*The leaf smells of living wood and sap. +4  .  cluster of acorns A cluster of young acorns nestled within the branches of the oak tree. They are tiny and immature, still green with soft shells. It will be several moons yet before they are ready to ripen. MO actorN6VMO actorN$87The acorns are still soft and flexible to the touch. -DMO actorN:%The acorns smell of growing green. mMO actorN;>" FCYou shouldn't overburden yourself with items while in this form. MO actorO=xNM>IWith a twist of the wrist you manage to yank free a small green acorn. NM?ZNM@&8<M small green acorn acornsy MMChewy and still bitter, it lacks the full nutty flavor of a ripened acorn. MNK<|! NL|A small unripe acorn, green and soft, and no larger than a fingernail. When you shake it something rattles around inside. aNNUThe remains of a small green acorn. Nothing much is left but a hollowed out shell. MO actorNO|MO actorNQ]The young acorn is still soft to the touch, its skin having not yet hardened into a shell. -KMO actorNES,The acorn smells of green growing things. +MO actorNVMO actorNXYou give the young acorn an experimental shake. Something small can be heard rattling around inside. How odd... the acorn is no where near mature enough to have formed a nut. /.HMO actorOxN[Carefully you peel back the still thin skin of the acorn and pop its top off. A pair of white wings burst free of the opened acorn. The pale moth carefully shakes itself, pumps its wings experimentally, and then flutters into the air around you. N\ZN]> &8  6M  lunar moths  luna moth A pale white moth of middling size and average appearance except for the pair of matching black crescent moons upon its front wings. Its unadorned back wings trail back into elegant little swirls. MO actorNgMO actorN6iKA soft wisp of silk that leaves a trace of fine white powder across your !> feathers.  fingers.  -uMO actorNjVYou smell nothing on the lunar moth, although doing so makes you sneeze repeatedly. +yMNlBeautiful but highly poisonous. Not that it would matter much to you. The moth struggles valiantly as you pop it into your mouth. !<&  .  rain of petals 88A gentle rain of falling petals drifts to the ground. MO actorNux6MO actorNzSilken and fleeting. -QMO actorN|2... a shadowy sweetness. Faint and unplaceable. /MO actorN,}.FMO actorNP~'The petals are silent in their fall. mMO actorN>" FCYou shouldn't overburden yourself with items while in this form. rMO actorOxN%A petal lands upon your open hand. NZN&  <MD  loose petals  loose petal CCA lost petal that has wandered away from the rest of the flower. MO actorN1MO actorNA wisp of silk. -QMO actorN2... a shadowy sweetness. Faint and unplaceable. +y **Delicious! And hopefully not poisonous.   .:   treeflowers, the treeflowers Along the tree branches grow clusters of many petaled flowers in blues and reds, greens and yellows, purples and whites. And in the heart of each flower lies a tightly closed bud. MO actorN oMO actorN-PThe flowers are silken except for a strangely hard lump within their centers. -QMO actorN2... a shadowy sweetness. Faint and unplaceable. MO actorNMO actorNIt's taken so long to perfect these trees, it seems a shame to pluck all the blossoms off of them. Perhaps if you were just to choose one... +MO actorN3MO actorNpThere appears to be something in the heart of the flowers. Perhaps, if you were to look at one in particular?   L:MD  blue treeflower **You tuck the blue flower behind your ear You pull off the blue flowerMN:A blue petaled flower, the color of a summer morning skyN<" N. FN:. In the heart of the flower lies a tightly closed bud. MO actorN]MO actorNThe flower is N<" 6N'completely silky beneath your touch. IN=silken except for a strangely hard lump within its center. -QMO actorNC2... a shadowy sweetness. Faint and unplaceable. 0  "5M  sapphire ttA sapphire, stone of darkest blue found within a blue treeflower. It has been shaped into the form of a teardrop.  BBYou discover a sapphire nestled within the bud of the treeflowerMO actorNUMO actorN!6The faceted jewel is smooth and hard to your touch. -GMO actorN|(It smells faintly of flowers and sap.   L:MD  red treeflower ))You tuck the red flower behind your ear You pull off the red flowerMN8A red petaled flower, the color of the horizon at dawnN<" N. FN:. In the heart of the flower lies a tightly closed bud. MO actorNXMO actorN|The flower is N|<" 6N|'completely silky beneath your touch. IN|=silken except for a strangely hard lump within its center. -FMO actorN>'A fiery scent, pungent and powerful. 0  "5M ruby kkA ruby, stone of deepest red found within a red treeflower. It has been shaped into the form of a heart.  >>You discover a ruby nestled within the bud of the treeflowerMO actorNUMO actorN6The faceted jewel is smooth and hard to your touch. -GMO actorNk(It smells faintly of flowers and sap.   L:MD  white treeflower ::You plop the white flower behind your earatop your head.  You shake off the white flowerMN9A white petaled flower, the color of pure undriven snowN<" N. FN:. In the heart of the flower lies a tightly closed bud. MO actorNoMO actorNThe flower is N<" 6N'completely silky beneath your touch. IN=silken except for a strangely hard lump within its center. -^MO actorHA gentle scent that remains with you even when the flower is lowered. 0H  "5M  diamond A diamond, stone of glittering transparency found within a white treeflower. It's form is the one sharing it's name... a diamond.  AAYou discover a diamond nestled within the bud of the treeflowerMO actorN )UMO actorN/+6The faceted jewel is smooth and hard to your touch. -GMO actorN-(It smells faintly of flowers and sap. @  L:MD  ,,You tuck the yellow flower behind your ear  You pull off the yellow flower yellow treeflowerMN:;A yellow petaled flower, the color of the fully risen sunN;<" N<. FN>:. In the heart of the flower lies a tightly closed bud. MO actorNd?MO actorNAThe flower is NB<" 6NC'completely silky beneath your touch. INE=silken except for a strangely hard lump within its center. -MO actorNJGbA smell that reminds you of summer and wild buttercups and dandylions growing along the fields. 0  "5M topaz qqA topaz, stone of brightest yellow found within a yellow treeflower. It has been shaped into a faceted sphere.  ??You discover a topaz nestled within the bud of the treeflowerMO actorNTUMO actorNV6The faceted jewel is smooth and hard to your touch. -GMO actorNsX(It smells faintly of flowers and sap.   L:MD  ,,You plop the green flower atop your head.  You shake off the blueflower green treeflowerMNe8A green petaled flower, the color of newly grown grassNf<" Ng. FNi:. In the heart of the flower lies a tightly closed bud. MO actorN^jMO actorNlThe flower is Nm<" 6Nn'completely silky beneath your touch. INp=silken except for a strangely hard lump within its center. -JMO actorNDq+A fresh scent that fills you with vigor. 0L  "5M  emerald,  an emerald uuA emerald, stone of darkest green found within a green treeflower. It has been shaped into the form of a triangle.  BBYou discover an emerald nestled within the bud of the treeflowerMO actorNUMO actorN36The faceted jewel is smooth and hard to your touch. -GMO actorN(It smells faintly of flowers and sap.    L:MD  ..You twist the purple flower into your hair.  --You pull the purple flower from your hair.  purple treeflowerMNAA purple petaled flower, the color of the final moments of duskN<" N. FN:. In the heart of the flower lies a tightly closed bud. MO actorNyMO actorNThe flower is N<" 6N'completely silky beneath your touch. IN=silken except for a strangely hard lump within its center. -BMO actorN_#A spicy scent, sharp and exotic. 0P  "5M  amethyst,  an amethyst yyAn amethyst, stone of flawless purple found within a purple treeflower. It has been shaped into the form of a nonagon.  BBYou discover a sapphire nestled within the bud of the treeflowerMO actorNUMO actorN96The faceted jewel is smooth and hard to your touch. -GMO actorN(It smells faintly of flowers and sap. p///J  sun,  the sunMNUShafts of sunlight lance through the trees but the sun itself is hidden from view. N> > E >q" `NT"Tis dangerous to stare at the sun like that," Val says he gazes at you sideways. "qJ  glint of water OOOnly the faintest sparkle of sunlight on water can be seen at this distance. T  J   red hills, the red hillsMN"vgWNHIn the distance an irregular tumble of red stone can be faintly seen. rNfIn the distance a rise of red hills can faintly be seen through the irregular shape of a rock arch. /MO actorN-.=MO actorNQThe hills are too far away. oMO actorNpXMO actorN>vg" NYou glare are the chaotic tumble of stones and it trembles, slowly sinking into the rocky ground, as the far off hills quietly lengthen, stretching outwards arms of earth and stone until they are perfectly curved and smooth once again. !vg.N"The hills are fine as they are. lllJ\  red rock arch HHA tall arch of red stone, its shape and form are naturally irregular. ~~You gaze through the red rock arch and something flashes back at you... something reflective catching the light of the sun. /MO actorN .;MO actorN.The arch is too far away. qqqJ  canopy ??A twining lacework of living branches arches high above you. J  sky,  the sky UUYou can see bits and pieces of the sky through the lacework of branches above you.    /.  pebbled groundMNTree roots sink into a ground covered with gleaming pebbles of onyx and turquoise. In between, patches of bare ground are a rich dark brown. N<m" SNG\b A mound of displaced pebbles and earth marks the mouth of a hole. 1MO actorNC0MO actorNg]NgNYou carefully dig through the roots and stone but find nothing of interest. [Ng8You carefully dig through the roots and stone to find !."mmyMO actorNYzMO actorN} <m" cN} NYou smooth over the stone and earth until the ground is pristine once more. !m7N} +There are no holes to be filled in here. >MO actorN@ ?kMOactordobjNd You bury ! ! amongst the stones and roots. &MO quipnoNKN)Merely a traveler passing through, huh?xNWhat is your purpose here?ON$So how does it feel, being a mage?o(MO quipnoNKN\b"Merely a traveler passing through, huh?" you say to Val. "Aye," replies the mage. "Fully the truth if not exactly the full truth."AN\b"What is your purpose here?" you demand of the mage. \b "A treasure hunt, of course," replies Val. "The same reason as everyone else."zN\b"So how does it feel being a mage?" you ask in fascination. \b "How does it feel" Val echoes. "It... gives you great power and a great burdern of responsibility. An awareness of the good and the bad and... a loneliness, I suppose. You are no longer the same as everyone else. @>A?MO actorN$qMO actorN%&RBeneath the piles of hard little pebbles the bare ground is thick and springy. -ZMO actorN(;The ground smells of moist earth and decomposing leaves. mMO actorN)>" FCYou shouldn't overburden yourself with items while in this form. UMO actorOo  selectionN ,<n@N -n$E.  groundyMO actorN1<zMO actorNU>>m" ZNU?FYou smooth over the pebbles until the ground is pristine once more. !m8.  smattering of onyx 99The onyx gleams faintly in the scattered forest light. MO actorNzQMO actorN2The onyx is cool and smooth beneath your touch. mMO actorN>" FCYou shouldn't overburden yourself with items while in this form. MO actorOhxNx=You carefully select a bit of onyx from amongst the piles. NxZNx&CCC.  scattering of turquoise Turquoise is such a lovely color, isn't it? Neither blue nor green, but something in between, supposedly the same color as the Summer Seas. MO actorNwUMO actorNy6The stones are rough and ragged beneath your touch. mMO actorNSz>" FCYou shouldn't overburden yourself with items while in this form. zMO actorOxN}-You casually pick up a piece of turquoise. N~ZN&N N N5M  turquoise pebbles ragged piece of turquoise bbAn irregular fragment of turquoise, mottled blue-green and gold, about the size of a thumbnail. MO actorNKRMO actorNM3 The stone is rough and ragged beneath your touch+MO actorNEOMO actorNiQ> m NiRYou toss the pebble into the lake. It skips across for a few paces, each little jump leaving behind perfect concentric circles in its wake, before vanishing under the water without a sound. <&NiS>  NiTYou toss the pebble away without a thought. It plinks against an expanse of colored glass within the trees, and luckily falls away without a scrape nor scratch. NiV)\  5M  onyx pebbles smooth bit of onyx **A smooth scrap of onyx, flawless black. MO actorNbQMO actorNd2The onyx is cool and smooth beneath your touch. +MO actorNfMO actorN$h> m N$iYou toss the smooth bit of onyx into the lake. It skips across for a few paces, each little jump leaving behind perfect concentric circles in its wake, before vanishing under the water without a sound. <&N$j>  N$kYou toss the piece of onyx away without a thought. It plinks against an expanse of colored glass within the trees, and luckily falls away without a scrape nor scratch. N$m)8   ./  ground,  the groundMNIn amongst the grasses...hyacinths, pansies, and tulips, black dahlias, thornless roses, and nine varieties of lilies, moonflowers, rainrims, and silver tipped speckles. Flowers that had no right to be growing together, in this season, or any season at all.N<m" _NP\b A gash of dark brown amongst the greenery marks the mouth of a small hole. cN<g" QNECracks, clefts, and upheavals of land pockmark the landscape, greenery and grasses tossed all askew by the recent earthquake. Hyacinths, pansies, and tulips, black dahlias, thornless roses, and nine varieties of lilies, moonflowers, rainrims, and silver tipped speckles... all of them look a bit more bedraggled than usual.1MO actorN.0MO actorNRhNRYYou carefully dig through the matte of flowers and grass but find nothing of interest. fNRCYou carefully dig through the matte of flowers and grass to find !."mmoMO actorNZp9MO actorN~<g" N~You concentrate on the land before you and it smooths over once again, cracks closing in upon themselves, grasses spreading across the dark upheaved earth, every petal and stem placing itself just so...!g.N~"The meadow is perfect as it is. yMO actorNzMO actorN <m" eN PYou push grass and greenery back into the hole until it filled in once again. !m7N +There are no holes to be filled in here. MO quipnoNK}N'Merely something I stumbled across...bNHow did you know of it?<NI made it up...MO quipnoN|KN|\b"Merely something I stumbled across," you reply airily.\b "Is that so?" replies Val as his unfathomable gaze rests on you once again. N|\b"How did you know of it?" you turn the question on the mage. "I am well read and well researched," he replies with a grin. "And as for you...?"N|N|\b"Oh, I simply made it up," you say airily. "So a place like that truly exists?"\b"Aye, it once did" Val replies. "So you made it up, did you? You seem quite adept at that... making things. A>MO actorNA ?lMOactordobjNe ! You bury ! " amongst the flowers and grass. &MO actorN "nMO actorN $OThe grass and leaves are prickly, the flower petals soft beneath your touch. -uMO actorNo &VA wild cacophony of a perfume, each flower warring to carry its scent above others. @>A?P_ summon0MOactorobjseqnoN'[" MOactorprepiobjO ]loN{[ N{[M ! #N{[M!N{[G .PGJ|///_ foo "Foo!" you say and the world around you ripples and bends. Apparently you have touched upon a word that holds together the foundation of this place, a word never meant to ever be said. You wonder exactly how this word came into your mind. .PGJ|H_ curseMO actorN&b>" 2N&b#"KAWK!" you curse. "KAK KAK COA!"KN&b>  E >" E >" N&bYou begin cursing up a blue storm. Several of the tavern patrons glance at you warily.\b "What bug crawled up his arse?" mutters !>F7. \b "Maybe he had some of that there stew," replies !>5 "Half hour after I'd eat it, I'd be cursin' too. " N&b> > E >" E >  E >  sN&bAYou draw in a deep breath and begin to rant upon a slew of the worst curses imaginable. "May a pox eat away at your skin and leave your eyeballs boiling in their sockets, may your gonads wither away to dust and be baked within the pies of harpies, may a blight fall upon your-- fall upon your--"\b "...nether regions?" !> supplies helpfully.[N&b> > E >  N&bYou curse inwardly. Virulently but inwardly. You'd you'd quite love to rain down some curses outwardly upon the meddling mage's pale head, if you could simply move your !> beak lips...WN&bKYou mutter imprecations under your breath as the day darkens around you. . a|_ xyzzysMO actorN&Aa>  N&BaC.N&Da"That's your name, guard it well!.PGJ|eee_ plover ;;You gaze towards the heavens but no birds meet your eyes.L_ defend againstMO actorN7bJYou draw forth your power and the world around you ripples into shields N7b> > E >  N7b between you and Val. Alas, these shields do not block out the piping trills of Val's flute which keep you paralyzed in place. N7b>  E >" "N7b.>N7b> >  %N7b.>  N7b. .! a|x2jjj_ listen)MO actorN'c> *./. axiii_ smell)MO actorN&c> +.,- axH_ burnO actorMN#d`You smolder with hidden power. Hopefully its only power and you haven't managed to light your !> cloak  feathers on fire again. .!YZ axPx2X_ growlMO actorN&e>5" 2N&e#That would reveal your presence. N&e> > E >  cN&eTYou growl low in your throat at the pale haired mage who has you frozen in place. N&e>" E >  E >" N&e3You suddenly let loose with a ferocious growl. \^!>? glances at you in some worry. \b "That reminds me--" begins !>!. \b "That reminds me," !>F cuts in. "About the tale of the monstrous dog Barghest made of the shadows of death itself. Anyone who had the misfortune of stumbling upon it would be dead before the sunset of the third day."\b \^!> sniffs, his thunder stolen. N&e> > E >" E >  E >  DN&e5You growl low in your throat. Val eyes you warily. N&e>" CN&e4You try to growl but all that comes up is a "COA!"@N&e>" ,N&e You growl low in your throat. . axHHH_ gasp MO actorN%lf>5" 2N%mf#That would reveal your presence. N%nf> > E >  zN%ofFOnly the faintest of gasps manages to make its way past your frozen !> beak lips. N%pf>  E >" N%qf?You draw in a deep breath and release it in a sudden gasp. \^!> tilts her head towards you in curiosity. \b "That old scoundrel didn't pinch your rump, did he?" she asks. "He's been doing the same to everyone all day." N%tf> > E >  E >  N%wftYou draw in a deep breath and release it in a sudden gasp. \b "Did you notice something unexpected?" Val queries. HN%zf<You draw in a deep breath and release it in a sudden gasp..RQ ax_  bewitchMO actorN(f>5" AN(f2That would most certainly reveal your presence. .N(f>  E >" PN(fYou !> perchsit] in stillness, eyes demurely cast down, not a single twitch of a muscle nor a flutter of a !> feather cloak to bring a bit of attention to you. And yet a quiet spreads and pools within the tavern and you can feel their gazes, turning one by one towards you. N(f> > E >  E >  N(fYou stand perfectly still, unmoving, unflinching, with no outer sign of the spell you are weaving. Slowly, gradually Val turns to stare at you intently, from head to heel, as slowly he inches closer and-- !>he thrusts his open palm at you. There is nothing within his hand, yet all the same you feel the force of his blow from several feet away. With a "KRAW!" you flap away into the air as Val watches you through narrowed eyes.he wrests his gaze away, turning his head from you. \b "I'm going to... be over there... for a while," he says huskily and without a backward glance he walks away from you.   N(f> > E >  N(fYou stand perfectly still, the noise of the flute shrieking into your mind, as you cast your glamour over Val. Yet the young mage only plays all the louder... damn him! +N(f> > E >  N(fYou stand perfectly still, the noise of Val's voice sinking into your mind, as you cast your glamour over Val. Yet the young mage only plays chants all the louder... damn him! FN(f:Alas, there are none here to behold your alluring self. . ax_  complainmMO actorN)g>5" N)g As amusing as it would be to see everyone's expressions if a disembodied voice suddenloy started complaining about things in their midst, that would ruin yuor grand deception of tricking the humans into believing the tavern is outside of the influence of the fey. /N) g>" E >  E >" N) gYou grumble under your breath about meddling mages and mortals stomping all over where they don't belong. \b "Eh? What's that? Speak up! " says !>.TN) g>" E> > E >  E >  N)gYou grumble and fuss under your breath. Val chuckles deeply in his throat. \b "Well, aren't you being a sourpuss today, " he says. N)g>" E> > E >  {N)gLYou would gladly complain if you could force any sound beyond your frozen !> beak lipsN)g>  E >  E >M" N)g"Stop it!" you suddenly cry out. "Stop that horrible singing!" \b And Val pauses as he gazes at you. "Hmm? This chant is only supposed to bother those magical creatures... to set the blood of a dragon boiling, to lure forth a unicorn, to hypnotize a fey..."\b N)g>" 8N)g)You grumble and fuss under your breath.GN)g>" 3N)g'"KRAK!" you grumble. "KRAWK KAK COA!".XW ax_ praydMO actorN%2gEThe thought is laughable. You are the closest thing to a god here. .$% ax_ groanMO actorN&[g>5" N&\gAs amusing as it would be to see the expressions of the tavern denizens if a disembodied voice began groaning in their midst that would raise far too many suspicions. N&]g> > E >  MN&^g>Your groan of frustration strangles unheard in your throat. HN&_g>  E >" E >" N&bgYou draw in a deep breath and let loose with a long, mournful moan, the type of sound any ghost or haunt would be proud to claim as their own. \b "I warned y' not to be eatin' that there stew!" says !>. 5N&dg>  E> > YN&egJYou groan softly, the sound easily subdued by the music of Val's flute. N&gg>  E> > rN&hgcYou groan... Val will have to be dealt with, his infernal chanting is causing quite the headache."N&jg> > E >" N&mgYou draw in a deep breath and let loose with a long, mournful moan, the type of sound any ghost or haunt would be proud to claim as their own. \b Val looks at you worriedly. "Are you well?" he asks. (N&pgYou groan in exasperation.. axfff_ die?MO actorN$g That thought is unacceptable! L   _ liveMO actorN%gAnd so you do, through this unchanging existence. You can not physically die, at least not as mortals are supposed to do. You may simply cease to be... if you are absorbed by a mage, or torn asunder by the other fey, or even if you merely wander too far from your lands, you shall simply fall apart to nothing. No body left behind, no supposed soul flitting off into eternity, just... nothingness. This life is your eternity. . axH_ squawkMO actorN'g>5" 2N'g#That would reveal your presence. IN'g>  E >" E >" N'gR"KRAW!" you suddenly squawk into the muttering conversation of the tavern. \b \^!>Fq bursts into laughter. "Even the bird is tired of listening to your old stories, " he tells the other old man. @N'g> > E >" gN'gX"KRAW!" you call out loudly. "KAK KRAW!" \b "Yes, I hear you, Lord Raven. " says Val. N'g>  E >" E >" N'gYou give a sudden squawk. \^!> and !>F[ gaze at you in puzzlement. \b "Did the beans finally make their way through ye? " says !>?. "It always takes me by surprise when they hit the ol' gut."N'g> > E >  N'gPYour indignant squawk dies away in your throat before it can pass your frozen !> beak lipsN'g> > E >" YN'gJYou give a sudden squawk.\b "Something bite you? " Val asks innocently. |N'g>" +N'gYou give a sudden squawk. ?N'g>" +N'g"KRAW!" you suddenly squawk. . ax_  surrenderlMO actorN*gMThe thought goes against the very fiber of your being. Surrender is death. . ax   _ peck out eyesc MO actorN.Gh>" E >  E >" +N.JhWith a cackling croak you sweep into the air, criss crossing the room as you carefully build up speed, faster and faster until you suddenly swoop down and attack, pecking and scratching at the eyes of the random person closest to you. \b There is sudden pandemonium in the tavern as the tavern maid screams, the two old men leaps shouting to their feet overturning benches and tables in their wake, and !>3 dives into her travel satchel to pull out a SOMETHING. "The demon bird is attacking! " the tavern keeper comes lumbering into the room, her handy scullery skillet in hand. \b You merrily lead everyone in a chase round and round the room, stopping every now and then to divebomb someone close at hand. \^!>  runs face first into a wall, several pots and plates are thrown, some of them even hitting (others, ofcourse, never you), and everything is in shambles, all except for the lone table where the drunkard still slumbers peacefully. \b "DEMON!" the tavern keeper shrieks as you are finally chased out of the tavern window. With a BOOM of finality the shutters are slammed closed behind you. \b You wing your way back to perch on the window ledge and carefully preen your feathers. Looks like you might have to avoid the tavern for a little bit. N.Rh"i>N.Uh>" E> > N.`hYou hover in the air above the young mage, your wings wings held just so, as you await your opportunity. And then with a great "KAW" of the glee, you fall out of the sky and towards Val's face, scratching, clawing, and pecking at those strange green-blue eyes. \b Val flinches back just in time and begins to swat at you as you make several passes at him. He lowers his hand from his head and looks up at you, and for a moment your gazes meet, you poised in the air as he stands below. A shiver passes through you. \b And then your wings snap closed again as you dive towards the mage once more. The air jellifies around you, holding fast to each glossy black feather and each glinting sharp talon, and you are frozen no more than a foot away from the mage. You shouldn't have ignored that feeling, that warning... Damn! \b Val reaches up and plucks you out of the air, his gingers closing firmly around you. You'd snap your beak at those pale, trespassing fingers if you could. His grip on you tighters as he holds you closer, staring intently at you, and you stiffen, waiting, on the edge of phasing away or transforming... \b Val pets you on the head. "You ought to be less surly. " he says and with a quick flit of his wrist he tosses you back into the air. \b You flap away from him in confusion. Turning back for a moment you give one last "KRAW" of defiance before settling a good distance away to further observe the young mage.%N.bh>" BN.ch3Alas, there are no eyes to be had in this place. N.eh>" E> > E >  FN.fh7Alas, Val's eyes are quite out of your frozen reach. \N.ihPThat's not quite the reputation you were hoping to build for your human form. . ax_ pecksMO actorN%vh>5" 5N%wh&That would require a physical body. N%yh>  E >" E >" N%zhYou peck at the loose wooden floorboards, at the woven reed cage bars, at the cedar chips strewn before the fire, at the dangling coat of the !>F8, at anything and everything that catches your fancy.  N%{h> > E >" oN%~h`You sidle up to Val's leg and give it a good peck. Val moves faster than you imagined, swinging his leg around again to give you a light boot in the back of your feathered rump. \b You squawk in indignation and launch yourself into the air, glaring down at Val's pale head. If you were a true bird you would leave a nice present for him right there. zN%h>" E >  D >  D >  D >  JN%h;You peck at the pale colorless leaves that surround you. N%h>" E> > E >  >N%h/Alas, Val is quite out of your frozen reach. }N%h>" E> > E >  N%hAlas, Val is quite out of your frozen reach. You're not quite sure how you'd manage to peck at him in this form anyway, unless you were planning on henpecking him. N%h>" BN%h3Desultirorily you peck at the ground around you. EN%h9This might be more fun if you were in your other form. .TU ax_ createMO actorN'[Your power washes over you, tumbling, rising, crescendoing... and then finally fading away as you fail to give it shape or form. 0MOactorobjseqnoN[" MOactorprepiobjO loN#[ N#[b ! #N#[b!N#[G .PGJ|fff_ think_MO actorN&[@Your thoughts idly wander through the labyrinth of your mind. 0MOactorobjseqnoN[" MOactorprepiobjO loN[ N[# ! #N[#!N[.PGJ|_ freeSMO actorN%Qb4If only freedom were such a cheap thing to obtain..32PGJ|J  your boundary, your boundary your boundary VVYou can sense, there at the edge of the meadow, the line where your influence ends. l* * *J  breeze ZZThe wind is gentle and refreshing, coquettishly playing with the ribbons on the breeze. TMO actorN5The wind is slightly cool as it blows through you. -uMO actorNVA wild cacophony of a perfume, each flower warring to carry its scent above others. /MO actorNd.MMO actorN.The wind blows silently through the meadow. MO actorN(MO actorN>$E.  groundyMO actorN14zMO actorNU6>m" dNU7PYou push grass and greenery back into the hole until it filled in once again. !m|9 9 9.  carpet of flowers Hyacinths, pansies, and tulips, black dahlias, thornless roses, and nine varieties of lilies, moonflowers, rainrims, and silver tipped speckles. Flowers that had no right to be growing together, in this season, or any season at all.MO actorN*CvMO actorNNE2The flowers leave a fine film of pollen on your !< hands wings. -uMO actorNGVA wild cacophony of a perfume, each flower warring to carry its scent above others. mMO actorNEH>" FCYou shouldn't overburden yourself with items while in this form. UMO actorO selectionNK<n @NLn##     |: : :.E  bluebell hyacinths, the bluebell hyacinths bluebell hyacinths VVTheir heads drooping, deep bodied bluebell hyacinths tinkle slightly in the breeze. MO actorNleMO actorNmFThe hyacinth petals are waxy around a hard little tongue of silver. -IMO actorN`o*Sweetest of the flowers in your domain. /MO actorNp.qMO actorNqRIf you listen carefully, a faint sweet chiming can be heard from the hyacinths. mMO actorNJr>" FCYou shouldn't overburden yourself with items while in this form. zMO actorOxNt-You pull free a single bloom from its nest.Nu+ZNv&h% % %.  scattering of tulips Tulips in a wide array of colors are scattered across the meadow. Red, blue, yellow, purple, orange and green, they form perfect little goblets with their petals. MO actorN8sMO actorN :*The tulip petals are silky beneath your !>talons  fingers. -KMO actorN<,The tulips smell strongly of sugar water. y ddThe tulip petals are crisp and smooth between your teeth with a flavor reminiscent of a cucumber. mMO actorN@>>" FCYou shouldn't overburden yourself with items while in this form. oMO actorOxNA"You gather an armful of tulips. NB*ZNC&P P P.  smattering of pansies Purple pansies grow low along the ground. Some of them are touched with yellow or white or red and all have dark little centers, faces that seem to smile up at you.MO actorN SMO actorN4The pansies' petals are velvet against your skin. -IMO actorNg*A delicate perfume, faint but pleasant. y Pansies taste somewhat of mint, a flavor you've always enjoyed, but guilt creeps up about eating the pansy while its "looking" at you.... Maybe later. The pansy smiles up at you. mMO actorNq>" FCYou shouldn't overburden yourself with items while in this form. iMO actorOxNYou gently pluck a pansy. N)ZN&h  .  blanket of lilies Lilies in all shapes, sizes, and colors are strewn about the meadow. Tri-colored Day Lilies in creamy orange, yellow and red, the spotted Tiger Lily and the trumpet shaped Regal Lily, the blue Funnel Lily and Star Lilies in blue, pink and burning orange, green buds of Peace Lilies and graceful white Calla Lilies, orange Bell Lilies with purple spots and the tiny little Lily-of-the-Vallies. MO actorNMO actorNaSmooth and rough, bumpy and waxy, in all different textures are the lilies raise their petals. -GMO actorNu(A heavy perfume, almost overpowering. y 55You nibble delicately on a day lily... sweet onion at the tips grows bitter as you move to the stem. The tuber roots of the Tiger Lily taste somewhat of potato while the medicinal Star Lily roots are rather bitter. The other lilies are poisonous... to humans, anyway. You pop a few of them into your mouth. mMO actorN>" FCYou shouldn't overburden yourself with items while in this form. MO actorOpxNGWith a critical eye you quickly gather together a bouquet of lilies. N'ZN&j j j.  passel of black dahlias Towering over the other flowers are black dahlias, round multi-petaled blooms in shades of black, like a starburst of darkness.MO actorNMO actorN+The dahlia blossoms prickle as you brush !>against themyour hands over them. -aMO actorNyBYou bury your nose into a dahlia bloom... a light floral scent. y Mmm... the bloom is a bit of a blend between melon and carrot. The long hollow stem tastes of sugar, and the tuber root is like a potato, only sweeter. mMO actorN>" FCYou shouldn't overburden yourself with items while in this form. tMO actorOxN'You haul up a dahlia, roots and all. N&ZN&   .#  jumble of roses. Roses in all different colors and sizes are scattered across the meadow. New buds, blossoms in full bloom, and aged flowers with falling petals call out for your attention. MO actorNSMO actorN4The roses are soft and pliant beneath your touch. MO actorNn'MO actorNOnce you grew them with thorns so sharp and their perfume drowned out the scent of all the other flowers. But lately you have removed the thorns and, while there is probably some way to create them with scent, you think that it is somehow more fitting this way. -cMO actorNDIt seems the roses have lost their scent along with their thorns. y The rose is crisp between your teeth but rather dull of taste. Perhaps crystallizing it with sugar would enhance the flavor. mMO actorN>" FCYou shouldn't overburden yourself with items while in this form. MO actorO xN0GYou carefully gather a handful of roses, each one a different color. N0%ZN0& o o o.#  A cluster of rainrims. yyThe three petals of these white flowers curl back upon themselves trapping moisture underneath their blue flecked rims.MO actorNSJMO actorNU+The blooms are moist with collected dew. -9MO actorN5WAn almost woodsy scent. y MMIt tastes a bit like moss and mildew and is quite squishy as it goes down. MO actorNYMNZYou must careful of the rainrims...that they receive enough nutrients since you don't permit any insects for them to feed upon. mMO actorN[>" FCYou shouldn't overburden yourself with items while in this form. tMO actorOxN^'You bend down and collect a rainrim. N_$ZN`&   .  stash of cornflowers ttBright blue corflowers are sprinkled across the fields, each plant bearing many petalled flowers of richest blue. MO actorN(9MO actorN*A soft brush of petals. -RMO actorN,3A mild scent only noticeable when close at hand. y ,,A sweet and spicy taste, much like clove. mMO actorN.>" FCYou shouldn't overburden yourself with items while in this form. wMO actorOxN(1*You pluck a cornflower from the ground. N(2"ZN(3& 5 5 5.  A sprinkling of moonflowers. Petals of translucent iridescence surround a center of crystal blue. These flowers are rumored to glow in the light of the moon.MO actorN]MO actorN>The flower petals bruise even under the softest of touches. -TMO actorNa5A faint scent with the barest bite of spice to it. y [[A touch of spice on your tongue and then its gone; the petals almost melt in your mouth. mMO actorN>" FCYou shouldn't overburden yourself with items while in this form. MO actorOxNVGingerly you pull a moonflower from the ground, careful lest you hold it too tight. N !ZN & F F F.  patches of silver speckles llDeep bodied flowers, white and gilded in silver. Soft golden anthers peek out from between the six petals.MO actorNkMO actorNLThe petals are thick and waxy with rougher patches where the silver lies. -`MO actorNQATheir scent is reminiscent of the sea, or so you've been told. y {{You take a bite out of a handy speckled petal. It's a tough chew. Overall you can think of more pleasant flowers to eat. mMO actorN8>" FCYou shouldn't overburden yourself with items while in this form. MO actorOxNKYou pull a silver tipped speckle from the ground, stems, leaves and all. N ZN&  .  web of honeysuckle webs of honeysuckle rrA fragrant mesh of honeysuckle vines adorns the surface of the columns. Dew gleams moistly inside their petals. MO actorNZMO actorN;The honeysuckle blossom is are soft and slightly sticky. -VMO actorNR7 Shockingly the honeysuckle smells like honeysuckle. y nnYou take a sip from a handy honeysuckle blossom. Ah, a little burst of sweetness on the tip of your tongue. mMO actorN">" FCYou shouldn't overburden yourself with items while in this form. zMO actorOxN-You carefully pluck a blossom from a vine. NZN&@J  sky,  the horizon The skies stretch endless blue above you. Here the clouds are feathery and wispy, almost insubstantial at their ends. However, to the north there seems to be a gathering and a darkening. J  clouds,  the clouds LL The clouds are wispy bits of dragon's breath with no real form or shape. uuuJ ,  the sun sun 77The flowers turn their heads towards the rising sun. <J  hazy figure of white trees LLEven from this distance, the trees to the east look rather pale in color. /MO actorNs.=MO actorNtThe trees are too far away. J  hazy figure of dark trees BBThe darkened form of a grove of trees can be seen to the north.   .  pillar of blossoms pillars of blossoms ))It appears that some of the flowers have grown together so thickly that their tangle has formed the basis of these pillars which stand several heads taller than you. Many blossoms of honeysuckle adorn the surface of the columns and colored ribbons have been threaded through the climbing plants.MO actorNMO actorNNThe column is dense with leaves and petals and stems. Only the tips of your !> claws  fingers' can sink into the mass of greenery. -MO actorNh{The columns smell heavily of the honeysuckle that graces them with the scent of the other flowers an underlying current. /MO actorN.VMO actorN,7The columns trai their ribbons silently in the wind. (  .  circle of ribbons circles of ribbons qqRed, blue, yellow, purple, orange, green, white, black, and brown... gaily they shimmer and dance in the wind. MO actorNKMO actorN,The ribbons are slender snatches of silk. -wMO actorN@XThe ribbons have taken on the perfume of the flowers that continuously surround them. mMO actorN>" FCYou shouldn't overburden yourself with items while in this form. UMO actorO0 selectionN@<n @N@nH H H.  sweeping black ribbons ++A black ribbon sweeps around the column. MO actorNpIMO actorN*The ribbon is a slender snatch of silk. -sMO actorNTThe ribbon has taken on the perfume of the flowers that continuously surround it. mMO actorN\>" FCYou shouldn't overburden yourself with items while in this form. vMO actorOxN)You carefully pull a black ribbon free.N6ZN&f f f.  stark white ribbons LLThe white ribbon is a stark contrast to the green of the growing pillars. MO actorNIMO actorN*The ribbon is a slender snatch of silk. -sMO actorN TThe ribbon has taken on the perfume of the flowers that continuously surround it. mMO actorNz >" FCYou shouldn't overburden yourself with items while in this form. vMO actorOxN )You carefully pull a white ribbon free.N 7ZN&M M M.  hanging brown ribbons 11A brown ribbon hangs half hidden by the foliageMO actorNu+IMO actorN-*The ribbon is a slender snatch of silk. -sMO actorN/TThe ribbon has taken on the perfume of the flowers that continuously surround it. mMO actorNa0>" FCYou shouldn't overburden yourself with items while in this form. vMO actorOxN2)You carefully pull a brown ribbon free.N38ZN4&O O O.  floating orange ribbons //Orange ribbons floating lightly in the wind. MO actorNuIMO actorN*The ribbon is a slender snatch of silk. -sMO actorNTThe ribbon has taken on the perfume of the flowers that continuously surround it. mMO actorNa>" FCYou shouldn't overburden yourself with items while in this form. xMO actorOxN+You carefully pull an orange ribbon free.N4ZN&F F F.  gleaming yellow ribbons ''Yellow ribbon gleaming in the light. MO actorNmBIMO actorND*The ribbon is a slender snatch of silk. -sMO actorNFTThe ribbon has taken on the perfume of the flowers that continuously surround it. mMO actorNYG>" FCYou shouldn't overburden yourself with items while in this form. wMO actorOxNI*You carefully pull a yellow ribbon free.NJ2ZNK&M M M.  winding purple ribbons //Pale purple ribbon winding round its pillar. MO actorNtjIMO actorNl*The ribbon is a slender snatch of silk. -sMO actorNnTThe ribbon has taken on the perfume of the flowers that continuously surround it. mMO actorN`o>" FCYou shouldn't overburden yourself with items while in this form. wMO actorOxNq*You carefully pull a purple ribbon free.Nr3ZNs&Y Y Y.  flash of green ribbons <<Out of the corner of your eye you catch a flash of green. MO actorNIMO actorN*The ribbon is a slender snatch of silk. -sMO actorNTThe ribbon has taken on the perfume of the flowers that continuously surround it. mMO actorNm>" FCYou shouldn't overburden yourself with items while in this form. vMO actorOxN)You carefully pull a green ribbon free.N5ZN&x6 6 6.  waving red ribbons Red ribbon waving in the sun.MO actorN`IMO actorN*The ribbon is a slender snatch of silk. -sMO actorNTThe ribbon has taken on the perfume of the flowers that continuously surround it. mMO actorNL>" FCYou shouldn't overburden yourself with items while in this form. tMO actorOxN 'You carefully pull a red ribbon free.N!1ZN"&o o o.  trailing blue ribbons trailing blue ribbons 77 In front of you, a blue ribbon trails in the breeze.MO actorNIMO actorN*The ribbon is a slender snatch of silk. -sMO actorN TThe ribbon has taken on the perfume of the flowers that continuously surround it. mMO actorN>" FCYou shouldn't overburden yourself with items while in this form. uMO actorOxN(You carefully pull a blue ribbon free.N0ZN&sss<LMD  honeysuckle blossom ,,You twist the honeysuckle into your hair.  !!You shake the honeysuckle off. blooms of honeysuckle TT A single white honeysuckle blossom with a bead of nectar dripping down its lips. MO actorN VMO actorND7The honeysuckle blossom is soft and slightly sticky. -VMO actorN7 Shockingly the honeysuckle smells like honeysuckle. +y nnYou take a sip from a handy honeysuckle blossom. Ah, a little burst of sweetness on the tip of your tongue.  T  <LMD  single silver tipped speckle --You tuck the silver speckle behind your ear ##You pull off the silver speckle. The flower is white and deep bodied, set into the center of a spiral of long, dark green leaves. Silver gilds the its tips and is sprinkled across the six petals. A clutch of golden anthers nestles within the heart of the flower. MO actorNkMO actorNLThe petals are thick and waxy with rougher patches where the silver lies. -WMO actorN28The flower smells of the sea, or so you've been told. +y {{You take a bite out of a handy speckled petal. It's a tough chew. Overall you can think of more pleasant flowers to eat. !<LMD  wayward moonflower ::You twine the stem of the moonflower around your wrist.  ..You pull off the moonflower off your wrist. Diaphanous petals that shimmer with colors surround a center of pure crystal blue. If you hold unto this until tonight, perhaps it will glow in the moonlight for you. MO actorNr]MO actorN>The flower petals bruise even under the softest of touches. -TMO actorN5A faint scent with the barest bite of spice to it. +y [[A touch of spice on your tongue and then its gone; the petals almost melt in your mouth. "XXX<LMD  wayward cornflower ))You tuck the cornflower behind your ear You pull off the cornflower A single cornflower plant bears many circular blossoms filled with small, tri-pointed petals of richest blue. Three and three slender dark blue anthers rise up from the center of each flower.MO actorNhB9MO actorNDA soft brush of petals. -RMO actorNF3A mild scent only noticeable when close at hand. +y ,,A sweet and spicy taste, much like clove. #@@@@2 MO actorNu$l)))<MD  rainrim bloomMO actorNHlnMO actorNlmYou are about to tuck the rainrim behind your ear when you notice it dribbling moisture down your arm. You decide not to wear it afterall. The three petals of these white flowers curl back upon themselves trapping moisture underneath their blue flecked rims. Within the center of this wide mouthed flower lies a bright gold anther, sticky and tempting, that will entrap any wayward insects. MO actorN!oJMO actorNEq+The blooms are moist with collected dew. -8MO actorNsAn almost woody scent. +y MMIt tastes a bit like moss and mildew and is quite squishy as it goes down. %kkk<LMD  handfuls of roses`MN<" E <  !Ngarland of rosesNhandful of roses <<You wind the roses together into a garland for your head.  //You pull the garland of roses off your head. A red rose is for passion, white for purity, pink for happiness, and yellow for friendship, peach is for desire, and orange is fascination, violet is for old love and blue is... but there isn't any blue. MO actorNSMO actorN#4The roses are soft and pliant beneath your touch. -cMO actorN|DIt seems the roses have lost their scent along with their thorns. +y }}The rose is crisp between your teeth but rather dull of taste. Perhaps crystallizing it with sugar would enhance the flavor&HHH<MD uprooted black dahlia, an uprooted black dahliaMO actorNjnTMO actorN5The dahlia is a bit too bulky to wear as a corsage. It is a true black dahlia, not the dark purple ones that florists are wont to cultivate and call black. Multipetaled and black, like a starburst of darkness.MO actorNMO actorN+The dahlia blossoms prickle as you brush !>against themyour hands over them. -aMO actorN>BYou bury your nose into a dahlia bloom... a light floral scent. +y Mmm... the bloom is a bit of a blend between melon and carrot. The long hollow stem tastes of sugar, and the tuber root is like a potato, only sweeter. '\\\<LMD  77You braid the lilies into a wreath around your neck.  %%You pull off the wreath of lilies. aMN<" E <  !Nwreath of liliesNbouquet of lilies bouquets of lilies A bouquet of lilies all commingled together. Tri-colored daylilies whose long leaves form graceful fountain shapes, the deep orange Tiger Lily with its spots, the Regal Lily with its many trumpet shaped blooms, the Blue Funnel Lily and the Star Lilies, the Peace Lilies turning from pale green to white as they bloomed, graceful white Calla Lilies, purple spotted Orange Bell Lilies with their flared petals and leaves, and Lilies-of-the-Valley with their multitude of tiny white blossoms among the broad leaves. MO actorN'MO actorNKaSmooth and rough, bumpy and waxy, in all different textures are the lilies raise their petals. -GMO actorN(A heavy perfume, almost overpowering. +y 55You nibble delicately on a day lily... sweet onion at the tips grows bitter as you move to the stem. The tuber roots of the Tiger Lily taste somewhat of potato while the medicinal Star Lily roots are rather bitter. The other lilies are poisonous... to humans, anyway. You pop a few of them into your mouth. )<LMD  perfectly pretty pansies &&You twist the pansy into your hair.  %%You shake the pansy off your head.  perfectly pretty pansy A bright purple pansy with five round petals and heart shaped leaves. Its dark center seems to smile up at you in contentment. MO actorNQ)RMO actorNu+3The pansy's petals are velvet against your skin. -IMO actorN-*A delicate perfume, faint but pleasant. +y Pansies taste somewhat of mint, a flavor you've always enjoyed, but guilt creeps up about eating the pansy while its "looking" at you.... Maybe later. The pansy smiles up at you. *<LMD  armfuls of tulips 44You drape the blanket of tulips across your neck.  &&You pull off the blanket of tulips. VMNQ<" "NRblanket of tulipsNTarmful of tulips, an armful of tulips Red, blue, yellow, purple, orange and green, the tulips form perfect little goblets with their petals. You can see a glistening of nectar that half-fills each bloom. MO actorNWsMO actorNY*The tulip petals are silky beneath your !>talons  fingers. -KMO actorNx[,The tulips smell strongly of sugar water. +y ddThe tulip petals are crisp and smooth between your teeth with a flavor reminiscent of a cucumber. u SSYou tilt a tulip bloom up to your lips and honeyed water rushes into your mouth. +<LM#D  solitary bluebell hyacinth bluebell hyacinth blooms LLYou let the hyacinth bloom dangle from a twine of stems around your neck.  You pull off the hyacinth. CC Nestled within the deep blue hyacinth lies a tiny silver chime. MO actorN7MO actorN[yYour favorite scent of all the flowers. It seems a shame that naturally they only bloom for a few weeks in the spring. MO actorNfMO actorNG The hyacinth petals are waxy around a hard little tongue of silver. -3MO actorNHeady and strong. +/MO actorN.pMO actorNQIf you listen carefully, a faint sweet chiming can be heard from the hyacinth. y After carefully removing the silver bell, you pop a hyacinth bulb into your mouth. Its flavor is sweet and nut-like. It would taste even better if slow roasted. MO actorN MO actorO/xN?ANestled within the deep blue hyacinth lies a tiny silver chime.N?-ZN?&,@  .  hyacinth head CC Nestled within the deep blue hyacinth lies a tiny silver chime. MO actorNfMO actorNG The hyacinth petals are waxy around a hard little tongue of silver. -3MO actorNHeady and strong. MO actorNHMO actorOlxN|ANestled within the deep blue hyacinth lies a tiny silver chime.N|-ZN|&-p/ / /5  tiny tongue of silver tiny tongues of silver A small splinter of silver. MO actorN>MO actorN Hard and cool to the touch. -4MO actorN Heady and strong. +.\  .  rolling meadow of greenery Each blade of grass is a pure deep green, perfectly shaped and placed for the utmost effect. The grass is of middling height to serve as a backdrop to the flowers and not overshadow them. MO actorNGMO actorN+(The grass prickles against your skin. -8MO actorNxA healthy green scent. y {{You pop a stem of grass into your mouth. It is sweet-- for grass, anyway. The flowers here should have better flavoring. mMO actorN7>" FCYou shouldn't overburden yourself with items while in this form. lMO actorOxNYou uproot a clump of grass. N/ZN&/@  <M  clumps' of grass clump of uprooted grass iiA handful of deep green grass, stems and leaves a bit bent and the worse for wear from being uprooted. MO actorNGMO actorN(The grass prickles against your skin. -8MO actorN>A healthy green scent. +y {{You pop a stem of grass into your mouth. It is sweet-- for grass, anyway. The flowers here should have better flavoring. 00  LMD **You tie the blue ribbon around your head You pull free the blue ribbon  curl of blue ribbon curls of blue ribbons EE The ribbon is a cornflower blue with an iridescent shimmer to it. MO actorN IMO actorN# *The ribbon is a slender snatch of silk. -sMO actorNr TThe ribbon has taken on the perfume of the flowers that continuously surround it. +1L  LMD ..You tie the red ribbon around your upper arm You pull free the red ribbon  length of red ribbon lengths of red ribbon RR The ribbon is the deep red of a robin's breast with an iridescent sheen to it. MO actorN0IMO actorN42*The ribbon is a slender snatch of silk. -sMO actorN4TThe ribbon has taken on the perfume of the flowers that continuously surround it. +2L  LMD --You tie the yellow ribbon around your wrist !!You pull free the yellow ribbon  flare of yellow ribbon flares of yellow ribbon HHThe ribbon is a creamy golden yellow with an iridescent shimmer to it.MO actorN YIMO actorN0[*The ribbon is a slender snatch of silk. -sMO actorN]TThe ribbon has taken on the perfume of the flowers that continuously surround it. +3  LMD ,,You tie the purple ribbon around your hair !!You pull free the purple ribbon  stretch of purple ribbon stretches of purple ribbons ""Pale purple of amethyst crytal. MO actorNIMO actorN*The ribbon is a slender snatch of silk. -sMO actorN^TThe ribbon has taken on the perfume of the flowers that continuously surround it. +4,  LMD --You loop the orange ribbon around your neck !!You pull free the orange ribbon  loop of orange ribbon loops of orange ribbon, an orange ribbon !!As orange as its name implies. MO actorNIMO actorN*The ribbon is a slender snatch of silk. -sMO actorNnTThe ribbon has taken on the perfume of the flowers that continuously surround it. +5L  LM ,,You tie the green ribbon around your waist  You pull free the green ribbon  coil of green ribbon coils of green ribbons ((The dark green of fresh pine needles. MO actorNIMO actorN*The ribbon is a slender snatch of silk. -sMO actorNTTThe ribbon has taken on the perfume of the flowers that continuously surround it. +D6L  LM ..You knot the black ribbon around your throat You untiel the black ribbon  trail of black ribbonD trails of black ribbons &&The pure black of a starless light. MO actorNIMO actorN *The ribbon is a slender snatch of silk. -sMO actorNYTThe ribbon has taken on the perfume of the flowers that continuously surround it. +7   LMD ..You loop the white ribbon around your knee.  ""You pull free the white ribbon.  twist of white ribbon twists of white ribbon ** White as the clouds floating above it. MO actorNIMO actorN*The ribbon is a slender snatch of silk. -sMO actorNa TThe ribbon has taken on the perfume of the flowers that continuously surround it. +8  LMD ..You tie the brown ribbon around your ankle.  !!You pull free the brown ribbon.  spiral of brown ribbon spirals of brown ribbon %%Dark brown of newly churned earth. MO actorNBIMO actorND*The ribbon is a slender snatch of silk. -sMO actorN]FTThe ribbon has taken on the perfume of the flowers that continuously surround it. +9]]].\  ++deeply colored glass in between the trees, //the deeply colored glass in between the trees-MN}Sunlight shines through the colored glass that decorates the trees... crimson, gold, sapphire blue, jade, turquoise, and royal purple... an aura of rainbow light that is reflected in the ground below. Certain shapes can picked out amongst the colors... a butterfly in shades of yellow and red here, a blue flower there, and that bit of turquoise and blue... an open book perhaps.N<" N\b Several sheets of glass have been been shattered clean through with the remnants left to litter in the shadows of the trees.  You look through the swatches of color in stained glass and see a different world beyond. Many different worlds in many different colors. MO actorNUMO actorNy(You reach up into the trees and brush !> againsta hand acrossf the glass. It is perfectly smooth and unblemished, you would not be satisfied with anything else.  MO actorNY MOactordobjN}D! ON}With impecable aim you cast !, at the colored glass stretched between the dark boughs of the metal trees. It hits with a resounding chime and a musical crinkle of shattering crystal. The afflicted glass falls to the sandy ground in a storm of sharp glittering fragments. "> >E&> &N} You fling !,h at the trees. It flits against the colored glass with a muffled whisper before sliding to the ground.> &  oMO actorNpMO actorN<" ;N&As you gaze upon the grove the dark metal branches of the trees begin to tremble. A hazy mist seems to arch from branch to branch like spiderwebs unfurling, darkening, growing color and substance. And then with a final shimmer the glass gleams jewel-toned and the trees are whole once again. !-N!The grove is perfect as it is. :dJ  your boundary, your boundary your boundary You can sense, all around the edge of the grove, the line where your influence ends and the Beast's begins. The Beast presses ever inward but you easily hold your border steady. ;  J  wind The air here is still and heavy with the heat of the sun. The surrounding sands and glass and metal greedily absorb the rays the sun, adding their own warmth to the area. MO actorN>" uNYou reach out and pass your !> wings hand& through the still, unresisting air.;N/You soar easily through the still, warm air. ->MO actorNA sharp metallic aftertaste. /MO actorN.MMO actorN#.You hear nothing in the silence of the air. MO actorNv(MO actorN><@J  rolling meadows, the rolling meadows To the south green springs up again as grass takes the place of glass and sand. Spots of color amongst the greenery signifies the beginning of the flowered meadows. = J   lakeshore, the lakeshores To the east green springs up again as grass takes the place of glass and sand. Further on the land falls away to a distant glimmer in the horizon.>   ./  ground,  the groundMNAt the edge of the grounds where the grass gives way, the sand is pale white and coarse. It grows ever finer and darker, interspersed with smooth stretches of clear glass, until the sands that lie in the shadow of the trees are as dark as the trees themselves. Underneath the entwined boughs lays layers upon layers of glass, both clear and dark, their surfaces touched by colored dapples of light. N<m" MNA\b A small hole with trickling sides has been dug in the sand. 1MO actorNI0MO actorNm?\NmMYou carefully dig through the sand and glass but find nothing of interest. ZNm7You carefully dig through the sand and glass to find !?."mmyMO actorN]zMO actorN<m" YNDYou smooth over the sands until the ground is pristine once more. !m7N+There are no holes to be filled in here. >MO actorN:?iMOactordobjN^ You bury !  amongst the sand and glass. ?&MO actorNMO actorNYou run your !>talons  fingersF through the grains of sand and brush their tips against the glass. @>A?MO quipnoNKwN\bDragons have sense...jNI can't imagine why...ENWhat did they look like?1MO quipnoNqKNq\b"Dragons have sense," you retort.\b "Aye," Val replies. "All the ones lacking sense were killed off long ago. Humans are more lucky in that regard. Or mayhaps less, depending on your point of view. Nq\b"I can't imagine why..." you drawl. \b Val laughs. "Because all the dragons who are left have quite a bit of common sense," he says.BNq\b"What did they look like?" you ask in fascination. \bThe mage laughs. "Have you never seen a drawing of a dragon then?" he asks. "Did you not notice the painting of the dragon on the tavern?" you retort. \b The mage laughs even more. "Aye... well, they have wings like a bat, only much larger and more graceful. They are covered in large irridescent scales... and can be many colors. Full grown they are very, very large, yet there is something sleek and elegant about them.Nq?E.  groundyMO actorN1zMO actorNU>>m" XNUDYou smooth over the sands until the ground is pristine once more. !>m@8J  sky,  the skies The sky above you, seen between the many fluffy clouds, is a brilliant blue. Endless blue to the south, west, and east, but an odd darkening to the north. Perhaps a storm is coming.A(J  clouds,  the clouds The clouds floating above you are fluffy and puffy, piling one atop the other until they form towering mountains of ethereal vapor. One such formation and another has the rough outline of a woodpecker with wings outspread, and another appears to be a fluffy little creature with wisps for claws, and towering above all is a castle in the sky, the shape of a tower or rampart visible within the edges of the clouds. BlJ ,  the sun sunMN!The sun blazes high above you and reflects off the pale sand and patches of glass scattered about the area. Luckily the many clouds shade you from most of its rays; yet several sunbeams manage to slant through the trees' stained glass, casting an ethereal glow within the grove itself. N> > E >q" `N T"Tis dangerous to stare at the sun like that," Val says he gazes at you sideways. "qC$  .  stretches of pale sand wwThis sand is pale and somewhat coarse. The small patches of glass that sprinkle it are transparent and somewhat thin.MO actorNEMO actorN&The sand is warm beneath your feet. -aMO actorN+BThe ground smells of sand, which is not much of a scent at all. mMO actorN>" FCYou shouldn't overburden yourself with items while in this form. MO actorOxNXYou have little clue what you would do with it, but you grab a handful of white sand. NDZN&Dn n n5M  handful of white sand handfuls of white sand BBA handful of pale sand that sparkles with tiny little crystals. MO actorN(>MO actorN*The sand is coarse and warm. -YMO actorN ,:It smells of sand, which is not much of a scent at all. +EKKK. colored shards KKA smattering of colored shards recently wrested from the grove of trees. MO actorN5?MO actorN7 That would be rather painful. -QMO actorN92There is a bit of a metallic bite to the scent. mMO actorN@:>" FCYou shouldn't overburden yourself with items while in this form. MO actorOxN=HYou carefully pluck a sliver of colored glass from beneath the trees. N>FZN?&FC C C5M;MND slivers of !<@ glass:MNG sliver of !<@ glassMA slender sliver of !<@g glass, no longer than a splinter. Its color changes depending upon how you hold it up to the light. MO actorN=H?MO actorNaJ Painfully sharp to the touch. -[MO actorNL<It smells of glass, which is not much of anything at all. +33redpurplebluegreengold turquoiseG  .  expanse of black sand ffThe dark sand is very fine and is liberally littered with patches of thick glass as dark as itself. MO actorNYKMO actorN[,The sand is rather hot beneath your feet. -^MO actorN]?There is a bit of a metallic bite to the scent of this sand. mMO actorN^>" FCYou shouldn't overburden yourself with items while in this form. MO actorOxNaYYou have little clue what you would do with it, but you grab a fistful of black sound. NbHZNc&H  5M  fistfuls of black sand fistful of black sand DDA fistful of dark sand that longs to escape between your fingers. MO actorNnHMO actorNp)The sand is soft and hot to the touch. -^MO actorNr?There is a bit of a metallic bite to the scent of this sand. +I.  span of gleaming black glass, the gleaming black glass The dark glass is thick and lies in many layers. The sunlight glimmering across its rough surface throws back a distorted reflection of you. MO actorN}MO actorN|The glass is very warm beneath your touch. Between smooth stretches are dents and bumps caused by the underlying layers. J(.  distorted reflection Your reflection in the dark glass shows only a vaguely man shaped form. The irregular slopes in the glass cause your shape to stretch such that it seems two dark wings sprout from your back. MO actorNMO actorN(&The glass is very warm beneath your !> touch  fingersS. Between smooth stretches are dents and bumps caused by the underlying layers. KH.\E  patches of clear glass, the patches of clear glass Sunlight glitters across the surface of of the pellucid glass that lies in patches of varying depths. You can see through the glass to the sand and soil that lies underneath. MNXThe sand beneath the glass is pale and coarse with bits of dusty brown earth mixed in.NL! aNUUnderneath a thin patch of class you can see a beetle crawling through the ground. MO actorNMO actorN$Smooth and warm to the touch.N$M! N$Your !> talonss  fingersV narrowly avoid a jagged edged fragment that has broken off the main body of glass. Ld###LM KMN(The beetle hangs oblidgingly off your !> shoulder like a piercingcloak like a fancy brooch..  &&You pull off the blanket of lilies.  bronze scarab [[This beetle has a pretty bronze coat with a metallic green leaf pattern across its back. /MO actorN_.KMO actorN,The beetle clicks and chirrups to itself. MO actorNOMO actorN0The beetles exoskeleton is hard to the touch. 6MO actorNM{You eat the beetle whole. It scuttles around your mouth and makes a rather disturbing crunching noise as you chew on it. !<&-MO actorN"!)M   5M K jagged edge of glassMN7A jagged shard of clear class with a sharp point. It !> would fit fits easily within your hand. MO actor'MO actorN>" ;N,You snap your beak at the shard of glass. NYou brush your hand across the splinter of glass and a bead of blood wells up across one fingertip. It slips off your flesh and falls to the ground with the faint tinkle. > N&mMO actorN#>" FCYou shouldn't overburden yourself with items while in this form. -MO actorN"!)Nxxx5Mf  blood drops crystalized blooddrop A drop of deep ruby blood, smoothly crystalized into a flawless gem. Little sparks of red and orange fire glint deep within the depths of the crystal. MO actorNaMO actorNBThe blood drop is perfectly smooth and cool beneath your touch. O???.\  --glass butterfly in shades of red and yellow This butterfly is fashioned after one that you created for your meadow, even down to the yellow figure eight markings upon its crimson wings. LLYou look through the glass and see the northern plains in a golden light. MO actorN>MO actorNb(You reach up into the trees and brush !> againsta hand acrossf the glass. It is perfectly smooth and unblemished, you would not be satisfied with anything else. P???.\  ""book of turquoise and blue glass A book of glass with covers in turquoise and shades of blue that range from soft sky to deepest sapphire. The thinnest slivers of clear glass symbolize the open pages. ==You look through the glass and a fountain of deepest blue. MO actorN>MO actorNb(You reach up into the trees and brush !> againsta hand acrossf the glass. It is perfectly smooth and unblemished, you would not be satisfied with anything else. Q.\  flower of glass A flower of glass with shades of green and yellow for the stem and spiralling leaves. The petals are angled slivers of brightest blue... a tulip, perhaps. Nay, the shape is wrong for that. A rose... that must have been the flower you were thinking of when you created that mosaic. BBYou look through the glass and see nothing but the blue of sky. MO actorNMO actorN(You reach up into the trees and brush !> againsta hand acrossf the glass. It is perfectly smooth and unblemished, you would not be satisfied with anything else. R.   dark treesMN The grove of dark trees stands perfectly straight before you without a knot nor bend nor lump to their trunks. Their branches and twigs unnaturally swoop and curl around each other, forming the latticework for the many colored glass that stretches inbetween them. N>9" N\b Several sheets of glass have been been shattered clean through with the remnants left to litter in the shadows of the trees. MO actorNMO actorNYou place your palm against a tree trunk and find it strangely cool to your touch. The tree bark is flawlessly black and smooth and chimes musically, metallically when you tap it. -zMO actorN![The trees do not smell of living wood, but of sand and glass with a metallic tang to it. /MO actorNu".PMO actorN#1The trees chime melodically when you tap them. MO actorN${MO actorN%\With glass twined around and through them, these trees would be far too painful to climb.  MO actorN& MOactordobjN(D! QN)With impecable aim you cast !, at the colored glass stretched between the dark boughs of the metal trees. It hits with a resounding chime and a musical crinkle of shattering crystal. The afflicted glass falls to the sandy ground in a storm of sharp glittering fragments. "9> >E&> &N+ You fling !,h at the trees. It flits against the colored glass with a muffled whisper before sliding to the ground.> &  oMO actorN-pMO actorN />9" =N 0&As you gaze upon the grove the dark metal branches of the trees begin to tremble. A hazy mist seems to arch from branch to branch like spiderwebs unfurling, darkening, growing color and substance. And then with a final shimmer the glass gleams jewel-toned and the trees are whole once again. !9-N 2!The grove is perfect as it is. S|.  $$multicolored dapples on the ground, ((the multicolored dapples on the ground The sunlight shining through the colored glass leaves rainbow shadows upon the darkened glass on the ground. Reverse images of the patterns in the trees above are cast on the land below.MO actorN;?MO actorN_A&The glass is very warm beneath your !> touch  fingersS. Between smooth stretches are dents and bumps caused by the underlying layers. TT.  77reflection of a butterfly in shades of red and yellow This butterfly is fashioned after one that you created for your meadow, even down to the yellow figure eight markings upon its crimson wings. Its antenna points straight towards its flowered meadow. MO actorN-JMO actorNQL&The glass is very warm beneath your !> touch  fingersS. Between smooth stretches are dents and bumps caused by the underlying layers. U0.  22reflection of a book of turquoise and blue glass The reflection of a book with covers in turquoise and shades of blue that range from soft sky to deepest sapphire. The sliver of a sheet points towards the nearby lake. MO actorN TMO actorN.V&The glass is very warm beneath your !> touch  fingersS. Between smooth stretches are dents and bumps caused by the underlying layers. V.  reflected flower A blue flower with shades of green and yellow for the stem and spiralling leaves. The blue rose seems to spring from the ground itself. MO actorN_MO actorNa&The glass is very warm beneath your !> touch  fingersS. Between smooth stretches are dents and bumps caused by the underlying layers. W.   The tree limbs, from thickest branch to smallest sliver of a twig, twist and twine around each other in elaborate patterns. Beautiful patterns. Unnatural patterns. MO actorNjMO actorNlYou place your palm against a tree trunk, for the lowest branch is high above your reach, and find it strangely cool to your touch. The tree bark is flawlessly black and smooth and chimes musically, metallically when you tap it. -zMO actorNn[The trees do not smell of living wood, but of sand and glass with a metallic tang to it. XJ;  twinkling of the fireflies You watch the fireflies blink and twinkle at each other, each flash of color a message in itself. Studying them... concentrating... \b \t North...\b \t north...\b \t it...\b \t comes...\b \t ...from the north. You watch the fireflies blink and twinkle at each other, each flash of color a message in itself. Studying them... concentrating... \b \t North...\b \t north...\b \t it...\b \t comes...\b \t ...from the north. /MO actorN.MO actorN#rListening to the fireflies is an execise in futility. Perhaps if you were to examine their blinking messages...?YJ   the north,  the north //A prickle runs down the back of your neck as you gaze towards the north. The skies there are darkening and have been for some time... You cast your senses as far as you are able, but find nothing. It seems you'll find out what it is soon enough. Whatever it may be comes straight towards your domain. /MO actorNx.=MO actorNThe north is eerily silent. Z  .  scattering of fireflies A host of fireflies floating delicately in the air and blinking colored messages to each other. Crimson, gold, sapphire blue, jade, turquoise, royal purple... understanding flickers at the edge of your mind./MO actorN.MO actorN;rListening to the fireflies is an execise in futility. Perhaps if you were to examine their blinking messages...?MO actorN:MO actorNA gentle brush of wings. UMO actorO6 selectionNF<n@NFn`_^]\[[,.  **turquoise fireflies blinking in the wind LLA scattering of turquoise fireflies flash blue-green light at each other. MO actorN7:MO actorN9A gentle brush of wings. MO actorOxN<>" EN=6You catch a turquoise blinking firefly in one hand. HN?<The turquoise firefly lands obediently on your shoulders. N@gZNA&\,.  --royal purple fireflies blinking in the wind 44Purple fireflies circle around the colored glass. MO actorN:MO actorNA gentle brush of wings. MO actorOxN>" BN3You catch a purple blinking firefly in one hand. EN9The purple firefly lands obediently on your shoulders. NiZN>[[N&],.  ((crimson fireflies blinking in the wind 88A few crimson fireflies darting amongst the branches. MO actorN:MO actorNA gentle brush of wings. MO actorOxN>" CN4You catch a crimson blinking firefly in one hand. FN:The crimson firefly lands obediently on your shoulders. NeZN>[[N&^.  %%jade fireflies blinking in the wind //Jade fireflies flicker in between the trees. MO actorNh:MO actorNjA gentle brush of wings. MO actorOxNm>" ANn2You catch a green blinking firefly in one hand. DNp8The green firefly lands obediently on your shoulders. NqhZNr>[[Ns&_8.  ..sapphire blue fireflies blinking in the wind CCA handful of sapphire fireflies hover in the shade of the trees. MO actorN :MO actorNA gentle brush of wings. MO actorOxN>" @N1You catch a blue blinking firefly in one hand. CN7The blue firefly lands obediently on your shoulders. NfZN>[[N&`$.  ''golden fireflies blinking in the wind 33Many golden fireflies light up beneath the trees.MO actorN:MO actorNA gentle brush of wings. MO actorOxN>" BN3You catch a golden blinking firefly in one hand. EN9The golden firefly lands obediently on your shoulders. NaZN>[[N&a$  <6M  glittering golden firefly glittering golden firefliesMN< > 4N%A golden firefly hovers in the air.N<  HN9A golden firefly contentedly perches on your shoulder. WNKA dark bug with a bright red head and belly full of golden luminescence. MO actorNsMO actorNoThe carapace of the firefly is hard but fragile feeling. Its little legs tickle as it runs across your skin. +y ||You pop a squirming firefly into your mouth and crunch down. Squish. That was not enjoyable, on so many different levels. MO actorNMO actorN> b D > c D > d }NBYou decide it wouldn't be wise to dispose of that now.. without !< ! you might become lost in here!N)bL   A' Cavern  \(Cavern\)MN8\bYou stand within a wide cavern, twice as tall as your human form with far flung walls that fade into shadow. The familiar engravings that scroll throughout the stone walls are overlaid with a lustrous material that catches the light and throws it back at you. A steady wind blows through the cave, bringing with it the tang of water as it ruffles through your hair and clothes.\b The cavern breaks off into three smaller tunnels. One to the west, one to the north, and one to the south.* You listen to wind as it keens high and low through the subterranean tunnels. You never quite understood why the breezes sound so sad. O9MN8<! N 8x\b You fumble around in the darkness, somehow end up turned about, and stumble out once more into the light of day. \b>N 8You squeeze back through the narrow tunnels and, blinking, emerge from the cave mouth and once more into the light of day. \b MN 8<! N8x\b You fumble around in the darkness, somehow end up turned about, and stumble out once more into the light of day. \b>jN8XYou phase through the stone cave walls and find yourself back within the red hills. \bNKMN8<! N8x\b You fumble around in the darkness, somehow end up turned about, and stumble out once more into the light of day. \b>N8Light held high, you wander down the silent northern passageway. With each step the scrollwork through the stone becomes more intricate and numerous; the glow of the engravings growing brighter and brighter until it seems that they burn with a phantom fire of their own. Finally you come to a plain blank wall... the end of the passage. With a shrug, you shift through the wall and enter...\b |QfMN8<! N8x\b You fumble around in the darkness, somehow end up turned about, and stumble out once more into the light of day. \b>N8You walk down the western passage with the wind tugging and playing at your clothes. The engraved patterns grow sparser as flues begin to pepper the surrounding stone. The wind mutters and trickles and blasts from the differently shaped chinks as you wander further and further down the tunnel. \b Finally the whispering stone falls back as you enter a colossal cavern and find yourself on the banks of a subterranean lake. \bcS You sink into the embrace of the earth. Quiet serenity as your land cradles you close-- but now is not the time to rest. You ascend back to the surface... or rather, back to the subterranean caves. R You tilt your head up towards the heavens-- or rather where the heavens would be, past the stone bulk of the cave. Allowing your corporeal body to dissolve away, you slowly drift upwards, past the stone of caves and tunnels, slowly, slowly upwards to the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.MO actorN 8FMO actorN "8<! N #8x\b You fumble around in the darkness, somehow end up turned about, and stumble out once more into the light of day. \b>N %8You squeeze back through the narrow tunnels and, blinking, emerge from the cave mouth and once more into the light of day. \b c  A' Subterranean Lake \(Subterranean Lake\) [[\b You are dwarfed by the sheer size of the cavern that is dominated by this underground lake. The engravings have grown fainter in the stone that rises and encircles for hundreds of feet on all sides. On the opposite shores of the lake, nine titanic gaping flues moan as they continuously stream wind into the chamber. Despite this, the dark waters of the lake remain still and undisturbed. \b Three trails circle the lake. One leads around the bank towards the south, one path rises upward along the stone walls and disappears into a dark opening above, and another leads into a tunnel to the east. * You listen to wind as it keens high and low through the subterranean tunnels. You never quite understood why the breezes sound so sad. OdMNQ8You walk along the stone shores circling the subterranean lake. Except for the narrow path, the ground is uneven with layers of rock overlapping until they reach the waters edge. The trail ends directly in front of the nine carven flues; you pause and stand there for a moment as the great streams of winds buffet you from side to side. \b Unseen from the opposite shore, there is a narrow staircase that leads up into the mouth cavern of the dragon flue. NR8|" NS8It's a bit of a struggle to climb up those stairs and make your way through the passage all the while as the wind is trying to bodily blow you back across the lake. Finally you come to the chamber at the end of the windy passage. \bdrNU8fA gentle wind sweeps across the passageway as you make your way back to the Chamber of the Winds. \bdpMNV8XYou phase through the stone cave walls and find yourself back within the red hills. \bPMNZ8You walk down the southern passage with the wind pushing at your back. The engraved patterns once again begin to fill the stone walls in between the few flues still dotting the surface. \b Finally you emerge into another cavern. \b bS{MN_8_You plunge into the dark depths of the subterranean lake. The waters pour over your head and you are consumed. \b You are falling through darkness. The night sky spins all around you, stars blaze by within easy reach as the earth turns about you. Up is down, down is up and you...\b ... suddenly find yourself within the clear waters of the lake. \b>RMNa8You carefully walk upwards, following the path that overlooks the lake. Below you, the still dark waters are full of pinpricks of phosphorescent light, and it is disorienting, as if you were looking down upon a clear night sky. You press onwards, into a tunnel whose blank stone walls close in around you, narrower and narrower until you are once again crawling on hands and knees.\bNc8>" Nf8JAnd then the scent of burning wood fills your nostrils and you push aside a pile of smoldering timbers and crawl out of the ash-filled hole. You shake free of the dark flakes that coat your entire body and step back outside into the sunlit courtyard. \b "You should be careful. Its dangerous to be poking around in there yet. " !>FB calls out to you when he notices you emerging from the tavern. {Nj8oAnd then the scent of cabbages and potatoes, of dank earth and musty barrels, fills your nostrils and you push aside a crate and pop out of a small hidden hole. Brushing yourself off, you step back into the tavern proper, where the patrons still chatter amongst themselves. One of the old men notices you and waves.\b "Din't see y' come in, " he says cheerfully. \bd  A' Chamber of the Winds \(Chamber of the Winds\)MN29w\bA round chamber of middling size, empty save for the faintly glowing engraved patterns that cover its stone walls. N39>|" vN59g... Nay, that's not exactly true. The chamber is full of a wild wind that howls and shrieks as it tears about the room, rattling at the stone walls and stealing your breath away bit by bit. \b And you can almost see it, the palest of pale outlines in the center of the chamber. The wind writhing and contorting about itself, its shape blurring and faint. \bWN79KUnseen and silent, a gentle zephyr can be felt playing about the room. \bN89PThe only way to leave this place is to return the way you came, to the north. *MN:9>|" LN;9=The wind wails and weeps as it thrashes about the chamber. ;N=9/The zephyr is too gentle to make such noise. pMN?9XYou phase through the stone cave walls and find yourself back within the red hills.\b NMN@9You turn your back to the wind once more and it helps you along the way. It seems almost as if you fly back to the shores of the underground lake. \bcS You sink into the embrace of the earth. Quiet serenity as your land cradles you close-- but now is not the time to rest. You ascend back to the surface... or rather, back to the subterranean caves. R You tilt your head up towards the heavens-- or rather where the heavens would be, past the stone bulk of the cave. Allowing your corporeal body to dissolve away, you slowly drift upwards, past the stone of caves and tunnels, slowly, slowly upwards to the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.e  <6M  creeping crimson firefly creeping crimson firefliesMN< > 5N&A crimson firely hovers in the air. N<  ^N,A crimson firefly crawls up and down your !> wingarm.PNDA dark bug with a bright red head and belly full of luminescence. MO actorNMO actorNoThe carapace of the firefly is hard but fragile feeling. Its little legs tickle as it runs across your skin. +y ||You pop a squirming firefly into your mouth and crunch down. Squish. That was not enjoyable, on so many different levels. MO actorNMO actorN> b D > c D > d }NBYou decide it wouldn't be wise to dispose of that now.. without !< ! you might become lost in here!N)f8  <6M  blinking blue firefly blinking blue fireflies WWA blue firefly rushes to and fro, its little wings and legs moving in a little dance.MO actorN#MO actorN%oThe carapace of the firefly is hard but fragile feeling. Its little legs tickle as it runs across your skin. +y ||You pop a squirming firefly into your mouth and crunch down. Squish. That was not enjoyable, on so many different levels. MO actorN(MO actorN&*> b D > c D > d }N&+BYou decide it wouldn't be wise to dispose of that now.. without !< ! you might become lost in here!N&-)gx0 0 0<6M  trembling turquoise firefly trembling turquoise firefliesMNL< > <NM-A turquoise firefly flits through the air. /NN<  eNO2A turquoise firefly holds unto the back of your !> wing hand.NQA dark bug with a bright red head and belly full of swirling blue-green luminescence. The way that the blue and green bleeds and melds into each other is almost hypnotic.MO actorNTMO actorN!VoThe carapace of the firefly is hard but fragile feeling. Its little legs tickle as it runs across your skin. +y ||You pop a squirming firefly into your mouth and crunch down. Squish. That was not enjoyable, on so many different levels. MO actorN=YMO actorNa[> b D > c D > d }Na\BYou decide it wouldn't be wise to dispose of that now.. without !< ! you might become lost in here!Na^)h  <6M  jumping jade firefly jumping jade firefliesMN~< > 1N"A green firefly blinks rapidly. N<  cN,A green firefly scurries up and down your !>breast tunic. VNJA dark bug with a bright red head and belly full of green luminescence. MO actorNMO actorNoThe carapace of the firefly is hard but fragile feeling. Its little legs tickle as it runs across your skin. +y ||You pop a squirming firefly into your mouth and crunch down. Squish. That was not enjoyable, on so many different levels. MO actorNMO actorN> b D > c D > d }NBYou decide it wouldn't be wise to dispose of that now.. without !< ! you might become lost in here!N)i  <6M  pretty purple firefly pretty purple fireflies'MN<  ;N,A purple firefly crawls along the ground. N<  YN!A purple firefly hides in your !> feathers hair. \NPA dark bug with a bright red head and belly full of pale purple luminescence. MO actorNMO actorNoThe carapace of the firefly is hard but fragile feeling. Its little legs tickle as it runs across your skin. +y ||You pop a squirming firefly into your mouth and crunch down. Squish. That was not enjoyable, on so many different levels. MO actorNMO actorN> b D > c D > d }NBYou decide it wouldn't be wise to dispose of that now.. without !< ! you might become lost in here!N)jJ m far southern pale trees --Trees to the far south are washed of color./MO actorNs.=MO actorNThe forest is too far away. koooJ m  meadows <<Green extends into rolling meadows towards the southwest. lJ m far western dark trees MMThe shadowed form of trees makes a dark spike against the sky to the west. mJ m sea of grass A sea of grass that shimmers and undulates even more than the waters before you. Darkened cloudheads loom in the skies far north, beyond the plains. nd###J m aura of colors to the east, an aura of colors to the east OOAn aura of rainbows to the east with the slightest glimmer of light on water./MO actorN3.?MO actorN4 The fountain is too far away. odddJ m border,  your borderMN>> m KN?<To the northwest there is... emptiness. The Beast is gone!NAYou can sense, at the edges of your lands, the line where your influence ends and the Beast's begins. The Beast presses ever inward but you easily hold your border steady. p4J m border,  your border HHYou can sense farther to the north and west, the edges of your lands. /MO actorNI.<MO actorNJThe tree keeps its silence.q./ m ground,  the groundMMNSThe ground that gently slopes to the edges of the lake is green and thick with vegetation due to the moist, rich earth. Besides the ankle length grass, the waters are ringed by tiny twisted little trees, no taller than your knees.NU<m" CNV7\b A small hole has been dug amongst the tiny trees. 1MO actorNW0MO actorNYr]NZNYou carefully scavenge through the tiny trees but find nothing of interest. [N\8You carefully scavenge through the tiny trees to find !r."m%MOactoriobjN]-MOactoriobjN^DAMN!myMO actorN bzMO actorN.d<m" 8N.e#You fill in the hole once again. !m7N.g+There are no holes to be filled in here. >MO actorNh?eMOactordobjNi You bury !  amongst the tiny trees. r&-MO actorNUliThe ground smells moist with living things. There is a faint tang in the air, the scent of wild water. MO actorNmMO actorNoYou brush your !> feathers  fingers0 through the grass and it prickles your skin. @>A?rE. m groundyMO actorN1wz^MO actorNUy>qm" 7NUz#You fill in the hole once again. !qms(J m sky,  the skies The sky above you is a bright blue, incandescent with light from the sun. The scattering of puffy clouds that graces the sky growths thicker and darker to the north. t,J m clouds,  the clouds The clouds floating above you are fluffy and puffy, piling one atop the other until they form towering mountains of ethereal vapor. One such formation looks a bit like a frosty white flame and another, slightly overlapping, has the wispy swirls of a flower in full blooms, yet wait... with the gently blowing winds, the flower has now transformed into a trea whose leaves break off and blow away right before your eyes. ul,,,J m,  the sun sunMNRThe sun, high in the sky, is reflected perfectly within the waters of the lake. N> > E >q" `NT"Tis dangerous to stare at the sun like that," Val says he gazes at you sideways. "qvL   J m reflection of the sun You gaze into the fiery reflection floating within the clear waters of the lake and its as if you are looking straight into the heart of the sun. The light burns into your eyes, seems to pool within the back of your head, and then the image inverts and for a moment it's as if you are gazing into a perfect black hole of nothingness. \b The darkness expands to cover your sight and then lightens, fades gently away, and you are somewhere else, gazing down upon strange lands rolling swiftly beneath you. Color leeches from the skies, the ground bleeds green away into grey, and the land is screaming, shrieking, burning... dying, its fey is dying, they are being torn apart, the land... the fey... rended into nothingness. \b Dark clouds are billowing upwards, being belched from the shuddering hills as they die, and something is standing in their midst, something in white, flowing white, bone breaking white, someone...\b A name. Its almost upon you. A burning ball within your brain, lightning at the tip of your tongue and... it feels you. It notices you, its power reaching up towards--\b You blink and you are standing by the shores of the lake, a perfect reflection of the sun caught within its clear waters.w@.: m entire thicket of tiny trees Upon first glance these waist-high trees could be mistaken for mere bushes, but indeed they are minatures of the trees within the white woods, exact in every way save for their normal pigmentation. -MO actorNbThe bonsai trees smell of living wood and sap far more strongly than their larger counterparts. MO actorNMO actorNkTiny twisted trunks are rough to the touch, little dwarf leaves are feathery brushings against the skin. MO actorNPYou don't want to destroy your bonsai tree forest by digging them all up, do you? Not after you spent all that time getting them perfect!xt333:M m one twisted little tree, one twisted little tree mmA miniature tree, less than an arm's-length long from the tip of its tiny leaves to its dirt-clogged roots.-MO actorNThe bonsai tree smells heavily of living wood and sap, far more strongly than itd larger counterpart in the White Willow Forest. MO actorN~MO actorNoIt's tiny twisted trunk is rough to the touch, little dwarf leaves are feathery brushings against your skin. yD:Mx carved jade butterfly __A flat jade carving, little larger than your fingernail, of a butterfly with wings outspread.-sMO actorNTThe jade butterfly smells heavily of the living wood and sap of the bonsai trees. MO actorN MO actorND>" DND5You brush your feathers across the jade butterfly. NDYou brush your !>talons  fingers@ over the carved whorls and slants of the butterfly figurine. 3MO actorN6Turning the jade butterfly over reveals another carving etched within its abdomen. It looks to be another butterfly, with shorter, stubbier wings. Or... perhaps a moth? zL   :Mw carved jade scarab xxA rounded carving of a small jade scarab. Gold touches the back of the beetle in the shape of a perfect figure eight. -pMO actorNQThe jade scarab smells heavily of the living wood and sap of the bonsai trees. MO actorN3MO actorNW>" @NW1You brush your feathers across the jade beetle.kNW_You run a fingernail across the faint carved line that marks the edges of the scarabs wings. 3MO actorN-Turning the jade scarab over reveals another carving etched within its abdomen. A different sort of insect altogether, with an elongated body and a pair of oversized legs... a locust. {:Mw carved jade firefly wwA dark little carving of a jade firefly. The figurine of the insect looks dull and empty without its customary glow. -qMO actorNRThe jade firefly smells heavily of the living wood and sap of the bonsai trees. MO actorN4MO actorNX>" @NX1You brush your feathers across the jade firely.:NX.You finger the jade carving of the firefly. 3MO actorNTurning the jade firefly over reveals another carving etched within its abdomen. A fat little honeybee, little lines of delicate etchings covering its body to show its fuzziness. |  . m moist green grass ddThis ordinary, if pretty green, grass is the least interesting thing to be examining in this area.MO actorN GMO actorN (The grass prickles against your skin. -8MO actorN A healthy green scent. y LLYou pop a stem of grass into your mouth. It is sweet-- for grass, anyway. mMO actorN >" FCYou shouldn't overburden yourself with items while in this form. nMO actorOxN( !You pull free a tuft of grass. N( }ZN( &}  <M  tufts of ordinary green grass tuft of ordinary green grass <<A tuft of ordinary green grass, ankle length and uprooted.MO actorN GMO actorN (The grass prickles against your skin. -8MO actorN# A healthy green scent. +y LLYou pop a stem of grass into your mouth. It is sweet-- for grass, anyway. ~  J# m  dark islandTMN+ The surface of the small island forms a perfect half circle within the lake, like a black pearl inset into a mirror. The grounds of the isle are stark and dark, empty save for the lone tree that dominates the area. N, > m UN- I\b The blue petals of the dark tree tremble and whisper to each other. /MO actorN. .=MO actorN/ The island is too far away. MO actorN0 MO actorN2 pYou skim quietly across the peaceful lake, only tipping a toe or two into the cool waters along the way. Beneath you there is the glint of scales as fish flash on by, a whirl of colors from the coral and anemones and trailing water plants, the faint shimmer of rainbows caught underneath the waters.\b Without a sound, you land upon the dark shores of the island. \b>MO actorN3 MO actorN4  Barren black bearing blue blossoms... you'd certainly been enamoured with the letter 'b' when you created this place. All you'd need is for the water to bubble for ambiance...LJ m single black treeMN= The bark of the black tree blends into the surrounding dark ground such that it is near impossible to tell where tree begins and land ends. From a distance, with its lovely blue petaled leaves, the tree resembles nothing so much as a lone flower in bloom. N> > m oN? c\b Before your eyes the the leaves of the dark tree tremble and flare, seeming to beckon to you. 8  J m wind FFThe air is cool to the touch with only the barest hint of a breeze. rMO actorNyI SThe air is ephemeral here, only a faint shadow of the liquid luster of the lake. -9MO actorNK The tang of pure water. /MO actorN0L .MMO actorNTM .You hear nothing in the silence of the air. MO actorNN (MO actorNO >./_^ pure waters of the lake2MN_ iLight glimmers on the still surface of the lake. A perfect reflection of the sun floats in the water below. Your own image is hazy and indistinct, little more than a colorless blur.\b The waters of this lake are so pure that you can easily see down to its pale sandy bottom dozens of feet below with only the faintest shimmer of distortion. Large lake kelp trail fronds through the water, so tall that their tips almost brush the surface. Other plants and seaweed in varying shades of green, and purple, and blue sway back and forth slowly in an unseen current. Tiny fish with colored metallic scales dart in between columns of coral reefs, scattering of shells, and smoothly shaped stones.\b Sea inhabitants and those of fresh water, and a few things that shouldn't exist in either. Everything seems so clear and close, as if you could easily reach out and touch them.\bN` < DNa )Floating on the waters of the lake are !.Nb < CNc (Floating on the waters of the lake is !./MO actorNd .BMO actorNe #The waters are still and silent. uEMNg >" Nh pYou dip your beak into the pure waters of the lake. The water that rushes down your throat is sweet and cool. Nj You kneel by the shores of the lake and, cupping your hands, dip into its pure waters for a sip. The taste is sweet and cool, the purest of waters in your land.CMO actorN;n tWith a flutter of dark wings you plunge underneath the cool waters of the lake. You are breathing in the cool waters into your lungs, filling you with a crispness that no air could ever hope to achieve. \b Bubbles float around you, above you, the plants reach out to caress you, and all colors seem brighter that ever before. You drift down to the bottom of the lake. \b>MO actorNo MO actorNs You wade into the lake, the chilled waters rising up to your knees, and then walk down the slight incline, the waters rising higher and higher until they are above your head and you are breathing in the cool waters into your lungs, filling you with a crispness that no air could ever hope to achieve. \b Bubbles float around you, above you, the plants reach out to caress you, and all colors seem brighter that ever before. You drift down to the bottom of the lake. \b>MO actorN t 4MO actorN+ x j Light glimmers on the still surface of the lake. A perfect reflection of the sun floats in the water below. Your own image is hazy and indistinct, little more than a colorless blur.\b The waters of this lake are so pure that you can easily see down to its pale sandy bottom dozens of feet below with only the faintest shimmer of distortion. Large lake kelp trail fronds through the water, so tall that their tips almost brush the surface. Other plants and seaweed in varying shades of green, and purple, and blue sway back and forth slowly in an unseen current. Tiny fish with colored metallic scales dart in between columns of coral reefs, scattering of shells, and smoothly shaped stones.\b Sea inhabitants and those of fresh water, and a few things that shouldn't exist in either. Everything seems so clear and close, as if you could easily reach out and touch them.\b^kMOactordobjN z  N } tYou gently release the toyboat upon the still waters of the lake. For one moment it simply floats there, tipping back and forth as droplets of water slosh over its sides. And then it spins about, translucent sails unfurling outwards, and it glides away across the lake, faster and faster until its prow points upwards, towards the sun. \b Sails shimmer iridescently as they snap full of an unfelt wind. The toyboat skips lightly across the water and then with a graceful leap its arches into the air, tiny hull shuddering slightly as it sails upward, higher and higher, until with one final glimmer it disappears into the sun.>&N ~ D! ON The !! sinks silently into the lake. &QN The !. bobs merrily upon the surface of the lake. )^JMO actorN+ K6MO actorNO Carefully you step out unto the water, the surface shivering slightly beneath your feet.You lightly traipse across to the island, legs moving so swiftly that you almost seem to dance. \b>NO > > :NO .Val watches you silently from the shores. \btGMO actorN You gracefully slide into the lake, the chilled waters gently cupping your flesh as you luxuriously loll about. The drowned garden of sea plants and coral rolls beneath you, the bright blue sky hanging above you, and the center of the lake can be reached within a few easy strokes.\b >MO actorN MO actorN fYou stride boldly out into the midst of the lake, allowing the waters to support you as they can. \b>N > >  OYou turn about and meet Val's level gaze with a challenging one of your own. ` mt444M H  toy boat hhA simple boat carved out of a hollowed block of wood. Someone has painted a smiling face on its side. MO actorN/6MO actorN/Rough and splintery. -0MO actorN/Perfumed wood. )' Still Surface of the Lake \(Still Surface of the Lake\)+ ((The pure tang of water surrounds you. MNn!P\b You are floating atop the still surface of the lake. Gentle ripples expand around your body and disappear long before they reach the lake's shores. The depths of the lake lay tantalizingly close beneath you... forests of kelp and brightly colored coral, all teeming with fish, all seeming to be within the space of a short dive. \bNo!> m tNp!hVal eyes you from the green outer shores, his gaze flickering between you and the skies to the north. vMNq!^You continue on your way, gliding easily to the dark island within the heart of the lake. \bR zzYou tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.SUMNu!9With a single thought you begin to sink into the embrace of the lake. With nary a ripple the cool waters swallow you up, closing over your head.\b Bubbles float around you, above you, the plants reach out to caress you, and all colors seem brighter than ever before. You drift down to the bottom of the lake. \b>X  )' Still Surface of the Lake \(Still Surface of the Lake\)+ ((The pure tang of water surrounds you. pMNX!V\b You are standing on the water's surface, its clear calm expanse surrounding you. NY!>" @NZ!1A gentle breeze ruffles through your feathers. N[!>" E >" YN\!JA gentle breeze ruffles through your hair and faintly chills your body. XN]!>" DN^!8A faint breeze ruffles through your hair and clothes. N_!eBelow your feet several small fish have gathered and are currently staring up at you in curiosity. N`!> m gNa![Val watches you from the shores of the lake with an unreadable expression upon his face. vMNb!^You continue on your way, gliding easily to the dark island within the heart of the lake. \bR zzYou tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.SUMNf!9With a single thought you begin to sink into the embrace of the lake. With nary a ripple the cool waters swallow you up, closing over your head.\b Bubbles float around you, above you, the plants reach out to caress you, and all colors seem brighter than ever before. You drift down to the bottom of the lake. \b>MO actorNZh!You bend over and brush your !> feathers  fingersT across the surface of the lake. Its like touching chilly glass, fragile and wet. x7 7 7J m !!your reflection within the lake, !!your reflection within the lake !!your reflection within the lake The waters of this lake reflect only the truth and so it shows your real form... an ever shifting gossamery bit of nothingness, without color nor shape./MO actorN6 .BMO actorNZ #The waters are still and silent. MO actorN nMO actorN OYou have not lost yourself and so you have no need for this mere reflection. 87 7 7J bottom of the lake, the bottom of the lake Pale sands touched with just the faintest hint of gold cover the bottom of the lake in dips and gently rolling hills. Scattered thickly amongst the grains are colonies of brightly colored coral and wreaths & trails of aquatic plants./MO actorNB .BMO actorNf #The waters are still and silent. MO actorN RMO actorN 3You'll have to get a bit wet in order to do that!` m@>>>J m shimmer of distortion The bending of the rays of the sun as it touches the water, the faintest shifts of the current, and the play of light and shadow on the colors./MO actorN .BMO actorN #The waters are still and silent. ` m  J m tumbled pebbles, the tumbled pebbles Pastel stones lay tumbled about the lake bottom. From smallest pebble to largest rock have been worn into smooth and flowing shapes by the waters. /MO actorN .BMO actorN #The waters are still and silent. MO actorNZ RMO actorN~ 3You'll have to get a bit wet in order to do that!` m  J  little fish, the little fish Little fish with glinting scales can be seen darting about beneath the calm surface of the waters. Other fish, larger and with long flowing fins, hover within the shadows of the coral. /MO actorN .BMO actorN( #The waters are still and silent. MO actorNp RMO actorN 3You'll have to get a bit wet in order to do that!` m  J m trails of kelp, the trails of kelp Tall plumes of kelp in varying shades of green and blue with threads of yellow-green. They sway slowly underneath the waters edge./MO actorN .BMO actorN #The waters are still and silent. MO actorNG RMO actorNk 3You'll have to get a bit wet in order to do that!` m|y y yJ m underwater vegetation, the underwater vegetation Gazing straight down into the waters clear depths, many different kinds of vegetation can be spied. Thin coverings of colorful algae cling to solid surfaces, clumps of seaweed sprout from stone and coral, and sea grasses carpet the ground, sprinkled with sponges and blooms of anemone./MO actorN!.BMO actorN!#The waters are still and silent. MO actorN!RMO actorN!3You'll have to get a bit wet in order to do that!` mTT T TJ# m columns of coral reefs, the columns of coral reefs A lacework of coral covers the sands of the lake bottom. Spirals and columns, fringes and globes, lowlying and tall, all in varying shades of colors. /MO actorN!.BMO actorN%!#The waters are still and silent. MO actorNm!RMO actorN!3You'll have to get a bit wet in order to do that!MO actorN!4MO actorN!These species should be living in the sea, not within a freshwater lake, or so you have read or been told. You are not certain if you have their shapes and forms quite correct... alas, there is quite a dearth of information on things from the sea in this landlocked kingdom. ` m  J m scattering of shells xxA scattering of shells, pepper the bottom of the lake. Spirals, flat coils and rounded whorls, not all of them empty. /MO actorN,!.BMO actorN-!#The waters are still and silent. MO actorN'.!RMO actorNK/!3You'll have to get a bit wet in order to do that!` m44 4 4J m still surface of the lake, still surface of the lake eeThe surface of the lake lays perfectly still, allowing you a nearly flawless view into its depths. /MO actorN!MO actorN^@!>" NN^A!?You dunk your beak fully into the chilly waters of the lake. `N^C!TYou dip your hands into the lake and allow its waters to run through your fingers.` mJ  depths of the lake, the depths of the lake The waters of this lake are so pure that you can easily see down to its pale sandy bottom dozens of feet below with only the faintest shimmer of distortion. Large lake kelp trail fronds through the water, so tall that their tips almost brush the surface. Other plants and seaweed in varying shades of green, and purple, and blue sway back and forth slowly in an unseen current.\b Tiny fish with colored metallic scales hover in the water mere fingerwidths below your feet, gaping up at you in curiosity. /MO actorNY!.BMO actorN}!#The waters are still and silent. ` ` ` ` ` ` ` ` ` uuu QQLittle fish with glinting scales can be seen darting about beneath the calm surface of the waters. Other fish, larger and with long flowing fins, hover within the shadows of the coral. Several of the smallers ones have drifted closer to the surface, every now and then poking their mouths above the water to try nibbling at your feet. m m mJ  Val, ValMN!> m N!~Val stands upon the shores of the lake with his dark cloak slightly flaring in the gentle wind. His eyes are riveted to you.aN!UThe thought of the mysterious mage crosses you mind, but he is no where to be seen./MO actorNE!.8MO actorNi!Silence from the mage. MO actorN!MO actorN!As you were never much of one to shout out conversations at the top of your lungs, Val is a bit too far away to converse with..  dark barren soilMN!yThe soil of this small island is loose and crumbly, black colored and barren of all vegetation save for the lone tree. N!<m" AN!5\b A small hole has been dug into the dark ground. 1MO actorN!0 MO actorN?"qN?"bYou carefully dig around the ever present roots of the dark tree, but find nothing of interest. nN?"KYou carefully dig around the ever present roots of the dark tree to find !."mmyMO actorNX"zMO actorN|"<m" bN|"MYou press down on the earth until the ground is perfect smooth once again. !m7N| "+There are no holes to be filled in here. >MO actorN> "?aMOactordobjNb " You bury !  in the dark ground. &@>A?MO actorN"vMO actorN"WLoose and crumbly and not quite as moist as one would expect on such a small island. -]MO actorNy">It smells of earth with a faint underlying sweetness to it. mMO actorN">" FCYou shouldn't overburden yourself with items while in this form. }MO actorOOxN_"0You reach down and cup a handful of darksoil. N_"ZN_"& E.  groundyMO actorN1"zMO actorNU!">m" aNU""MYou press down on the earth until the ground is perfect smooth once again. !mM handful of dark soil handfuls of dark soil HHA handful of dark soil, freshly scooped from the small barren island. MO actorN,"vMO actorN."WLoose and crumbly and not quite as moist as one would expect on such a small island. -]MO actorNB0">It smells of earth with a faint underlying sweetness to it. +4   *.   dark treeMN7"sThe bark of this tree is a deep charcoal black, its surface crackled and lightly splintered with fine intertwining webs of splits and cracks. The bright blue leaves resemble petals, clustered around little diamond specks of fruit.\b The thick knobby roots of the tree writhe and twine around the island so that it is difficult to tell where tree begins and island ends.N9"> m N:"D<.MN?"<   sitting in offOMNA"7You slide out of the tree and back to the dark earth.R {{You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.MO actorNE"MO actorNF"bCarefully, gently, lest you disturb the it, you slip up amongst the trees many dark branches. \b>MO actorNG"MO actorNH"bCarefully, gently, lest you disturb the it, you slip up amongst the trees many dark branches. \b>BCMO actorNrJ"FMO actorNL"'Smooth between the jagged splinters. -9MO actorNN"A haunting sweet scent. /MO actorN!O".MO actorNEQ"> m 2NER"#The dark tree keeps its silence. NEa"You lean close and listen to the whispering of the tree. \b \t"It comes... \n \tits comes... \n \tmy keeper. \n \tIt is here. \n \tTurn around...\n \tand fight..."\b Azure blossoms silently fall from the tree as it pulls its roots free and winds them close. And to the north you feel the death of the Fey Tree. A scream, more felt than heard, and a release of great power... like a silent explosion and to the north... something... was... \b Across the waters of the lake, Val waits upon the verdant shores, his gaze also drawn to the north. He makes a sound, half growl half cluck of a tongue, and his gaze drops to you. "I'm afraid we have run out of time," he says and as he comes forward the air about him, ripples and darkens, solidifies into the shadowed shape of a long flowing coat. \b The mage steps upon the lake and sparks flare beneath his feet. The water freezes as he walks across to you. \b>&&"CC>C>C>C>D Val2MO quipnoNLKN LAnd so the game ends...yN LCome and meet your doom...PN L0And were you the one to destroy the other fey?N L1I had grown tired of playing with you anyway...N L,Then I am pleased to truly meet you you...NL4Then I suppose we are both done playing pretend...[NL&If you thought the was impressive...(NLDon't call me that...NLI'll grind your bones...NL'Now try and impress me, Pookiebutt...NLSomeone like you?NLSo was that your plan?dNL'And such is the greed of the mages...0NLHave you no guilt.... NLAnd am I the main course?NL&So is this why you came, Trevalkian?NL$Between a rock and a hard place...NL!Perhaps we can strike a deal...RN L.Suddenly your presence is much preferable...N#L What?!?N$L,Are you asking what I think you're asking?N%LAre you crazy?N&L!And where did this come from...}N'LHow can I trust you?ZN(L,So is this what comes of the little boy...!N+LThis is a trick...N,LBut what will happen to me?N-LThere has to be another wayN.LThen why did you attack me?N0L+To tell you my name leaves me helpless...JN1LHow can I trust you... $N2L$Give me some sign of your faith...N4L I'm me!N5L Is this it?N6LI'm still here!N8L&Oh, how I adore being fought over...rN9L"I rather think I belong to me...CN:LI shall scorch you both!N>L&s!S   # < ZBvB\ !?"N#a$x%&5MO quipnoNCLK\4NDLw\b"And so the game ends", you say as you turn around to face Val. \b "And perhaps another one begins", Val replies.\bNELq4NGLl"Come and meet your doom, mage!" you tell Val coldly. \b The mage merely smirks and says "We shall see.\b">##y3NIL"And were you the one to destroy the other fey?" you demand. \b "Not I", replies Val. "I've been with you this entire time, remember?"\bNJLNKLd2NML^"I had grown tired of playing with you anyway," you say\b "More is the pity," Val replies.\bNNL>##NOLh1NQL"Then I am pleased to truly meet you" you say.\b Val gives you a slight bow. "I am Trevalkian. I only wish this was under better circumstances," he says\bNRLNSLK0NUL"Then I suppose we are both done playing pretend," you say. Val laughs. "Aye, enough games for now. Time to become serious, before it's too late."\bNVLNWL6/NYL"If you thought that was impressive," you say as you preen, dark obsidian scales gleaming in the sun. Your flare your wings into the air, letting them fill with the winds you have summoned forth, and with a powerful pump you glide free of the island.   >-N[L"Don't call me that," you roar as sparks of green fire boil free of your maw. Your flare your wings into the air, letting them fill with the winds you have summoned forth, and with a powerful pump you glide free of the island.   ,N]L"I'll grind your bones!" you snarl at the smirking mage. Val tsks. "Isn't that line rather trite after all these years?" he asks as he half crouches down in a defensive position.   >+N`L"Now try and impress me, Pookiebutt!" you taunt the mage. "I shall endeavor not to disappoint," Val replies as you sense a foreign power gathering around him.   >*NbLo"Someone like you?" you mock the mage. \b "Me? Not precisely. I came here for another reason..." Val replies.   )NeL"So that was your plan?" you demand. "I should have known!" \b "Nay, I am not the one doing this. I had hoped that, at the least, you would understand that"   (NgL"Such is the greed of mages." you say bitterly. \b "And of fey, " Val replies. "And of most creatures within this world. But only your kind and my kind can tear the world asunder with these desires."   m'NiL@"Have you no guilt for what you do?" you demand. "For many creatures consume the flesh of others, but only mages consume the soul." \b "That is something I think of every time" Val replies. "And believe what you will, I am not usually in the habit of holding conversations with the fey I know I will have to absorb."\b   %NlL"And what of I?" you ask. "At least I hope to be the main course and not some appetizer." Val moves as if to say something, but fall silent. "You will have to fight, for you are more than that." he finally says.    }$NoL"So is this why you came... Trevalkian?" you mock the mage. \b Val's lips quirk upwards. "Nay, as I told you... I came for another treasure... yet it seems that it is lost to me."   [#NrLA"Between a rock and a hard place," you mutter to yourself as Val rushes up to you. Painfully you struggle to your feet, not willing to meet the mage while lying on your belly. "Or is that from the frying pan into the fire?" you muse and try to decide if Val is pan or the fire. \b Val comes to a stop near your head, well within fire breathing range. Apparently insanity is quite catchable today.\b "I was afraid that I may have been too late. That you would have been consumed with--" \b "I am no easy meat," you interupt the mage. \b "No..." he says and his eyes soften. \b  NtLp"Perhaps we can strike a deal..." you pant as Val rushes up to stand by your head. Mages were notorious for their rivalry and dealing with one at a time would be far easier... as long as they-- "You aren't in cahoots with that other one?" you demand of Val. \b"Far from it," Val replies. "And I have a deal for you, if not perhaps the one you were thinking of..." \b NwL"Suddenly your presence is much more preferable," you tell Val as he rushes up to stand next to your head, well within fire breathing range. Apparently insanity is quite catchable today. \b "Is that so?" the mage says softly. "I had feared that I dawdled too long and may have been too late..." \b "Too late to consume me, yourself?" you ask idly as you pull yourself to your feet. You will not face the mage while lying upon your belly. \b "Nay," says Val and his lips press together in determination. \b NzL}"What?!?" you say eloquently. Val laughs lightly. "I am offering to bond with you. I think we would make good partners." \bN}L"Are you asking what I think you're asking?" you ask Val is an askingly way. "Aye, I am offering to bond with you. I think... we would make good partners." Val says gently. \b NL"Are you crazy?" you ask Val, as your neckfrills stand upright in shock. When you considered a deal, this was not precisely what you had in mind. "I have been told so, before." Val replies with a laugh. \bNL"And you have decided this, in one day?" you ask. "Where did this come from?" you wonder half to yourself. \b "You may not remember me, but I remember you. " Val says as you look upon him in puzzlement. \bNL"And how can I trust you so easily?" you demand of the mage. "This could so easily be another trick. " Val looks upon you a bit sadly. "I am sure your suspicions have borne you well over the years, but this may be the only way to save ourselves. sNL*"So this is what comes of that little boy I met, so many years ago?" you say. Val looks upon you in surprise. "Do you remember me then? For I have never forgotten you. You could say... that you made quite the impression on me that day. In every fey I have ever met I have always looked for you. "NL"This has to be a trick. " you mutter to yourself. \b "No trick," says Val. "If that was my reason, I could have taken you in long ago. " Yet his words meant to soothe seem instead to fill you with more suspicion. \bNLNL"But what will happen to me, if we do this? " you ask the mage. For while you have always had a keen interest with anything to do with mages and magickery and fey, there has never been an account of how a fey came to be bonded. And there probably is a reason for that. \b "Your link to your land will be broken and reformed as a link to me. " Val replies. "And so you will lose domination over this land, yet keep the brunt of the rest of your powers. All it takes is a sign of faith." \b tNL "There has to be another way. " you say. \b Val lowers his eyes "Aye, we can always go our separate ways and hope that one of us may defeat Lorekosi. But... I will not let him have you." The determination behind his voice touches you with a faintest of chills. \bNLNL"If this was always your intent" you ask suspiciously. "Then why in the nine hells did you attack me on the island?" \b "I had to know what your true intent was. If you really meant to harm me..." says Val. "And either we were both holding back there, or we are both utterly horrid fighters. For both our sakes, I hope for the former." \b You snort and wisps of smoke flit from your nostrils. You do not understand this mage-logic... Its not as if its hard to tell between those you wish to hurt and those you simply... play roughly with.\bNLNL"To tell you my name leaves me helpless!" you exclaim to Val. And you well know that he knows this, yet it buys you some time. \b "I know," Val says quietly. "But such things have only the power you put in them. We mages refuse to let others have this power and so our own names have no power over us. I will share my name with you and give you a new name... and you will never have to be afraid of your name again. " \b "A new name?" you ask suspiciously. "Not Snugglebums, is it?" And Val's eyes glint wickedly. \b "I said I'd share my own name... how about Pookiebutt?" asks Val\b "You are not filling me with enthusiasm," you tell the mage.   NL"How can I trust you?" you say. \b "It would be far easier for you to overwhelm me if you knew my name..." \b "Yet there is no other way," says Val.  NLNL"Give me some sign of your faith?" you demand. \b "There is nothing I possess that could ever equal the faith I ask of you now..." says Val. "All I can do is swear that no matter what your decision, I will protect you... \b  NLNL'"I'm me!" you exclaim in some surprise. \b "Of course, you're you." says Val. "Who else would you be?" \b "I could be part of you," you retort and test out your new me-ness. There is you and, somewhere knotted up in the back of your head, there is Val too. And yet something was missing--- \b#!"uNLNL"Is this it?" you ask somewhat doubtfully. \b "Aye," Val laughs. "Were you expecting the peal of trumpets and fireworks in the skies? The sky to fall and the mountains to tremble? We can try that later, if you wish...." \b You snort a faint plume of fire in reply and test out your new me-ness. There is you and, somewhere knotted up in the back of your head, there is Val too. And yet something was missing--- \b#!"NLNL"I'm still here!" you exclaim in some surprise. \b "Of course, you are." says Val. "Were you truly expecting me to absorb you when you weren't looking? If that was my game, I'm more than powerful enough not to have to resort to such trickery."\b "Foolish me for having such suspicions over mages," you retort dryly and test out your new me-ness. There is you and, somewhere knotted up in the back of your head, there is Val too. And yet something was missing--- \b"!#vNLNL"Oh, how I adore being fought over like a prized piece of cheese!" you exclaim. \b Val has the manners to at least looked suitably chastized. Lorekosi merely laughs. "How amusing," he says. "Well I do hope you both can give me a challenge."$%&=NLNL"I rather think I belong to me!" you interject. \b Lorekosi merely laughs. "How amusing," he says. "You belong to whoever has the strength to take you. "$%&[NLNLZ"Perish in my flames!" you roar. "I shall scorch you both!" \b Lorekosi merely laughs. NL>" NLVal eyes you. "I shall scorch you" you say to Lorekosi. "And lightly toast Val" you amend. \b "Thanks," Val says dryly. $%&NL& : H B  J,Gx_d0c /!P"#$%&<L  dark coat A long dark with a high, intricate collar and a flaring hem that sweep all the way to the ground. Elaborate mage designs have been embroidered in many different colors all along its edges. ZYxxqxqxD Val3JK6}[~\[\+3cMNBH>  E >  NCHc<cKMNDHNEHThe air jellifies around you, becoming thick and syrupy, trying to hold you in place. If you needed to breathe you probably would have suffocated. NFHNGHNHH\bVal waves his right arm and little flits of fire dance about your skin. Rather amusing, actually, compared to what lies within your power. NIH.NJHNKH\bThe ground beneath you erupts upward, forming into dark hands to clutch and grasp. They barely brush against you before disintegrating into nothing once again. NLHkNMHNNH\bThe skies above you spin about, clouds whirling past, yet not quite so fast enough to form a cyclone. What in the world is the mage trying to do?NOHNPHNQHq\bLightning arches across the sky, burning green fire as it falls. You do not know if that was you or the mage.NRH'NSHNTH\bThe still waters of the lake begin to roil and boil, growing cloudy and dark before all colors seeps from them once again. NUHNVHNWH\bColored tendrils arch from the fingertips of the mage, fall across you and binding for all of a moment before you burst free. NXHNYHNZH\bBubbles rise up from the ground, hovering iridescently within the air. You wonder what possessed Val to use his powers in this way until one bubble brushes against the tree and pops. Or rather explodes with a glaring white heat. N[HN\HN]H{\bVal reaches out and the ground shudders and tremors. Paltry, really compared to the earthquakes that bow to your will. cE d t. /dEMN`H> >  NaHd<dKNbHNcHNdHNeHNfHNgHiNhHNiHNjHHNkHNlHNmH'NnHNoHA\b Val begins to stir at your feet, and then groggily sits up. !> &> >CH > &" !&CENqH>   NrH" NtH>  NuH"NwH>   NxH" NzH>  N{H"N}H>  N~H"NH> D >" dNHPThe mage looks about him, glances down at his naked self, and then up at you. "NHMHe pulls himself to his feet, brushes himself off, and gives a slight shrugNH>  NHx. "I suppose we should be off then," Val says and, without a hint of self consciousness, he wanders off to the north. >>&!NH>  NHat the smudged patterns he had fallen across. "I suppose we should be off then," Val says and, without a hint of self consciousness, he wanders off to the southeast. >!>&>&!>&NH>  NH at the sutras fallen from the trees. "I suppose we should be off then," Val says and, without a hint of self consciousness, he wanders off to the east. >!!>&NH>  NHx. "I suppose we should be off then," Val says and, without a hint of self consciousness, he wanders off to the north. >>9&"9>&NH>  NHwith an amused grin at the hole he had been digging. "I suppose we should be off then," Val says and, without a hint of self consciousness, he wanders off to the west. m>>9&!9NH> m NH]. And then without a hint of self consciousness, he continues staring off across the lake. m>>9&!9)eMNH>" E> NHe<eKNHNHx\bYou rear above Val, wings sweeping into the sky, throat burning with smoldering fire and then-- something pulls you back. Darkened muscles ripple as you strain against the this new force, you curve your long neck back towards the mage to behold what magic he now casts. Your eyes meet his and his look... the dawning of some terrible realization on his face. \b It's not--- \b And then you dragged back, fighting and clawing, your being almost being wrenched asunder. Val shouts something and then he is gone as you drawn away from the lake, back and back and back again, something pulling you inexorably, something foreign yet also hideously familiar. \b Green grass sways under you, grass that turns to blue and purple and red, as you are dragged to the very edges of your domain. A figure in white awaits you there, and beyond him, the smoking crater that was once the Fey Tree. \bNH >> > CC 9fMO actorNHMO actorNH> > E >  E >" qNH*Well, that's one way to get him to shut up. \b You give your aching head one last shake as you edge carefully around the mage, watching him warily, patiently waiting for your moment... and so there it is, and you swoop in and press your lips on his. \b The damnable chanting finally stills as Val stands stiffly before you. And then his body melds against yours as he leans forwards, his arms coming around to pull you closer, along the small of your back, your shoulders, and then the nape of your neck, as he deepens the kiss. He tastes of mint, of rosemary, and of some other spice you can't quite place. \b This would be more pleasurable if you did not have to worry about him turning and consuming you at any moment. Or perhaps that makes it all the more exciting. You still decide it would be best to pull away and so you do.\b "Stop singing" you tell him. "It's abominable." \b "I think my singing must be sublime if its gets you to do that." Val replies as he brushes his fingers against his lips. He then tilts his head as he regards you. "I'm heading to the north, will you come with me?" \b "In a moment," you reply. "There are a few more rocks here that I need to kick." \b Val smirks-- smiles?-- and, giving you a small bow, he walks under the red arch and towards the flicker of a rainbow in the distance. >>>>>9&"9>& NH>> E >" NHBlithely kiss your mortal enemy? Don't mind if you do! \b You edge carefully around the oblivious mage, warily watching, patiently waiting for the moment, the perfect instant to pounce... And then you swoop in and press your lips to his.\b For a moment he is stiff and still before you, and then he is enthusiastically returning the kiss, arms wrapping around your back, your shoulders, fingers threading through your hair as he presses closer. \b He tastes of mint, of rosemary, and some other sweet spice you cannot place and-- this is not the response you were expecting. What precisely you were expecting you cannot say, but this most certainly is not it. \b You are the one who pulls away. Finally Val takes a step back himself and looks at you... disappointed? And smug, definately smug. \b "My, you are an affectionate one!" he asks. "Or is it simply your habit to rush about kissing random strangers?"\b "There's an old tale where you're supposed to kiss pale haired young men. And then gold falls out of the sky. Or something of the sort," you say. \b "Sorry to disappoint you, then." replies Val. "Although I was about to say-- I am most pleased with your habit of kissing strangers. ">>>NH>> E >" CNH!Blithely kiss your mortal enemy? Don't mind if you do! \b This time you are prepared. You wait until his back is turned to you and then you stealthily circle around and pounce! You nip playfully at his lips before pressing your mouths together and he responds by sliding his tongue forward in a gentle exploration. And so it is a duel of tongues and this time you won't back down. \b Finally it is Val who pulls away, gasping for air, as you have no need to breath. \b "You keep doing this and I'll start to get strange ideas. " he warns you. >>>|NH>" 5NH&Alas, the time for that has passed. 5NH>> NHfThis kiss won't be so blithe. Once, and once again, and once more... but this time, no matter how well you skulk about, the mage's eyes don't leave you. And so you approach him straight on. His lips quirk upwards slightly and this time he is the one to lean forward and initiate contact.\b More desperate this time and perhaps more invasive... his taste so fills your mouth that it seems you have inhaled it into your very being. His tongue presses further down your throat and-- is he really trying to eat you? What is it supposed to feel like to be consumed by a mage? Your jerk back and away from him and the wildness you feel in your heart is reflected in his eyes. \b "We..." and he has to pause for breath. "will get far too distracted with this." Another breath. "This isn't the time... Later..." and Val turns away from you to lean over and catch his breath. >>>NH>> jNH[You sense that it would somehow be dangerous to kiss the young seeming mage any further. NH>  E >  >NH/Now is most certainly not the time for that! NH>" NH7You swoop down and pounce upon the mage, your talons !>-'skirting carefully around the skin of+(sinking deeply into the material about his shoulders. You fluff your feathers up and begin cooing as you rub your head against his cheek and pepper his pale throat with gentle pecks. \b "You are certainly being affectionate today, aren't you, Lord Raven? " he says and cuddles you close. NH1MO actorN|'H0 MO actorN'H>  E >  N'H?You jump into the ditch alongside Val and begin digging away. Sensing your intent the earth oblidgingly opens up beneath you. Unfortunately, of all possible places, Val has chosen to dig atop your treasure room, and so there is nothing underneath the oblidging earth. \b With a great yelp, from either you or Val or perhaps both of you, you plunge into the treasure room amidst an avalanche of loose dirt. Val tumbles to his feet, absentmindedly brushing himself off, as he looks about with great interest. You remain in a bemused tumble atop the largest pile of debris. \b>>"|>&>&!>&> &> &C).N'H"Desultorily you dig around Val. MO actorN*HMO actorN*H>=" D >  D>/" E >" N*HYou walk up the tree where Val is ensconced and give him a light push. \b "Easy there!" Val chides you. "How about you come instead of having me come down?"N*H>=" D>/" E >" N*IYou walk along the tree bough where Val rests and give him a good push. Unfortunately, a good push in raven form is not much of a push at all. \b "Do you want to cuddle, Lord Raven?" Val teases. N*I>" N*IStealthily you creep up behind Val and give him a good push. The mage stumbles forward a bit, turns around, and arches a pale eyebrow at you. >##/N*I>" N*IStealthily you flap up behind Val and him a good push. The force of the push sends you fluttering backwards while the mage wanders off unknowing. zN*I>" fN*IZYou lash out with your outspread wings sending Val staggering backwards for a few feet. >MO actorN.In[MO actorN. I<The thought is... either rather gruesome or rather kinky. MO actorNV/ IMO actorNz/ I>" Nz/ I{You lash out at Val with the tip of your twining tail and although the mage staggers back, he still remains on his feet. XNz/ILAlas, the wards around the mage make taking or lifting him rather tricky. OMO actorN0I0You are thwarted by the wards around the mage.OMO actorN0I0You are thwarted by the wards around the mage.MO actorN11IMO actorNU1I>" NU1IYou reach out a black claw towards the dark clad mage. A blast of cold wind pushes your talons back within a handspan of Val's head. >NU1IYou reach out towards the mage with your mind but are thwarted by the wards surrounding him. And taking him physically... that would take quite a bit of skill in all your forms, even draconion. MO actorN2I=MO actorN3IYou !> flap  swaggerP around the mage and are greatly amused to see him swivel about to watch you. MO actorN3IMO actorN3I>" N3IWith a 'CRAK!' you swoop down and perch yourself daintily upon Val's shoulder. The mage reaches up and scratches you under your beak. >## N3I>" N3!IWhile the image of plopping yourself atop the mage's lap is rather amusing, he might get the wrong impression. Although, perhaps you are not so certain exactly what impression you have been trying to achieve...\b "And what are you smirking about?" Val asks. N3#IWith a muffled roar you pounce towards the mage. There is a blur of shadows and darkness beneath your muzzle and then suddenly the mage is behind you, having moved faster than is within the rights of any mere human. MO actorN6$IMO actorN6%IThe prospect is intriguing... in much the same way as mating with a black widow. As pretty as Val is, the constant worry of his turning around and consuming you would diminish any enjoyment. Or maybe it would simply add to the excitement. (LMO actorN8)INMO actorN<8+I>" N<8,IWith a great 'KRAK!' you swoop at of the sky and begin a flurry of pecking, clawing, and squawking about the mage's head. Val lifts an arm and fends you off absentmindedly. In a rage, you go straight for the mage's !>k @'s eyes... and end up ramming head first into an invisible barrier. \b You hit the ground with a 'PLUFT'. "Be nice," the mage admonishes you. N<8-I>##N<8.I>" E >  D >  oN<8/I`Attack him directly in front of everyone else? Perhaps you would be better to bide your time. uN<80I>" E >  TN<81I(<(K&N<82IN<84IWithout a sound you launch yourself towards the mage. Val shifts away in a blur of darkness and your hands pass through thin air, one of your nails scratching at the mage's cheek. \b Val wipes away the trail of red from his face. "What are you doing?" he barks at you. >##N<86IOnce again you fling yourself at the mage, this time your shoulder collides with his chest and you bring a fist up into his stomach. Val staggers back, cursing. "Don't do this," he warns you. >##%N<88IaFor the third time you attack the mage with your bare hands. And the last thing you see is his !>k @w eyes gazing down sadly at you before...\n ...the world...\n ...slipping\n away... \b You have been consumed by Val. N<8=IMO actorN">@IMO actorNF>BI>" NF>CIYou walk up to Val's breeches' leg and slowly claw your way up his clothes until you are perched comfortably on his shoulder. The mage pats your feathered head. "It might have been simpler to have gone down than up," he says. NF>DI>" NF>EIyThe thought is intriguing... in the same way that mating with a black widow would be. And perhaps for the same reason. NF>FI>" 7NF>GI+You seem to have that thought backwards. MO actorNC@HI6MO actorNg@JI>" Ng@KIWith a great caw you descend from the heavens and begin pecking at the mage's exposed skin. "Surely you can find something far tastier than me?" he says and shoos you off. Ng@LI>" nNg@MIDYou edge towards Val, patiently waiting for him to turn his back before you pounce! Swiftly you descend upon the mage, nip at his neck, and then dance out of his grasp as he reaches out towards you. \b "That's not really fair, Snugglebums," he says while rubbing at his neck. "Without letting me give you a matching mark!""g>##Ng@NI>" Ng@OIYou snake out your serpentine neck and try to bite Val's head off. The mage neatly rolls out of the way. "That's not very nice, Snugglebums" he says.  MO actorNCPIqMO actorNCQIRVal arches a pale eyebrow at you as you lean forward and give him a little tug. MO actorNDRI5MO actorNCDSIReading the mage... it had been impossible, even before you knew who he was. His expressions are veiled, as well they should be, with him being what he is. HMO actorNETIGMO actorN*EVI>" dN*EXIU"KRAWK! KAK KA KAW!" you call all to the mage. \b \Hail, Lord Raven," Val replies. bN*EZIV"Hail, Val!" you call out a greeting to the mage. "Hail, Snugglebums!" Val replies. MO actorNF[IMO actorN?F]I>" 2N?F^I#This is hardly the time for that!gN?F`I[Much to Val's amusement, you reach out and brush off a few specks of dirt upon his cloak.>##JMO actorNGaIIMO actorN:GcI> > E >  E >" N:GlIYou struggle to draw in breath as the chant rolls from Val's tongue, numbing your mind and dulling your senses. The wind blows red dust in circling eddies and Val stands with his back to you. You lean against a smooth roll of hill for support as a painful throb wells up behind your forehead, pounding irregularly, swelling and pressing outwards until you bend over and scream. \b Your cry echoes and rebounds throughout the hills before fading away. And then silence. \b "Was it so terrible then, my singing?" asks Val. He has turned to look at you, still and poised, as if on the point of coming over to you. \b You straighten and smirk. "It was abominable," you say. "Giving me quite a headache. "\b "Well then, I suppose I should stop. I wouldn't want to pain you." Val elegantly shrugs. "I suppose we're done here anyway. Shall we go?" and he walks under the red arch and away to the north. >&N:GmI>  E >" IN:GnI:Your scream dies unfulfilled within your frozen throat. eN:GqI>  N:GsIYou scream and the sound fills the plains, echoing back and forth, growing shriller ever shriller until it sends the two mages reeling, Val collapsing down to one knee. N:GuI> > ~N:GvIrYou dig deep into your soul and let loose with a piercing, primal scream. Val turns to look at you quizzically. MO actorNLxI1MO actorNMzI>  NM{IvBeneath Val's feet lies a frozen chip of lake surrounded by bubblingm sloshing waters and flits of blue white fire. -NM}I!Nothing but earth under there. MO actorNMI2EMO actorNNI&Nothing back there but a nice rump. MO actorN\NIMO actorNNI>" NNI:You prod at the mage with your beak. Hard muscles under !> your touchthe soft silk of clothes. nNNI>" NNI5You poke Val square in the chest with your finger. !>:7Beneath the soft texture of his tunic is hard muscle. Val pokes you back. NNI>" E >  2NNI#You are repelled by his barrier. bNNI>" NNNIBYou delicately lift a dark claw and prod at the dark clad mage. MO actorNPIMO actorNPI>" 1NPICarefully you flutter up to Val's shoulder and, with wings tucked gracefully at your sides, you begin rubbing up against the mage. !>:4His skin is soft and smooth beneath your feathers.TQHis clothes are soft to the touch, yet you can feel the hard muscle underneath..7NPI>" >NPICarefully you edge towards Val, closer and closer, until he is finally within handsreach. You gracefully you run your hands along his shoulder, down his chest and stomach, and up along his back. !>His skin is soft and smooth beneath your fingers...except for the patterns of tattoos. You can almost trace their designs by touch as well as sight.His clothes are as soft and good quality to the touch as they were to the eye. And beneath the clothes... you can feel the stirrings of hard muscle against your fingers. \b "I have no earthly idea what you are plotting," Val says, "But whatever it is, I grow excited. " And he starts running his hands over you.\b Oookay, that's quite enough of that and you step back out of his reach. \b "Tease," he calls to you. NPI>##NPI>" E >  0NPI!Alas, he is beyond your reach. NPI>   E >  0NPI!Alas, he is beyond your reach. GNPI;Val stands perfectly still as you reach out towards him. MO actorNXVIMO actorN|VI>h" (N|VIYou smile innocently at Val. The young seeming mage looks you over carefully. "I think I should be wary of such an expression on your face. " he says. \b "Clever," you reply and then Val smiles back at you. "And should I be wary of that expression of your face?" you ask."h_N|VISYou smile enigmatically over at Val, who returns the smile just as enigmatically.[MO actorN.XI\MO actorNRXI>" NRXIYou flap up and clasp a clawful of Val's posterior. The mage gives a jump and whirls around. "Naughty raven!" he scolds you with a laugh. >##NRXI>" E >i" NRXIYou sidle up behind Val and give his rump a good pinch. The mage claps a hand to the pinched area, whirls around in surprise, and stares at you. "And here I thought you prefered ravens to geese," he says and then begins to approach you with a wicked grin. \b "What precisely do you mean by that?" you ask him warily, carefully backing away. \b "Come closer and I'll show you!" he says and thus begins a merry chase all around the countryside. Silly mage, trying giving chase. No one can catch you unless you want to be cau--\b Your thoughts are suddenly interrupted by a sharp pinch on your own posterior. You turn around to find Val grinning wickedly behind you. Damn distractions...!"i>##NRXI>j E >  0NRXI!Alas, he is beyond your grasp. zNRXI>" E >" D >  " PNRXIDConsidering your current size, that would cause quite the wedgie. MO actorN\IMO actorN]I>" gN]IX"KRAK! KAK KAK COA!" Apparently bird beaks are not particularly conducive to howling. >N]I2You howl at Val and he howls right back at you. MO actorN]IMO actorN^I>" N^I"KAK KAK KRAK KAK COA COA!" you sing at the top of your lungs right within Val's ears. The mage flinches a bit but reaches out and pets your darkly feathered head. "Are you serenading me, Lord Raven?" he says. "As sweetly as any nightengale?"N^I>" fN^IZYou burst into a raucous tavern song about riding a black ship upon a faraway sea, coming to steal away your true love from within her family's walls. Val grins at you and joins in with the second stanza, his voice a good deal sweeter in song than your own. \b How odd... it's been many a year and decade since another has ever sung this song. N^I>" -N^I!You croon out a warrior's lay. (MO actorN`I)MO actorN aI>" N aIYou flit through the air in curls and loop de loops, in spirals and waves, around and around the mage you flutter in a dark fall of feathers. >##N aI>" bN aICSeductively you dance around Val, sensing the mage's eyes following your every move. Closer and closer he draws to you and... you grasp his hands and do the dance of joy. Much to your surprise he follows along perfectly, as if he knew the steps himself. \b How odd... that dance died out of fashion a very long time ago. >##N aI>" 4N aI(This really isn't the time nor place. MO actorNcISMO actorNcI>" SNcIGYou whistle sharply at the mage. "I see you, Lord Raven" he replies. NcI>" YNcIJA great gout of steam erupts from your nostrils with a keening whistle. ]NcIQYou give a low whistle as you glance towards Val. The grins and strikes a pose.>##BMO actorNeICMO actorNCeI>" @NCeI4You fly up to Val in a flurry of wings and claws. NCeI>" NCeIDark wings unfurl with a great rush of air. You launch yourself forward, claws stretched out towards Val when a sudden gust of winds tilts you off to the right. With a snort of white smoke, you sweep back once again. >NCeI>" NCeI>NoMO actorNfIpMO actorNgIpThe mage is beyond your direct influence of power. Besides, he seems pretty perfect, outwardly, as he is now. MO actorNgIpMO actorNgI>" NgIYou flutter up to Val, wrap your wings about his shoulders, and, cooing up a storm, pepper his throat with soft pecks. "Well, aren't you an affectionate one?" Val says softly as he strokes your head. >##NgI>" E >k" NgIYou steal up behind the mage and slip your arms around him from behind. \b "In an affectionate mood, I see," says Val. "Although I must protest your coming up behind and pinning my arms down. " \b "Heh," you cackle evilly. \b Val tosses his head back and you catch a glimpse of his !>k @v eyes. You release the mage and back off confusedly... There had not been anything menacing in that gaze, and yet..."k>##1NgI>" E >k" NgIYou sidle up towards the mage, but he far more wary since your first huggle attack. Val reaches out towards you, his fingers faintly brushing your !> skin  clothes: as you rapidly back away to the sound of his laughter. >##NgI>" /NgI#This is hardly the time for that!MO actorN6lI@MO actorNZlI!The very thought confuses you. 3MO actorNlI2VMO actorNlI7There is nothing you can do for him concerning that. LMO actorN mIKMO actorNDmIYou !> coo softly murmur into Val's ear. The mage laughs, although there is no way he could have understood. "Whispering sweet nothings in my ear?" he asks. MO actorNnItMO actorNCnIUYou draw forth your power and the world around you ripples into shields around Val.PMO actorNnIQMO actorNnI>" /NnI You bat a wing at Val's face. NNnI>" E >l" NnIiYou give the mage a full force slap across one cheek. Val fingers said cheek and stares at you aghast. >##"lNnI>" E >l" FNnI7Val catches your hand as you once again whip it towards his face. "I think that's quite enough of that," he tells you and keeps a tight grasp on your hand until he's certain this violent whim has passed away. You debate hitting him with the other hand, but something about the look in his eyes warns you off. ;NnI/You can do far more damage to him than that. MO actorNqJMO actorNqJ>" NqJYou blow forth a great gout of fiery air and brimstone upon the mage. Val crouches down beneath his crossed arms and the flames part around him, leaving him only slightly singed. Val tsks. "You need sweeter breath, Snugglebums," he says. >PNqJDHow uncouth! Although this may be more dangerous in another form. MO actorN:sJMO actorN^s J>" ^N^s JOYou make a half coughing noise. Alas, bird beaks were not made for growling. N^s J> > E >  cN^s JTYou growl low in your throat at the pale haired mage who has you frozen in place. oN^sJ>" N^sJA great roar rumbles deep without your belly, boiling up along the slender curve of your serpentine neck, and finally bursting free with a goat of fiery flame and gusting steam. Your roar echoes round the land, sending the ground shuddering in its wake. NN^sJBYou growl menacingly low in your throat as Val eyes you warily. >##NMO actorNuJMMO actorNvJrYou sigh wistfully at Val. The mage eyes you carefully as if trying to determine the meaning behind this sound. PMO actorNvJOMO actorNvJ>" ENvJ#You croak a farewell to the mage.>##gNvJ>" iNvJZIt is with great fiery plumes and gouts of dark steam that you bid farewell to the mage.NvJ>" E >l" NvJj"Farewell, Pookiebutt," you take your leave of the mage. "Return to me soon, Snugglebums," Val replies. >##CNvJ>" /NvJ#You take your leave of the mage. >##p000.   dark roots The roots of the black tree are thick and knobby as they twist about the island and bury themselves within the dark ground. Even darker arterial veins run through the roots, seeming to throb faintly beneath your gaze. MO actorNx"\MO actorN9z"=The roots are softer than they look and warm to the touch. -:MO actorN|"A faintly acridic smell. RMO actorN}"3The tree doesn't appear to be done with them yet.x8 8 8  thick dark branches The thick branches of the dark tree twine and turn at odd angles that seem to jerk at your eyes. The knobs and ends of boughs and limbs remind you of joints and and grasping fingers. MO actorN"FMO actorN"'Smooth between the jagged splinters. -7MO actorNk"A faint, sweet smell. MO actorN"iMO actorN"JYou reach up to break off a branch, but then a pang of guilt stops you.   .  growing leaves of petals The petal-like leaves of this dark tree are a shifting blue, as of clouds passing through a high summer sky. As you watch, glimmers of light faintly flit across their surfaces.MO actorN"|MO actorN"]Silken centers surrounded by sharp spikes that could easily draw blood from an unwary hand.-EMO actorN"&A sweet scent, faint and ephemeral. MO actorN"MO actorN"You snap off a bright blue leaf and the dark tree silently screams. Thick drops of red well up from the point where the leaf was plucked.&5M a plucked blue leaf nnA single blue leaf, shaped like a petal and tinted red at one end. Sparks of light flit across its surface. MO actorN"MO actorN"dIts silken center is surrounded by sharp spikes that could easily draw blood from an unwary hand. -MMO actorNW".A sweet scent, tinged with an acridic bite. b b b.  crackled bark The bark of the dark tree is strangely smooth except for the web of thin cracks that patterns its surface. Its main trunk lists heavily, first to one side than another, as if it was bracing against a strong wind. MO actorN"EMO actorN7"&Smooth between the jagged splinters.-QMO actorN"2A faintly sweet scent, a faintly acridic smell. MO actorN"bMO actorN"CThe thought of peeling the bark from the dark tree horrifies you.D  .  hard little fruits MMThe fruits of this tree are hard little pebbles, clear and glinting faintly in the light. The berries grow in hidden clusters amongst the leaves until they swell and ripen. The fully mature fruit will burst into slender slivers and disappear before reaching the ground. Yet in that moment, that instant of the eternal fall... it...MO actorN"ZMO actorN";Tough little pebbles, the hardest of materials on earth. -mMO actorN"NThe leaves of this tree smell of honey, the fruit smells of nothing at all. MO actorN"VMO actorN"7You have no use for this, the fruit is not ripe yet.  JMO actorN!"K+MO actorNE"~You stride out unto the lake, its surface lightly splashing with each step. You make your way back to the opposite shore. \bm>NE"> m jNE"^Val arches one pale eyebrow as he watches you approach.\b "Coming back again?" he asks you. MO quipnoN"KN")I didn't find what I was looking for...yN"Mind your own business...QN"&I didn't want to leave you behind...nlMO quipnoNe"K0Ne"\b"I didn't find what I was looking for," you say with a negligent shrug. "Perhaps you simply didn't look hard enough," replies Val as he turns his gaze to the north once again. And finally you can name one of the emotions playing across his face... anxiety. Ne"u\b"Mind your own business," you snap at the mage. Val does not bother to either reply or even turn to look at you. >##BNe"\b"Of course," you say. "I didn't want to leave you behind," you tease. The mage turns to you and flicker of... anxiety?... flits across his face. "I am not the one you should be worrying about." he tells you. >##` ` ` ` ` ` ` ` ` p. . ..  $$thickly growing aquatic vegetation 55A lush garden of underwater vegetation, both those that belong to the sea and those that belong to fresh waters, stretches around you. A tall forest of kelp towers above and smaller snatches of sea grass and sea weed sprout from the sand, from the curves of coral, and from the litter of pastel stones and shells. \b Delicate blooms of anemones are scattered amongst the algae, the wort, and the pillars of sponges. Fronds and feathered needles and and mattes of tangled leaves, all sway gently in an unseen current as dapples of light and color play across them.MO actorN2#MO actorN4#You brush your !> wings  fingersR across a trailing frond of seaweed. Underwater, it has the texture of wet silk.-MMO actorNW6#.You drink in the cooled waters of the lake. MO actorN7#]MO actorN8#>Surely you don't wish to displace the entire drowned garden?0  .  forest of kelp DDA forest of kelp towers above you, their wide flat fronds casting deep shadows across the sandy bottom of the lake. Dark greens and blues and purple-reds are thickly mixed, all with paler yellow-green threads running through their leaves and a thinner hollow stem that anchors them to the ground. A dark brown bubble at the tip of the stems allows the fronds to float, reaching upwards towards the sun, a pale blue light at this depth.\b Graceful longfinned fish drift through the kelp forest, nibbling on passing leaves or watching you with interest through black-rimmed eyes. MO actorNB#PMO actorND#1The keep feels slippery yet tough to the touch.-MMO actorNF#.You drink in the cooled waters of the lake. MO actorNNG#6yMO actorNrH#ZYou bite onto a nearby frond of kelp. It tough and chewy, and very salty to your palate..  schools of fish Several schools of fish had made this strange lake their home. Little fish with colored metallic scales zigzag excitedly around you while their shyer, larger brethren with the long flowing fins keep their distance within the beds of kelp and coral. \b Starfish are strewn about, unmoving save for the slow pumping of their stomachs as they feed. And most hidden of all is the sandsucker fish, buried upto to its bulbous eyeballs in the sand.MO actorNS#kMO actorNU#LYou brush against a fish and find its skin slippery and cool to the touch.-MMO actorNW#.You drink in the cooled waters of the lake. MO actorOxNY#_You play a merry game of chase with a glittering little fish before it accedes to being held.NZ#ZN[#&<  <M+ caught little fishes caught little fish9MNz#CA small silver fish with scales ringed with metallic blue-green. N{#<! E <  N|#Its small mouth gapes open as its gills pump futively in the air. Beads of moisture run down its skin as the fish twitches helplessly.4N}#<" "N~#Alas its quite dead.y ttWith a slight pang of guilt you swallow the tiny fish whole. It slides down your throat with a faint salty taste. MO actorN#HMO actorN4#)It skin is cool and clammy to the touch->MO actorN#The fish smells like a fish. ()&MN#<  E <  E <  E <  E <  E < > D <  N#(<(KoN#3\bThe tiny fish twitches about in the fresh air. rN#C\bThe tiny fish's mouth gapes open as its gills pump agitatedly. "N#,\bThe tiny fish flails about frantically. N#=\bThe tiny fish slaps you with its tail as it flops about. N#4\bThe tiny fish flips itself over in desperation. ^N#K\bThe tiny fish's gills make wet popping sounds as they billow outwards. N#*\bThe tiny fish sluggishly flops about. N#%\bThe tiny fish twitches slightly. "N#5\bThe tiny fish goes still, its eyes glazing over. "C)E IG w) ) ).  glinting metallic fish These little fish, no longer than your longest finger, are full of energy, darting about the lake inquisitively, their colored translucent fins still pumping rapidly even when they hover in the water.\b The scales of these fish are silvery and ringed with metallic hues of red, blue, purple, green, gold, or bronze and the same colors tint their tiny rounded fins. Their eyes, capable of rolling in every direction, are oversized and remain a deep fathomless black.MO actorNe#kMO actorN=g#LYou brush against a fish and find its skin slippery and cool to the touch.-MMO actorNi#.You drink in the cooled waters of the lake. MO actorNj#MO actorN%l#>x" ON%m#@You have already disturbed the little fishes enough for today.kN%o#_You play a merry game of chase with a glittering little fish before it accedes to being held.>&"xC)h$$$.  long finned fish These foot long fishes show off a multitude of colors, from dark purple through many shades of blue, green, orange and yellow and the colors in between, red, black and finally white. Most of them are tri-colored with patterns running along fins that flare behind them like unfurling sails. Their eyes are rimmed in charcoal with pale metallic colors in their irises.\b Noticing your attention, several of the fish puff themself out even further, displaying colorful frills behind their gills.MO actorN-#}MO actorNQ#^You reach out towards the long-finned fish and they reach back, nibbling on your appendages.-MMO actorN#.You drink in the cooled waters of the lake. l# # #.  dark mussel shells You find a pair of what appear to be dark mussel shells mixed in with all the other shells that are strewn about the sand, but upon closer inspection you realize that they are actually a pair of eyes attached to a buried sandsucker fish. MO actorN1#hMO actorNU#IThe sandsucker blinks and dives deeper into the sand as you draw close.-MMO actorN#.You drink in the cooled waters of the lake.   M  lightning eel {{A long dark eel with black fins edged with gray. As you watch it, flits of blue and white light ripple through its body. MO actorN#UMO actorN#6A shock runs through your body as you touch the eel.-0MO actorN8#A fishy smell. mMO actorNn#>" FCYou shouldn't overburden yourself with items while in this form. MO actorOfoof sackfoundN#>N#N#!N#lN#%N#"N#?N#N#N#N#N##@You carefully catch the lightning eel in your handy container.N#)[N#OYou can't carry the eel like this. Perhaps if you had something to put it in?  .  scattering of seashells vvThis is a lake and not the sea, yet the sea shells and their inhabitants don't seem to mind this at all. Shells of many shapes and sizes lay scattered about the sandy bottoms of the lake, some of them abandoned, some of them still occupied. Palely spotted, creamed, and white, spiral, hinged, and whorled, delicate, glossy, and pebbly, they are the currency of the waters.MO actorN#HMO actorN#)The shells are hard beneath your touch.-MMO actorN.#.You drink in the cooled waters of the lake. (mMO actorN#>" FCYou shouldn't overburden yourself with items while in this form. MO actorN#2You wander through the drifts of underwater sand(N#<(K N#N#- and pull forth a creamy, spiral seashell. &N#N#N#$ and find a small bumpy seashell &N#N#N#, and a dark green shell catches your eye. &N#vN#N#& and trip over a large brown shell. &N#&N#N#X and spot a little glint in the ground, which turns out to be a tiny silver seashell. &N#N#N#z, digging idly through the heaps, when something pricks you, almost enough to draw blood. It is a sharp, pointed shell. &"N#N#N#L and discover a lustrous gold seashell wedged inbetween two coral drifts. &N#N$N$* nearly missing a delicate white shell. &N$.N$N$ and find a Lion's Paw. &N$N$N$N$e , admiring the many seashells. You take no more, though, for you have collected enough for today. N $ (S 4{3  , .yyy5M creamy spiral seashell A creamy yellow seashell that is one smooth spiral which ends in a blunt bulbous tip. Dark brown edges the opening where a snail or small crab once lived. MO actorN$2MO actorN$Smooth and hard. ->MO actorN8$It smells of water and salt. t4445M small bumpy seashell HHA small whorled seashell, pure white and covered in tiny uneven bumps.MO actorN$DMO actorN$%You brush against many tiny bumps. ->MO actorN!$It smells of water and salt. 5 dull halfshell Half of an greeny-black hinged shell. Outside its surface is dull and uneven with multiple layerings, while its inner lining is a iridescent mother-of-pearl. A large crack runs halfway through the piece. MO actorN($3MO actorN'*$Hard and ruffled. ->MO actorN`,$It smells of water and salt. kkk5M large coiled shell A large brown shell, coiled flatly to one side. Darker brown striations run through the upper chamber of the shell with a paler peach underbelly.MO actorN3$2MO actorN5$Smooth and hard. ->MO actorN*7$It smells of water and salt. hhh5M tiny silver seashell A tiny silvery white halfshell, no bigger than your fingertip. The surface of this shell is a bit lumpy and misshapen, almost like a rock. MO actorN@$3MO actorNB$Bumpy and flakey. ->MO actorN'D$It smells of water and salt. 5M pale ivory tusk shell A pale ivory tusk shell mottled brown at its ends and no longer than a finger. Its slightly curved cone shape bears quite a resemblance to the tusk it was named after. MO actorNL$>MO actorN N$Long and pointed at one end. ->MO actorNPP$It smells of water and salt. 5M limpet shell A lustrous gold-brown limpet shell, shaped like a shallow vase or bowl. A tiny circular hole lies at the lip of one edge-- perhaps a clue as to what happened to the limpet that once lived within. MO actorNY$9MO actorN[$Rough under your touch. ->MO actorN^]$It smells of water and salt. T5M circular shell A bright white shell, circular, with a raised five pointed star in its center. Long slender holes start at the tip of each point with a sixth hole directed at the main body of the star. MO actorNd$MO actorNf$You brush your !>talons  fingers^ along the raised bumps and holes of the seashell. It feels very fragile within your grasp. ->MO actorNh$It smells of water and salt. vvv5M dark red shell A Lion's Paw... a dark red halfshell, deeply ridged, with black horizontal striations. Tne bottom of the shell flares out into many tiny crests.MO actorNo$BMO actorNq$#The shell is uniformly fissured. ->MO actorN5s$It smells of water and salt. n n n.  forest of kelp Layers of algae in greens, blues, red, browns, yellows, and dark purples cover the slick surfaces underneath the waters of the lake. They cling tenaciously to the coral, to the stones, and to the backs of shells, tendrils waving idly in the current.MO actorN8}$=MO actorN\$A slippering bit of nothing.-MMO actorN$.You drink in the cooled waters of the lake. MO actorN$6:MO actorN$A slimy bit of saltiness.mMO actorNV$>" FCYou shouldn't overburden yourself with items while in this form. MO actorN$yYou reach out and pluck a random bit of algae. Its a slippery handful of near nothingness, difficult to hold unto here.>& 5M handful of algae TTA slippery handful of dark green algae, slightly shriveled and drying in the air. MO actorN$>MO actorN$A slippery bit of nothingness->MO actorN$It smells of water and salt. MO actorN9$6}MO actorN]$^You take a biteful of algae. Its texture is slick and slimy and it tastes strongly of salt. L   .  garden of worts 44As you gaze across your drowned garden, several types of worts come to your attention. Hornwort and quilwort growing across the sands like so much grass, fanwort and moonwort trailing leaves in the waters around them, the carnivorous bladderwort and even a few traces of stonewort mixed in with the algae.MO actorNr$PMO actorN$1The keep feels slippery yet tough to the touch.-MMO actorN$.You drink in the cooled waters of the lake. MO actorN?$6yMO actorNc$ZYou bite onto a nearby frond of kelp. It tough and chewy, and very salty to your palate.mMO actorN$>" FCYou shouldn't overburden yourself with items while in this form. MO actorNU$You quickly gather up a drowned bouquet of worts. Hornwort, quilwort, fanwort, bladderwort, moonwort... and leaving out the stonewort...&5M bouquet of wortMN$1You have gathered a bouquet of different worts N$>  GN$8whose leaves trail elegantly in the water behind you. <N$0that is a soggy drippy mess within your arms. MO actorN$\MO actorN4$=Nothing quite has the texture of soggy, half-dried leaves. ->MO actorN$It smells of water and salt.   .   hornwort Several hornworts can be found buried amidst the pale sand and silt. Whirled needle-like leaves are densely packed around the points of each branched stem of the bright green plants.MO actorN$3MO actorN$Prickly and slick.-MMO actorNL$.You drink in the cooled waters of the lake. mMO actorN$>" FCYou shouldn't overburden yourself with items while in this form. MO actorN$You quickly gather up a drowned bouquet of worts. Hornwort, quilwort, fanwort, bladderwort, moonwort... and leaving out the stonewort...>&t t t.   quilwort ddShort blades of quilwort with swollen bases. They look like nothing so much as bits of land grass.MO actorN$3MO actorN$Prickly and slick.-MMO actorN$.You drink in the cooled waters of the lake. mMO actorNK$>" FCYou shouldn't overburden yourself with items while in this form. MO actorN$You quickly gather up a drowned bouquet of worts. Hornwort, quilwort, fanwort, bladderwort, moonwort... and leaving out the stonewort...>&  .   fanwort Pairs of fanned leaves grow on either side of a slender stem covered in a gelatinous slime. A few of the plants have little white flowers with yellow spots at their bases. MO actorN$3MO actorN$Prickly and slick.-MMO actorNA$.You drink in the cooled waters of the lake. mMO actorN$>" FCYou shouldn't overburden yourself with items while in this form. MO actorN$You quickly gather up a drowned bouquet of worts. Hornwort, quilwort, fanwort, bladderwort, moonwort... and leaving out the stonewort...>&l) ) ).   hornwort$MN$!<@Thin branched wiry leaves support little green vacuums of air covered in trigger hairs. When a tiny animal wanders close to the bladderwort, attracted by the sweet scent released by the hairs, a small oval membrane will suck them into the 'bladder'' where they will be dissolved by the digestive juices of the plant. \b Even as you watch, a tiny purple snail floats up to the bladderwort and is sucked inside its greeny leaves. =Thin branched wiry leaves support little green vacuums of air covered in trigger hairs. When a tiny animal wanders close to the bladderwort, attracted by the sweet scent released by the hairs, a small oval membrane will suck them into the 'bladder' where they will be dissolved by the digestive juices of the plant.MO actorNP$3MO actorNt$Prickly and slick.-MMO actorN$.You drink in the cooled waters of the lake. mMO actorN$>" FCYou shouldn't overburden yourself with items while in this form. MO actorNs$You quickly gather up a drowned bouquet of worts. Hornwort, quilwort, fanwort, bladderwort, moonwort... and leaving out the stonewort...>&H  .   moonwort A fat, fleshy plant with thick waxy leaves that overlap their heart-shapes. Rotund pea-shaped buds grow thickly along the apex of the stem... wait a moment, what is this doing growing underwater anyway?MO actorN %GMO actorN' %(Waxy and easily bendable to the touch.-MMO actorNt%.You drink in the cooled waters of the lake. mMO actorN%>" FCYou shouldn't overburden yourself with items while in this form. MO actorN:%You quickly gather up a drowned bouquet of worts. Hornwort, quilwort, fanwort, bladderwort, moonwort... and leaving out the stonewort...>&,  .   stonewort The stonewort clinging to the sides of rock and coral could easily be mistaken for normal overgrown algae. Little raised stems contain whorled, filament branches that are often encrusted with a hard white substance. MO actorN%4MO actorN6%Slimy to the touch.-MMO actorNp%.You drink in the cooled waters of the lake. mMO actorN %>" FCYou shouldn't overburden yourself with items while in this form. MO actorN6"%You quickly gather up a drowned bouquet of worts. Hornwort, quilwort, fanwort, bladderwort, moonwort... and leaving out the stonewort...>&|  .  sea of grass Slender green spirals of seagrass, no longer than a handspan or two, grow in thick patches across the pale sandy dips and rolls under the lake. A few small white blossoms grace the stems of a scattering of grass. As you watch, tiny little white bubbles of pollen rise up from the blooms and drift upwards, towards the shimmering blue surface.\b A nearby starfish lies on its back, its stomach turned inside out as it digests a few blades of grass.MO actorN/%1MO actorN 1%A slippery whip.-MMO actorNW3%.You drink in the cooled waters of the lake. MO actorN4%6=MO actorN5%A touch chew of nothingness.mMO actorN6%>" FCYou shouldn't overburden yourself with items while in this form. zMO actorOxN9%-You pluck a blade of shimmering sea grass. N:%ZN;%&  5M+ blade of sea grass slender twirls of sea grass VVA slender twirl of sea grass, uprooted from the bottom of the lake. It drips wetly. MO actorNG%2MO actorNI%Slick but tough. -AMO actorNK%"It smells of water and growing. MO actorNcL%6RMO actorNM%3An acridic bite when you bite into the sea grass.mmmM   blue stone A squarish stone, mottled green and blue, and nearly as large as your hand. A hollow has been worn into its center. Upon closer inspection, the inside curves of the stone seem to twist at your eye, as their shape is off somehow. MO actorN"Z%MO actorNF\%You run your !>talons  fingers along the smooth planes of the stone. Try as hard as you might, you can't seem to follow a straight line from one side of the stone to the other. -5MO actorN5^%It smells of water. rrr.  scattering of stonesMNh%aA sprinkling of softly colored stones is scattered across the pale sands of the lake. The stones are in mottled pastels of blue, pink, gray, green, peach, and milky white, all of them with curves worn smooth by the shifting water. Sparkling bits of crystal speckle some stones, while others have become the holdfasts for weeds and grasses and algae.\bNi%>  UNj%IA few feet away a mottled blue and green stone catches your attention. MO actorNk%IMO actorNCm%*The stones feel smooth under your touch.-MMO actorNo%.You drink in the cooled waters of the lake. MO actorOxNr%=You gather a rounded seastone from the bottom of the lake. Ns%ZNt%&5M+ rounded seastones blade of sea grass zzA round flattened stone of a marbled blue, pink, and white. Tiny flecks of crystal and green algae decorate its surface.MO actorN~%fMO actorN%GThe stone is smooth and fits perfectly within the palm of your hand. -5MO actorNd%It smells of water. t2225 squishy sea sponge NNA lump of pale brown sea sponge, soaked through and through with lake water.MO actorN%IMO actorN%*The sponge is squishy within your grasp.-5MO actorN%It smells of water. x  .  scattering of sponges Scattered about the bottom of the lake are different types of sponges in varying colors. A deep red vase sponge stands off to the side, tiny bubbles rising from the central cavity within its bell-shaped body. Blue, purple, and green tube sponges are the most plentiful, some of them towering over your head at their full heights.\b Bright red tree sponges seem almost to mimic the twisting convolutions of the coral it grows besides. Colonies of small yellow and brown sponges grow low against the sand while colonies of sea squirts encrust the sides of stone and coral. Most beautiful of all are the palely translucent tunicates that edge around the other sea sponges, their crystalline bodies tinted with red, purple, or yellow.MO actorN!%oMO actorNE%PYou brush against a random sea sponge. They are soft and squishy to the touch.-MMO actorN%.You drink in the cooled waters of the lake. mMO actorN %>" FCYou shouldn't overburden yourself with items while in this form. }MO actorN%TYou reach down and pull up a brown sea sponge, sopping wet and large as your hand.>&O O O.  vase sponges 55The vase sponges are wide and squat, perched on rocks and sands at the very bottom of the lake. They have the appearance of inverted bells with irregular walls nearly as wide as they are high surrounding a deep central cavity. The few vases scattered about the lake range in color from purple to dark brown.MO actorNp%oMO actorN%PYou brush against a random sea sponge. They are soft and squishy to the touch.-MMO actorN %.You drink in the cooled waters of the lake. mMO actorN\%>" FCYou shouldn't overburden yourself with items while in this form. }MO actorN%TYou reach down and pull up a brown sea sponge, sopping wet and large as your hand.>&I I I.  tube sponges8MN%The tube sponges are distinguished by their many long tube-shaped growths, which range in color from purple to blue to gray-green. If you !>hold your hands hovern above the openings at the top of their long lengths you can feel a steady current of water being expelled. MO actoroMO actorN%PYou brush against a random sea sponge. They are soft and squishy to the touch.-MMO actorN%.You drink in the cooled waters of the lake. mMO actorNV%>" FCYou shouldn't overburden yourself with items while in this form. }MO actorN%TYou reach down and pull up a brown sea sponge, sopping wet and large as your hand.>&  .  tree sponges vvEven under water these sponges have a fiery color, with even their wavy shapes evoking the image of wavering flames.MO actorN%oMO actorN%PYou brush against a random sea sponge. They are soft and squishy to the touch.-MMO actorNJ%.You drink in the cooled waters of the lake. mMO actorN%>" FCYou shouldn't overburden yourself with items while in this form. }MO actorN%TYou reach down and pull up a brown sea sponge, sopping wet and large as your hand.>&  .  yellow and brown sponges rrThese sponges are much smaller than their tube and vase cousins, nothing more that a handful taken on their own.MO actorN%oMO actorN%PYou brush against a random sea sponge. They are soft and squishy to the touch.-MMO actorNR%.You drink in the cooled waters of the lake. mMO actorN%>" FCYou shouldn't overburden yourself with items while in this form. }MO actorN%TYou reach down and pull up a brown sea sponge, sopping wet and large as your hand.>&  .  yellow and brown sponges These small sponges that encrust the surface of stone and coral have white, gray, or brown spotted leathery bag-like bodies with bright green interiors seen peeking through their semi-translucent skin.MO actorN"%MO actorNF%`You poke the sea squirt and it shoots a mini stream of water at you before rapidly deflating. -MMO actorN%.You drink in the cooled waters of the lake. mMO actorN%>" FCYou shouldn't overburden yourself with items while in this form. MO actorN%`You poke the sea squirt and it shoots a mini stream of water at you before rapidly deflating. 8  .  yellow and brown sponges No longer than your hand, these clear sea sponges have large openings edged by dark pigments of red, purple, or yellow. Their bodies are so palely translucent that you can see through the outer and inner membranes to the coral and stone behind.MO actorNM%8MO actorNq%Slippery and delicate. -MMO actorN%.You drink in the cooled waters of the lake. mMO actorN%>" FCYou shouldn't overburden yourself with items while in this form. }MO actorNu%TYou reach down and pull up a brown sea sponge, sopping wet and large as your hand.>&x  .   coral reefs A bright lacework of coral reefs garnishes the underwater garden beneath the lake. Though each reef is composed of a tiny polyp within its stony shell, the fantastical shapes that the colonies of polyps build upon one another are as different as the varying shades of color they take.\b There is a dazzling pink coral colony, shaped like a prickly bush, and behind it rises a rounded dark blue reef covered in maze-like ridges that scroll all over its surface. A low lying green coral resembles a stack of broken plates piled one atop another and another colony is a flaming fan with each red and white branch rounded up. \b A pale peach reef forms a hedge of thorns around the others and towering above all are columns of yellow and pale brown formed by families upon families of polyps amassed together, each little group resembling the puckering of full lips. If you look closely, you can see small translucent filaments wavering in the water, seeking out their food.MO actorN&MO actorN* &lYou are gentle, lest your touch break the fragile colonies. The reefs are hard and scratchy to your skin. -MMO actorN &.You drink in the cooled waters of the lake. mMO actorN &>" FCYou shouldn't overburden yourself with items while in this form. ~MO actorOxN&1You carefully break off a slender arm of coral.N&ZN&&e e e5M;MN& handful of !< @ coralMN&A handful of !< @V coral, its small fingers grasp outwards like a many-twigged branch turned to stone.+<MN&handfuls of !< @ coralMO actorN5&BMO actorNY&#Sharp and scratchy to your touch.-5MO actorN!&It smells of water.  bright red dark bluegreen and yellow pale browncreamy whiteflamboyant pinkcolorchanging sea green pale purple  .   bubbles qqGlittering globes of air rise through the water to disappear at the glimmering surface of the lake high above. MO actorN;&?MO actorN=& The bubbles pop at your touch.-MMO actorN?&.You drink in the cooled waters of the lake. MO actorNc@&?MO actorNA& The bubbles pop at your touch.@   .  sea of grass Seaweeds in all different sizes, shapes, and colors grow thickly in all directions. Long thin tendrils, sharp needles, and nubbled leaves, feathery mattes, broad triangles, and little scallops, translucently thin, roughly webbed and thickly layered.MO actorN6I&vMO actorNZK&WYou trail your hands through a clump of nearby seaweed and find it rough and nettled.-MMO actorNM&.You drink in the cooled waters of the lake. MO actorN)N&6MO actorNMO&|You shrug and snatch up a random piece of seaweed. Its brown and wavy and tastes a bit like a biteful of salt and spices. (mMO actorNQ&>" FCYou shouldn't overburden yourself with items while in this form. MO actorNkS&)Your gaze wanders over the sea of weeds(NkT&<(KNkU&NkV&2 and you pluck a wavy handful of green seaweed. &NkW&NkX&NkY&k and comes to rest on a cluster of dark red seaweed swaying enticingly.You pull forth a promising plant. &NkZ&ENk[&Nk\& and something brushes lightly across you face. A few strands of bright blue seaweed are easily taken from the rock cropping near your head. &Nk]&Nk^&Nk_&; and you pick a handful of purple-ish seaweed at random. &Nk`&'Nka&Nkb&u and your eye is caught by several fancy displays of brown seaweed, their leaves spread out elegantly before them. &Nkc&Nkd&Nke&H some wiry green seaweed that you manage to uproot with some trouble. &Nkf&Nkg&Nkh&B as you easily pull free a pretty handful of little red leaves. &Nki&Nkj&Nkk&. grab a single sprig of dark green seaweed. &Nkl&RNkm&Nkn&X and you scrape off a thin covering of yellow-green seaweed from a nearby handy rock. &Nko&Nkp&Nkq&Nkr&K but decide that you have amasses quite a collection of seaweed already. Nks& (S tz  F H<M wavy green seaweed >>A wavy frond of seaweed, newly green and wide as your palm. MO actorNy&ZMO actorN&;If feels nothing so much as like a wet piece of lettuce. -FMO actorN&'It smells of water and green things. MO actorNI&6KMO actorNm&,It tastes like a salty mouthful of lettuce<M tangled thatch of red seaweed iiA tangled thatch of deep red seaweed. The blades of this plant resemble little fingers twined together.MO actorN&5MO actorN&Tough to the touch. -FMO actorN&'It smells of water and green things. MO actorNZ&6PMO actorN~&1A tough chew, but with a pleasant spicy taste. <M long strands of blue seaweed ;;A few long strands of seaweed, of a blue-ish green color.MO actorN&8MO actorN&Slippery and delicate. -FMO actorN&'It smells of water and green things. MO actorN.&6bMO actorNR&CIt tastes of nothing even as it gets stuck in between your teeth.`<M clump of purple seaweedMN&IA tangled handful of red-purple seaweed, lying in a clump between your !> feathers  fingersB. Its leaves are numerous and wavy, wreathed around each other. MO actorDMO actorN&%Brushes lightly against your skin. -FMO actorNi&'It smells of water and green things. MO actorN&67MO actorN&A rich, crisp texture.H<M fan of brown seaweed VVThe elongated irregular leaves of this brown seaweed splay outwards in a fan shape. MO actorN&4MO actorN&Slippery and soft. -FMO actorN&'It smells of water and green things. MO actorN=&6jMO actorNa&KIt tastes of mud and salt. Perhaps you should have rinsed this off more. p---<M wire of seaweedMN&ZThis yellow-green seaweed appears to be all stem and no leaf. It hangs limply from your !>talons  fingers, like a wet noodle.MO actor3MO actorN&Smooth but tough. -FMO actorN3&'It smells of water and green things. MO actorN&6MO actorN&hYou gnaw fruitlessly on the thin wire of seaweed. There's not much taste to it after all that effort.  <M red scalloped seaweed MMSmall scalloped leaves of red grow in ragged bunches around a central stem.MO actorN&3MO actorN&Slick and smooth. -FMO actorN&'It smells of water and green things. MO actorN4&6MO actorNX&dYou pluck off single red leaf and chew on it. Nice texture, but not much of a taste beyond water. eee<WM sprig of dark green seaweedMN&CA single sprig of dark green seaweed covered in feathery needles.N&  dN&XA tiny little snail, no bigger than a speck of sand, crawls amongst the leafy foliage.MO actorN&2MO actorN8&Wet and prickly. -FMO actorNp&'It smells of water and green things. MO actorN&6MO actorN&cYou chew the top of the dark green sprig. It has a deep, spicy taste, a bit like peppered honey. ,<M sheet of yellow algaeMN&CA thin sheet of yellow algae. Its falling to shreds between your !>talons  fingers even as you gaze at it.!>&MO actorN&(MO actorN& Slimy. -FMO actorN-&'It smells of water and green things. MO actorNy&6LMO actorN&%It slimily slips down your throat. !>&t222<M  tiny snail A tiny snail with a pearlescent little shell. You notice an even teenier pair of antennae twitching along the snail's head as it slowly wanders along.MO actorN'FMO actorN''It feels like a tiny speck of stone. ->MO actorN;'It smells of water and salt. MO actorN'6MO actorN'eYou pop the snail into your mouth and swallow. There's hardly a tickle as it goes down your throat.!>&  .   starfishMN' A smattering of starfish are scattered across the lake bottom, sleeping contentedly or digesting their food by turning their bodies inside out. Most of them are thick bodied with bumpy mottled coats and five pointed limbs, but a few others are slender with elongated or multiple arms.\bN' > sN'gNearby a deep blue starfish is engaged in a deadly tug of war with what appears to be a giant oyster.MO actorN'MO actorN'XYou poke a nearby starfish. Its skin is rough and bumpy as it wraps a leg around your !> talon finger.-MMO actorN'.You drink in the cooled waters of the lake. mMO actorN'>" FCYou shouldn't overburden yourself with items while in this form. MO actorN'> > N'You carefully pull the blue starfish off of the oystershell. The oyster heaves a sigh of relief as the blue starfish bubbles in dismay. >&1N'%You have already taken a starfish. VVV5M  starfishMN#'hA mottled blue starfish, color as deep as a sapphire, with five curling arms and a bumpy pebbled skin.N%'>  D> > E >  iN&']The starfish bubbles at you from the star-shaped slit on its underbelly that is its mouth. MO actorNE''MO actorNi('SYou poke the starfish. Its skin is rough and bumpy as it wraps a leg around your !> talon finger.-;MO actorN+'It smells of cool waters. x6 6 6.  giant oyster A large pale gray oyster lying in the sand, twice as round as your head, and with its foot firmly attached to a nearby coral reef. Lighter striations form along the overlapping layers of the two shell pieces that remain firmly clenched shut.MO actorN.6'MO actorNR7'xThe surface of the oyster shell is irregular and bumpy, layers upon layers of hard bony material overlying each other.-MMO actorN:'.You drink in the cooled waters of the lake. MO actorNR;'MO actorNv=' ! _Nv@'CWith a bit of coaxing, the oyster grudgingly cracks open its shell a sliver. You catch a quick glimpse of a gray-ish beige lump of meat that is the body of the oyster and then it is spitting something into your face. \b With a resounding thud... or perhaps closer to a 'BLURBLE' underwater... the oyster snaps shut again.> >&8NvB',The oyster remains tightly clenched shut. 5M  black pearl An iridescent black pearl, large as your closed fist. Looking into the colors that swirl through the its glossy surface reminds you of shimmer of light on water.MO actorNL'?MO actorNN' Smooth and cool to the touch. ->MO actorN@P'It smells of water and salt. P  .   anemone,MNZ'Slender flowing blossoms of anemones have attached themselves to the solid curves of coral or stone. Surrounding the darkness of the central mouth are circles of brightly colored tentacles, blue, red, green, orange, pink, yellow, purple, a pale white that almost seems to glow or some shade in between. The 'petals' of the anemones undulate gently in the water, trying to bring food closer to their gaping mouths.N[' > cN\'WA hermit crab scuttles past with a little peach anemone firmly ensconced on its back.MO actorNb]'}MO actorN^'^As you draw near the sea anemone, it withdraws its tentacles lest it accidentally sting you.-MMO actorNa'.You drink in the cooled waters of the lake. mMO actorNlb'>" FCYou shouldn't overburden yourself with items while in this form. .MO actorNd'> > Ne'You watch the hermit crab as it wanders past. It stops, watches you back with beaded black eyes, and with some reluctance proceeds to scurry up your waiting hand.>&GNg';You decide its best to leave the fragile anemones alone. 1115M ++hermit crab with an anemone upon its backMNz'> m N{'A little cream hermit crab is perched upon your shoulder. Growing across the crab's glossy shell is a tiny peach-tinted anemone, tentacles waving in the current stirred up by your movement.N}'A little cream hermit crab is perched upon your shoulder, looking a bit bedraggled. A shriveled peach mass is attached to the crab's glossy shell. The anemone is not doing too well outside of the water. MO actorN~'MO actorN7'HYou feel a faint sting from the anemone's tentacles as you brush your !> feathers  fingers across the back of the crab. -BMO actorN'#The hermit crab smells of water. eee.  shimmering surface You gaze upwards towards the surface of the lake high above you. Shimmering dapples of deepest blue play across the waters above like light gleaming through stained glass. A sense of serenity feels your being. MO actorNo'MO actorN9p'With a powerful kick you swim upwards towards the surface. You allow the rays of sunlight to play across your hands as you gently glide them across the bottom surface of the waters.-MMO actorNr'.You drink in the cooled waters of the lake.  a a a .  sandy bottom of the lake, the sandy bottom of the lake iiPale sands touched with just the faintest hint of gold cover the bottom of the lake in dips and gently rolling hills. Patches of sand are carpeted with seagrass, seaweed, or algae with the odd sponge, anemone, or wort anchored to the ground.\b Colored stones and sea shells are strewn about haphazardly amongst the living starfish, snails, and hermit crabs.MO actorN'lMO actorN'You run your !>talons  fingers through the wet sand.+130-MMO actorNz'.You drink in the cooled waters of the lake. mMO actorN'>" FCYou shouldn't overburden yourself with items while in this form. KMO actorN@'!You take a handful of wet sand.&>MO actorN'? MOactordobjN'You try to bury !  underneath the waves, but the sand continues billowing upwards, exposing it again and again. Finally you give up, allowing !  to lay where it has fallen. N'> &@>A?(1MO actorN'0\MO actorN';You dig through the sandy bottom of the lake and discover(N'<(KN'N' a tiny nest of seahorses, little equine bodies with glittery green fishy tails. They fuss at you for a moment for disturbing them before burying themselves back underneath the sands. N'N'N'C a jagged piece of driftwood, longer than your outstretched arm. &N'N'N' sand and more sand. N'sN'N'3 a fat golden dubloon, encrusted with barnacles. &N'N'N'n a giant clam, larger than a dinner plate, that has fallen into the pit created by your incessant digging. You pull it out and-- it clamps unto you! What a show of gratitude!\b The fight is short, with you thrashing wildly about as it holds on tenaciously. Eventually you allow your physical body to dissolve which sends the clam sailing off into the bed of kelp. N'N'N'G and with some trouble you manage to uproot some wiry green seaweed. >&N'N'N'L the soggy remains of a book. How in the world did this end up down here? &N'N'N'' a black spade with a broken handle. &N'RN'N'o an ever widening hole in the ground. The sight of it rather irks you, and so you carefully fill it in again.N'N'N'N'? that you have disturbed the lake bottom enough for one day. N' (S f8#  R T5M handful of wet sand A handful of wet and lumpy sand, taken from the bottom of the lake. Its pale color is touched with only the faintest hint of gold. MO actorN(HMO actorN()It feels remarkably alot like wet sand.-]MO actorN3(>The sand smells strongly of water and green growing things. <MhMN'<" +N'jagged pieces of driftwood'N'jagged piece of driftwood,rMN'<" 3N'$several jagged pieces of driftwood)N'a jagged piece of driftwoodsMN'<" pN'aA few jagged pieces of dark driftwood, broken into many smaller chunks by your recent struggle.N'A dark piece of driftwood, long as your extended arm, and broken & jagged along both ends. A thick coating of green algae has grown across its splintery surface, nearly obscuring the golden lettering that spells 'TITANIC'. MO actorN'3MO actorN'Wet and splintery.-=MO actorN'It smells like rotting wood.LMO actorN 'NbMO actorND'=The jagged piece of driftwood shatters beneath your blows. "%MOactordobjN'xMOactordobjN'As you attack ! . the driftwood splinters within your grasp. "oMO actorNU'pMO actorNy'ZWith a thought the driftwood is whole again. Or as whole as a hunk of driftwood can be. !  5M golden dubloonwMN'<" N'A brightly polished dubloon nearly as wide as your hand and thick as your thumb. A crude smily face has been enscribed on both sides of the coin. Actually, that may have been you who painted the face. You need to work on your art skills. bN'VA dubloon caked in mud and encrusted with barnacles that obscures all other details.MO actorN'MO actorN'<" HN'9You trace the raised smily face imprinted on the coin. HN'<The barnacle covered dubloon is rough beneath your touch. -_MO actorN'@The dubloon smells of water with a distinct metal tang to it. MO actorN'bMO actorN'=You carefully scrape the mud and barnacles off the dubloon."  ;5M  soggy book The drowned remains of an unfortunately misplaced book. Its cover has deteriorate to a sodden gray and green mess. The inner parchments seem to have congealed together. uu...nine plagues upon the kingdom.... first... hail... skies...storms of winds... lightning strike down... fire rains down from the heavens... swarms of... locusts... crops wither...rivers flood... and the earth quakes and is never still... a monstrous dog consumes... walks in shadows... and the final plague...\b Nothing else can be recovered from this nigh ruined tome.MO actorN[(1MO actorN(Soggy and soppy.-3MO actorN(A wet smell of rotoMO actorN(pMO actorN(|Unfortunatetly, you were not the creator of this book and thus, you do not have the knowledge of what this was originally.5 5 5M spadeMN (<" !(LA black metal spade with a sharp tip. Its wooden handle is broken halfway.!N#(A spade is a spade.MO actorN$(HMO actorN&()It feels remarkably alot like wet sand.-JMO actorN8((+There is the faint acridic bite of rust. oMO actorN)(pMO actorN+(mThe handle of the shovel flexes and grows outwards. With a final shudder the spade becomes whole once again!MO actorND,(MOactordobjNh.( E >" jNh/([You dig through the remains of the tavern but discover nothing but ashes and more ashes. *Nh0( xNh1(iIt would draw far too much attention if you started pulling up floorboards in the middle of the tavern.Nh2(~ E>SNh3(DYou scrabble in amongst the pebbles but find nothing of interest. *Nh4(~ UNh5(/You scrabble in amongst the pebbles and find !."mNh6( E>]Nh7(NYou carefully dig through the roots and stone but find nothing of interest. CNh8( ^Nh9(8You carefully dig through the roots and stone to find !."mNh:( E>hNh;(YYou carefully dig through the matte of flowers and grass but find nothing of interest. HNh<( iNh=(CYou carefully dig through the matte of flowers and grass to find !."mNh>(> E>\Nh?(MYou carefully dig through the sand and glass but find nothing of interest. NNh@(> ]NhA(7You carefully dig through the sand and glass to find !?."mNhB(q E>]NhC(NYou carefully scavenge through the tiny trees but find nothing of interest. _NhD(q ^NhE(8You carefully scavenge through the tiny trees to find !r."m NhF( E>qNhG(bYou carefully dig around the ever present roots of the dark tree, but find nothing of interest. [ NhH( qNhI(KYou carefully dig around the ever present roots of the dark tree to find !."m NhJ( NNhK(;You dig through the sandy bottom of the lake and discover(NhL(>(KNhM(NhN( a tiny nest of seahorses, little equine bodies with glittery green fishy tails. They fuss at you for a moment for disturbing them before burying themselves back underneath the sands. NhO(NhP(NhQ(C a jagged piece of driftwood, longer than your outstretched arm. >&NhR(NhS(NhT( sand and more sand. NhU(rNhV(NhW(3 a fat golden dubloon, encrusted with barnacles. >&NhX(NhY(NhZ(n a giant clam, larger than a dinner plate, that has fallen into the pit created by your incessant digging. You pull it out and-- it clamps unto you! What a show of gratitude!\b The fight is short, with you thrashing wildly about as it holds on tenaciously. Eventually you allow your physical body to dissolve which sends the clam sailing off into the bed of kelp. Nh[(Nh\(Nh](G and with some trouble you manage to uproot some wiry green seaweed. >&Nh^(Nh_(Nh`(L the soggy remains of a book. How in the world did this end up down here? >&Nha(Nhb(Nhc(' a black spade with a broken handle. >&Nhd(TNhe(Nhf(o an ever widening hole in the ground. The sight of it rather irks you, and so you carefully fill it in again.Nhg(Nhh(Nhi(Nhj(? that you have disturbed the lake bottom enough for one day. Nhk( (S h:#  P RzNhl( E>SNhm(DYou carefully dig amongst the grass but find nothing of interest. Nhn( TNho(.You carefully dig amongst the grass to find !."mNhp( E >  E >  Nhq("Nhs(KWith a shrug, you jump into the ditch alongside Val and begin digging away. Sensing your intent the earth oblidgingly opens up beneath you. Unfortunately, of all possible places, Val has chosen to dig atop your treasure room, and so there is nothing underneath the oblidging earth. \b With a great yelp, from either you or Val or perhaps both of you, you plunge into the treasure room amidst an avalanche of loose dirt. Val tumbles to his feet, absentmindedly brushing himself off, as he looks about with great interest. You remain in a bemused tumble atop the largest pile of debris. >>"|&&!& & &C) Nhu( E>RNhv(CYou dig about the soft, moist loam but find nothing of interest. 1Nhw( UNhx(.You dig about the soft, moist loam and find ! . "mNhz(  E>Nh{(qIt takes quite a bit of energy to dig amongst the hard red stone, yet in the end you find nothing of interest. 'Nh|(  Nh}(]It takes quite a bit of energy to dig amongst the hard red stone, yet in the end you find !."mNh~( D  vNh(jThe stone here is too hard to dig in. Besides that would ruin the pattern you worked so hard to create. T./   ground,  the groundMNZ*%The land here is slightly rolling, covered in a swaying skein of the wild-hair called grass and a shifting pattern of cloud shadows cast from above. Green at its entrance, the colors subtly change, fading through the shades of the rainbow until at the edge of your borders the grass turns green once again. A sharp demarcation between your tall colored grass and the stubbly grass beyond marks the very border of your lands. Besides the tall tinted grass, no other plants grow in this region and there are no paths nor breaks to the sea of blades.N]*<m" N^*t\b You know that somewhere there is a freshly dug hole, but its completely hidden within the sea of grass blades. 1MO actorN_*0MO actorN4a*>SN4b*DYou carefully dig amongst the grass but find nothing of interest. QN4d*.You carefully dig amongst the grass to find !."mmyMO actorNf*zMO actorN5h*<m" XN5i*CYou smooth over the hole until the ground is pristine once more. !m7N5k*+There are no holes to be filled in here. >MO actorNl*?bMOactordobjNm* You bury !  in the sea of grass. &@>A?-JMO actorNq*+The ground smells of ripe growing grass. MO actorNr*MO actorNt*You brush your !> wings  fingers0 through the grass and it prickles your skin. /MO actorNu*.eMO actorNv*FThe grass stirs and faintly, faintly can be heard the sound of seas.E.   groundyMO actorN1~*z~MO actorNU*>m" WNU*CYou smooth over the hole until the ground is pristine once more. !m q q q 8:.  ground,  the ground2MN-The grass sprouting in the surrounding flat land is short and a very dark jade green, mixed in with lichen and low-growing moss. Beneath this vegetation the ground is loose-soiled and moist, although perhaps not as moist as one would expect. Water gushes forth in the center of the heath and just as quickly is absorbed by the surrounding earth. Several rainbows curve to touch the ground, one such seeming to plunge into the ground beneath your feet. N-<m" JN->\b A small hole has been dug into the moist soil and heath. 1MO actorN}-0MO actorN->  E >  N-"N-KWith a shrug, you jump into the ditch alongside Val and begin digging away. Sensing your intent the earth oblidgingly opens up beneath you. Unfortunately, of all possible places, Val has chosen to dig atop your treasure room, and so there is nothing underneath the oblidging earth. \b With a great yelp, from either you or Val or perhaps both of you, you plunge into the treasure room amidst an avalanche of loose dirt. Val tumbles to his feet, absentmindedly brushing himself off, as he looks about with great interest. You remain in a bemused tumble atop the largest pile of debris. >>"|>&>&!>&> &> &C) N-> RN-CYou dig about the soft, moist loam but find nothing of interest. RN-.You dig about the soft, moist loam and find ! . "mmyMO actorNf-zMO actorN->  N-The pit that Val has been digging is an affront to your eyes. With nary a blink, you force the earth to close up upon itself once more.!>&N->  N-With a sharp cry, Val just manages to jump back in time to avoid being buried alive. He stares down at all his hard work undone and then glances back at you, eyes impossible to read. \b "I suppose," he drawls, "that was a subtle hint to move on." For a moment he merely stands there, gazing off at something unseen to the north. Then the mage gives a casual shrug. "It seems that time is almost up anyway." And with that the mage strides towards the glimmering of the lake to the west.m>9&!9!>&N-<m" ^N-IYou smooth over the loose soil until the ground is pristine once more. !m7N-+There are no holes to be filled in here. >MO actorN( -?oMOactordobjNL - You bury ! % amongst the moist soil and heath.  &@>A?MO actorN -MO actorN -LYou pull up the loose moss-covered soil and allow it to slip between your !>talons  fingers. ,MO actorN --QMO actorN -2The area smells of moist earth and fresh water. MO actorN -}MO actorN/ -^You don't really mean to pull up all the ground, do you? Why not just take a hunk of heath? /MO actorN -.MO actorN -yYou press your ear to the ground and hear the faintest hollow sounds of water falling, emanating from under the earth. 0A' Treasure Room \(The Treasure Room\)+ ZZIt smells of earth, of leather, and of wood, of the many treasures you have piled here. * ^^Silence reigns within your treasure room save for slight burbling of water in the distance. #MN.\b An underground cavern beneath the rainbow fountain, its obsidian walls reflect the light a hundredfold. \b Carefully heaped all around are your treasures, rusty parts of armour, discarded bits and pieces of clothes that caught your eye, piles upon piles of books about the outer world, a big gilded wooden chest full of something or other, pots and pans and baubles and knickknacks scattered hither and thitherN.F  N.q, a crystal chandelier dangling darkly in one corner, and the big wooden washboard from the tavern's scullery. FN.:and a crystal chandelier dangling darkly in one corner. N.\b All things that you have tricked or snatched or cajoled from the various people passing through your lands over the many years. \bN.>|" N.\b You have a new impromptu skylight, a large irregular hole within your treasure room's ceiling, allowing the warm rays of the sun to slant inside. A rainbow also falls through the crack, bathing your treasure chest in its light. RzMN.eYou drift into the embrace of the earth for a brief moment before returning to your treasure room. .  skylight An irregular hole within the ceiling of the treasure room leading up to the green grounds of the fountain outside. The trailing edge of a rainbow pours through the hole. MO actorN.FMO actorN.'There's not much to touching a hole. oMO actorNK.p/MO actorNo.>  No.You abtain from sealing the mage within your treasure room. He's quite pretty enough to belong there but he'd probably start smelling after awhile. [No.OWith a glance the gaping hole within the ground pinches shut and closes off. !|/ / /.\<  rainbow A rainbow arches straight and true through the impromptu skylight to land in the mjidst of your now dirt bestrewn treasure. The chest, in particular, is bathed within its light. y ccYou walk towards a rainbow, open your mouth, and allow an etherial sweetness to fill your being. MO actorNQ.MO actorNu.You reach out towards a rainbow and it reaches back towards you. Colors play across your fingertips, streaming past you, streaming through you. ,MO actorN,.-HMO actorNP.)The tang of pure water and true light. MO actorN.jMO actorN.KAs much as you love rainbows, that really would draw too much attention. p/&/&/. trenchUMN-YA long narrow trench dug within the loose soil of the grounds surrounding the fountain.N->  dN-XIts waist length and growing deeper by the moment as Val works assiduously away at it.N-hThe edge of the fountain's longest rainbow trails into the hole. Of all the places to choose to dig...MO actorN-MO actorN-You run your !> claws wings through the loose soil piled around the edges of the ditch. Much drier than it should be, especially considering its closeness to the fountain.YMO actorN-Z[MO actorN-<Flames smolder and flicker out, no match for the fountain.01zy./N(MO actorND->zVWPLQNLN LNL=NLNoLpN[L\N}L~NMLON . gaping You peer into the gaping hole in the ground to see your exposed treasure room lying far beneath you. A rainbow sweeps past your shoulder and lands upon the treasure chest directly below. MO actorN1-FMO actorN3-'There's not much to touching a hole. oMO actorNZ4-p/MO actorN~6->  N~7-You abtain from sealing the mage within your treasure room. He's quite pretty enough to belong there but he'd probably start smelling after awhile. [N~9-OWith a glance the gaping hole within the ground pinches shut and closes off. !| H. treasure chest eeYour wooden treasure chest gleams in the light of the rainbow. More can be told if you were below. MO actorNA-FMO actorNC-'There's not much to touching a hole.  o_oJ_oJ_oDMNQJ!>MNRJ!>MO actor* MO actorNxTJ>  E >g" 1NxWJ"You summon forth a quake and the earth obeys your command, trembling and heaving itself beneath your feet. The music of the flute cuts off abruptly as Val staggers sideways. The land groans as it is torn asunder, cracks forming into pits into rifts, as other sections are thrust high into the air, raining down bits of dirt and greenery and flower petals. \b Val leaps away from another sinkhole and takes shelter behind you. And then the earth finally stills to the sound of silence. No more groans nor quakes nor piping of annoying flutes. \bNxZJ>  Nx[JYou call upon your land to quake and rise up, to join in this desperate fray you find yourself mired within. And so it responds, cracks and clefts and upheavals, springing in amongst the two battling mages. Nx^J>  E >" E >g" Nx`J"What a mess," you say as you behold the remains of the meadow before you, flowers and pillars and greenery all askew at different angles. Perhaps you ought to abstain from earthquakes for awhile. \bNxbJ>  E >g" =NxdJ "I suddenly have the urge to visit another region," Val says as he pokes a toe at a wide pit near his feet. He tucks the silver flute pack underneath his cloak and begins to, carefully dodging around rifts and clefts, wend his way to the north. >&>>&"g"g!{NxfJ>  E >g" NxlJSands ripple and topple across the patterns as the earth shudders beneath your feet. Val staggers backward just in time to escape the upheaval of a new sand tune where he once stood. The metal trees sing and chime to each other as they tremble within their grove and then suddenly there comes the sound of crashing, splintering glass. \b As if subdued by that sound the land stills once more. Drifts of sands slide into each other, smoothing the landscape out once more. Val stands before you, peering up into the puffy clouded sky. \b "I believe that's a sign we should be moving on," he says, and thus saying so, he pulls the satchel higher upon his back and begins plowing through the new sand drifts, towards the southeast. >!>&>E&"9"g>&=NxnJ>  jNxpJ[You, Val, and even the bloody ofudas cling to the trees as the earth shakes beneath you. NxrJ>  E >g" E >" 6NxxJThe red hills shiver and shake all around you. Clouds of dust and red pebbles clatter to the ground and suddenly there comes a dull roaring, different from the groaning of the earth beneath you. Val curses and then runs full tilt into you, pushing you back and away, all the way to the other side of the red arch. A waterfall of red stone and dust follows you as one of the hills collapses in upon itself, sealing off the red arch and the entrance to the rest of the hills. Val wipes at the coating of red now covering him and says, "That fountain up north is looking better and better." And so both of you set off for it, you with many backward glances at the collapsed red hills. The damage doesn't appear to be too difficult to repair. >>"g"vg>9&"9>&_Nx{J>  E >g" E >" NxJThe red hills shiver and shake all around you. Clouds of dust and red pebbles clatter to the ground and suddenly there comes a dull roaring, different from the groaning of the earth beneath you. Val curses rushes to the other side of the red arch, a waterfall of red stone and dust following him as one of the hills collapses in upon itself, sealing off the red arch and the entrance to the rest of the hills. Val wipes at the coating of red now covering him and says, "That fountain up north is looking better and better." You flutter over and catch a ride upon his shoulder, as he wends his way to the north.At least the damage doesn't appear to be too difficult to repair. >>"g"vg>9&"9>&?NxJ>  E >g" $NxJYou awaken the land beneath you and Val comes bounding out of his hole, a surge of dark earth following behind him. The pit the mage had been digging puckers and collapses in upon itself, a carpet of grassy moss and heath spreading across its mouth in front of your eyes. Val gazes at the ground he had once labored over, now indistinguishable from all the other flatland surrounding. And then he turns and looks at you, eyes expressionless, and without a single word he walks towards the west. !>&m>>9&"g NxJ>  +NxJ The earth leaps to obey your call, heaves and falls away from beneath the young seeming mage. Val staggers and teeters for a moment, and then a small perfect circle solidifies underneath his feet. He raises his hands and the earth shudders and quails before you. > NxJ>  E> > NxJAt your command the earth trembles and shakes all about you. Layna squawks in dismay-- or maybe its the Old Coot-- as pebble skips about the courtyard, the barrel and water trough rattle and vibrate within their bases, and Val stands perfectly steady gazing up at the heavens. \b Finally the earth stills and your companions grab at anything for support. Well, not quite all of them. \b "Good gods," gasps the Old Coot. "What was that?" \b "Is that normal? Are there earthquakes here?" Layna asks. \b "None that I ever remember!" replies the old man as he clutches at the wall of the tavern as if expecting the earth to spin away at any moment. \b "Did you notice," Val muses softly, "that the tavern wasn't shaking? Not at all. And--" \b "That's all I be needin' to hear!" says Old Coot as he beelines for the tavern door. \b "And neither was the stables," finishes Val, a touch of amusement to his voice. "The horses were not disturbed at all. " And indeed, if you listen carefully you can still hear their quiet nickering to each other.\b Layna heaves a sigh. "So, twas the fey after all" she sighs and shivers. And then looks suspiciously about her. >&"gNxJ>  E> > E >  E >g" E >r" gNxJAt your command the earth trembles and shakes all about you. Layna gives a little shriek as pebbles skip about the courtyard, the barrel and water trough rattle and vibrate within their bases, and Val stands perfectly steady gazing up at the heavens. The maiden stumbles, regains her feet, and staggers wildly towards the tavern door. The earth follows her, rolling beneath her feet and hitting the tavern wall, causing a rattling tremor that knocks free the loose roof tiles above her head. \b The shingles rush down towards Layna and stop, poised daintily in midair, and you stare. For you had been about to do just that, yet it seems someone has beaten you to it. \b "Move!" Val commands and the maiden jumps away to obey. The tiles come alive once more and come crashing to the ground where Layna had been standing. \b The earth has stilled and for a moment all is silence. You turn to stare at Val and discover that Layna has done the same. \b "You," she says, "You did it. You stopped it-- stopped--" she swallows hard as she stares at Val. "You are a mage.". \b "I do know a bit of magic," Val replies quietly. \b Layna laughs dryly. "Oh I dare say, a bit more than 'a little'". She clears her throat and looks away. "I should thank you, but... I have no wish to be part of this. Of a fey hunt. I wish... both of you, luck. " she says and smiles wryly to herself before walking back into the tavern. \b "More afraid of me than of the fey," Val says, as softly as before. \b "That makes perfect sense to me," you reply. \b "And you," says Val "Will you turn away now as well?" \b "The others have far too much sense to accompany a mage," you reply. "All save me, who has no sense at all. " \b Val laughs. "Then what a pair we make!" and saying so, he pulls his cloak about him and sets off to the northwest. >>&>!">&"!rFNxJ:At your command the earth trembles underneath your feet.RMO actorN JQMO actorN JtYou draw in a deep breath and release it in a sudden gasp. \b "Did you notice something unexpected?" Val queries. MO actorNe!JAMOactordobjN!JH vN!JgWhat madness has taken ahold of you? You give yourself a good shake and glare at the tricksome mage. N!J" N!JaVal looks at you for a moment with an unreadable gaze and then neatly bites into the proffered !.>##N!J" iN!J="Heh," says Val. "I shall pass. I am trying to cut down on ! in my diet."jN!J WN!JKVal's eyes darken as he gazes towards you. Without a word he turns away. >##KMOactorioN#J You defend !<  against Val.{MOactorioN!$J You defend !<  against Val.N!$J>" N!$J>MO actorN$JMOactordobjN$J You defend !  against Val. N$J>" N$J>MO actorNM%JMO actorNq%J>  E >  Nq%JYou stand perfectly still, unmoving, unflinching, with no outer sign of the spell you are weaving. Slowly, gradually Val turns to stare at you intently, from head to heel, as slowly he inches closer and-- !>he thrusts his open palm at you. There is nothing within his hand, yet all the same you feel the force of his blow from several feet away. With a "KRAW!" you flap away into the air as Val watches you through narrowed eyes.he wrests his gaze away, turning his head from you. \b "I'm going to... be over there... for a while," he says huskily and without a backward glance he walks away from you.  Nq%J>##Nq%J> > E >  Nq%JYou stand perfectly still, the noise of the flute shrieking into your mind, as you cast your glamour over Val. Yet the young mage only plays all the louder... damn him! Nq%J> > E >  Nq%JYou stand perfectly still, the noise of Val's voice sinking into your mind, as you cast your glamour over Val. Yet the young mage only plays chants all the louder... damn him! VMO actorN*JUMO actorN2*JoYou yawn delicately at the mage. \b "Am I boring, you?" Val asks. "Shall we do something more exciting then?""MO actorN*J#"MO actorN*J>" vN*Jg"KRAK! KAK KAK COA!" you bark at Val. Alas, bird beaks are not particularly conducive to that sound. N*J{"And what do you think you're doing?" you bark at the mage. \b "Luring at the fey, of course," Val responds with a wink. XMO actorN,JWbMO actorN6,J>" N6,JVal tilts his head to listen as you squawk out all your complaints to him. "That's very interesting, Lord Raven. " he tells you. N6,J"And I have a headache and all this walking around is exhausting and the butterflies arent listening to me..." you pour out your woes to the befuddled mage. aMO actorN-JbLMO actorN-J-He seems quite capable of feeding himself. ZMO actorN.JYMMO actorN8.J>" N8.K_"You indulge in a bit of raucous cawing as you flutter your wings in appreciation. The mage !>takes a bow.swirls his cloak at you. zN8.K.You give the mage a round of applause as he !>takes a bow.swirls his cloak at you..RMO actorN/KSMO actorN/K>" N/KYou lash out with your tail, the slender tip of it whipping across Val's back. The mage starts forward and claps a hand behind him. "Naughty, naughty, Snugglebums," he says. N/ KKinky!MO actorN0 K MO actorN0 KpIs it really wise to accept something from the mage when you have no true concept of what you will befall you?\MO actorNf1 K[6MO actorN1 KYou reject the mage. MO actorN1KFMO actorN1K'Oh, you have been, quite assiduously!MO actorN62KMO actorNZ2K>" NZ2KVal raises a pale eyebrow as you reach out and run your hands through his pale hair. With a few deft twists you have plaited in a pretty little braid. \bNZ2K>" E >" 9NZ2K-"There!" you exclaim. "My masterpiece!". \bNZ2K>" E >" JNZ2K+"There!" you exclaim. "Now we match!". \b>##NZ2K>" PNZ2K&The mage chuckles as he runs his own hands through his hair. "The warriors of Nerinia braid their hair before battle... yet its not something I have ever tried." \b "And so, are we going off to battle?" you ask. \b Val tosses his hair a bit uneasily. "Perhaps. Sometimes it seems inevitable. ">##NZ2K>" NZ2KYou hop onto Val's head and begin fussing about with his hair. "My apologies, Lord Raven, but you can't build a nest up there!BNZ2K>" .NZ2 K"Now is hardly the time for that!MO actorN.6"KMO actorNR6$K>" NR6%K"KRAK KAK KAK COA!" you squawk right within the flinching mage's ear. "And what has your feathers in a twist, Lord Raven?" Val says as he lightly slaps at his ringing ears. NR6&K>" ^NR6'KOYou give an indignant squawk as Val looks at you innocently. Too innocently. GNR6(K>" 3NR6)K'Dragons do not squawk. Dragons roar. MO actorN7*K=MO actorN8+KThe thought is unacceptable!]MO actorNY8,K^dMO actorN}8-K2You towards the mage who smiles and waves back. >##TMO actorN8.KUMO actorN 90K>" E >  D&>  E >  E > m N 91KYou hover in the air above the young mage, your wings wings held just so, as you await your opportunity. And then with a great 'KAW' of the glee, you fall out of the sky and towards Val's face, scratching, clawing, and pecking at those strange !>k @ eyes. \b Val flinches back just in time and begins to swat at you as you make several passes at him. He lowers his hand from his head and looks up at you, and for a moment your gazes meet, you poised in the air as he stands below. A shiver passes through you. \b And then your wings snap closed again as you dive towards the mage once more. The air jellifies around you, holding fast to each glossy black feather and each glinting sharp talon, and you are frozen no more than a foot away from the mage. You shouldn't have ignored that feeling, that warning... Damn! \b Val reaches up and plucks you out of the air, his gingers closing firmly around you. You'd snap your beak at those pale, trespassing fingers if you could. His grip on you tighters as he holds you closer, staring intently at you, and you stiffen, waiting, on the edge of phasing away or transforming... \b Val pets you on the head. "You ought to be less surly." he says and with a quick flit of his wrist he tosses you back into the air. \b You flap away from him in confusion. Turning back for a moment you give one last 'KRAW' of defiance before settling a good distance away to further observe the young mage. N 9;K>##N 9" N 9?K`You sidle up to Val's leg and give it a good peck. Val moves faster than you imagined, swinging his leg around again to give you a light boot in the back of your feathered rump. \b You squawk in indignation and launch yourself into the air, glaring down at Val's pale head. If you were a true bird you would leave a nice present for him right there. >##SN 9AK>" N 9BK>)N 9CK>" N 9DK>6dMO actorN0AFKeMO actorNTAHK>" mNTAIK^Val can hardly offer you any protection that you cannot provide yourself while in this form!NTAKK{You dive behind the mage. Val tilts his head back towards you in bemusement. "I'll protect you, Snugglebums," he teases. VMO actorNsBMKWMO actorNBOK>" NBPK<USNBQK>" NBRK>N)NBSK>" NBTK>NMO actorN+CVKMO actorNOCXK>" NOCYKYou perch along Val's shoulder, affectionatly cooing up a storm as he strokes your darkly feathered head, your glossy wings, and the itchy hollow beneath your beak.>##LNOCZK>" 8NOC[K,"Who's the snuggliest wuggliest little wittle mage in all the lands?" you coo at the astonished mage. "Yes he is, yes he is! Such a cutie pie, such a snookie wuggums, such a little itty bitty..." \b Val is backing away from you carefully, looking far more frightened that you have ever seen him. \bNOC\K>" E >l" 7NOC]K+"... pookiebutt! Such a muffey wuffey..."NOC^K>" NOC_KYou flinch. "Ugh... I think I made myself sick," you say. \b "That can happen with too much sugar," says Val from a safe distance away. >##DNOC`K>" 0NOCaK$This is hardly the time for that. MO actorNFcK6MO actorNGeK>" NGgKYou flutter up to Val's shoulder, carefully walk inwards to the pale delicate curve of his throat, and then proceed to tickle up a storm with your feathers. The mage bursts into laughter, reaches over pulls you off his shoulder, and holds you gently within his hands. \b "That's quite enough of that, Lord Raven," he tells you. "You are quite distracting me." and much to your surprise he leans over and presses a kiss to your head before releasing you.>##NGhK>  E >" fNGiKMStill chuckling to himself, Val walks under the red arch and to the north. >NGjK>" |NGkK]Stealthily you sidle up to the unknowing mage and, as his attention is distracted, you reach over and flicker your fingers over his stomach and sides. Val laughs and turns to you. "So it's a tickle battle, you be wanting?" he says. \b "I am not ticklish," you tell him airily. \b And with a gleam in his eye, the mage sets off to prove you wrong. >##NGlK>  E >" NGmKWith an indignant squawk you rush out from the hills with the mage in not-so-close pursuit. "No one escapes the inquisition!" Val calls out to you. >>NGnK>" /NGoK#This is hardly the time for that! MO actorNBLqK!?MO actorNfLsK You close your eyes and think of serenity... of fluffy pale clouds passing by, of the soft whisper of the wind through grass, of the feel-- your thoughts are interupted by the loud sounds of Val tromping all about your lands. You open your eyes and glare at the mage in disgruntlement. MO actorNMvKEMO actorNMwK&He is assuredly already quite awake!cMO actorNNyKQMO actorN>N{K>" sN>N|KdYou blow a thin stream of air upon the unknowing mage. You might accomplish more in another form. N>N}K>" N>N~KYou blow a thin stream of air upon the mage. Val arches a pale eyebrow at you. "Is this an indirect kiss?" he asks with a wicked grin. N>NKYou blow forth a great gout of fiery air and brimstone upon the mage. Val crouches down beneath his crossed arms and the flames part around him, leaving him only slightly singed. Val tsks. "You need sweeter breath, Snugglebums," he says. >YMO actorNPKZMO actorNPK>" NPKYou blow forth a great gout of fiery air and brimstone upon the mage. Val crouches down beneath his crossed arms and the flames part around him, leaving him only slightly singed. Val tsks. "You need sweeter breath, Snugglebums," he says. >NPKYou summon forth the flames to burn and consume the mage. A faint red aura flickers around Val, yet no fires follow to your command. It seems that the mage is heavily warded against such direct attacks. TMO actorNRKSMO actorNRK>" NRKVal glances at you after you have properly excused yourself. "And what have you done that needs to be pardoned? " he asks with a slightly conspiratorial grin. "Are you about to confess your sins to me?" NRK>  RNRKC"You have nothing to apologize for," Val says with a slight bow. bNRK>" NNRKB"KRAWK! KRAK KRAK!" You beg the pardon of no one in particular. MO actorNTKMO actorNTK>" <NTK-"KAK KRAK KAK KAK KRAW!" you curse loudly. pNTKAYou draw in a deep breath and begin to rant upon a slew of the worst curses imaginable. "May a pox eat away at your skin and leave your eyeballs boiling in their sockets, may your gonads wither away to dust and be baked within the pies of harpies, may a blight fall upon your-- fall upon your--"\b "...nether regions?" !> supplies helpfully./MO actorNVK.MO actorNVKkIn stillness you listen to the mage, but he has fallen silent except for the soft whisper of his breath. ,MO actorNqWK-}MO actorNWKYou stealthily edge towards !>! Valthe cloaked stranger8, waiting for an inattentive moment to make your move.NWK You give !>! Valthe cloaked stranger a good sniff. He smells of woods and travel, of green earthy dirt and faintly of a spicy perfume, and mixed in with all is the unique smell that must be !>! Valthe stranger himself. NWK>" NWK2\b"Do I really want to know what you're doing?" !>! Valthe cloaked stranger; asks over your bent head. \b "Probably not," you reply. NWKMO actorNZK~MO actorN  N" N m Nk @ eyes darkened. N  jN  N&>##!>9&m>>N" EN`K6"KAK KAK COA COA!!!" you laugh merrily at the mage. N`K>" N`K{Gouts of white steam pours forth from your nostrils as your laugh deeply rumbles around the the surrounding countryside. #N`K>" E >  D>  E >  D >  D >  D">  E >o" E >p" CN`Kn<nKN`KYou burst into gales of giggles at the disgruntled look upon the mage's face. Val favors you with a scowl for your efforts as he brushes at the white covering his shoulder. >##\N`KYou continue to laugh at the fuming mage. \b "Oh, you're simply enjoying this, are you?" he asks you with a deathly calm to his voice. \b "Indubi--Indu--In--du--doo" you cannot finish your sentence. >##sN`KN`K You laugh so hard that you fall out of the tree and land upon the pebbled ground with a muffled thump. With a final shake, the last bit of white dissolves off of the mage's shoulder. Val stalks forward and stares down at you. His expression makes you laugh all the harder. \b"Stop! Stop!" you call out. "It h-hurts..." and you clutch at your stomach. \b "Oh, you need help all right..." the mage mutters before pulling you to your feet. \b "I have had a bellyful of this forest," Val mutters and stalks off to the east.N`K!o>>C)CqjN`K>" VN`KJYou laugh lightly at the mage, who merely raises a pale eyebrow at you. ()5MNK(NK<(KNK\bVal wanders around the treasure room, stopping every now and then to brush smidgeons of dirt off the things that catch his eye. As you continue to rest in a disgruntled heap. QNKo\bVal tilts his head above to gaze upon the new skylight... or perhaps its the rainbow that he is regarding. NK%\bVal's gaze falls upon the chest. NKG\bVal kneels before the chest, deftly running his fingers across it. ONK/\bVal continues to fuss about with the chest.NKNK>" NKy"Do you need help?" you call out to the mage.\b "A sledgehammer, perhaps?". Val 'tsks'. "No style with a sledgehammer.";NK/\bVal continues to fuss about with the chest.4NKo\bVal traces the closed line running along the lip of the chest to the unwieldy metal lock dangling in front.NKv\bVal stares at the iron lock until with a final clank it drops open. "Behold!" he exclaims to no one in particular.5NKn\bVal gently rifles through the contents of the chest, softly laughing every now and then at what he finds. NK>Q H NKFinally the mage draws back with a tattered journal held carefully within his hands. His eyes soften as he gazes down upon it for a moment before carefully taking it away underneath his cloak. >Q&NK>Q H cNKWIt is many long moments before the mage finally sits back and heaves a great sigh.\b NK>" :NK."Are you quite done looting now?" you inquire of the mage. \b Val laughs. "Aye, I'm all plundered out," he says. "We should probably be on our way," and saying such, he begins to scramble up the debris and back unto the surface of the fountain. "Heading to the west," his voice floats down to you. \bNK>" NKThe mage scrambles up the piles of debris and pulls himself through the hole in the ceiling and upto the surface of the fountain once again. m>C) E 6d^  E.  groundyMO actorN1-z=MO actorNU-> > NU-oThe pit that Val has been digging is an affront to your eyes. With nary a blink, you force the earth to close up upon itself once more. With a sharp cry, Val just manages to jump back in time to avoid being buried alive. He stares down at all his hard work undone and then glances back at you, eyes impossible to read. \b "I suppose," he drawls, "that was a subtle hint to move on." For a moment he merely stands there, gazing off at something unseen to the north. Then the mage gives a casual shrug. "It seems that time is almost up anyway." And with that the mage strides towards the glimmering of the lake to the west.m>>9&!9!>&qNU->m" ]NU-IYou smooth over the loose soil until the ground is pristine once more. !m X./  ground,  the groundXMN4The ground here is barren, covered in red slate and swirling eddies of dust. Red rock hills rise cleanly out of the ground, each one as barren as the one before it, all except for the lichen covered pinnacle of the Unicorn's Horn. N4<m" MN4A\b A shallow hole has been scraped into the hard stone ground. 1MO actorN40-MO actorN4>N4qIt takes quite a bit of energy to dig amongst the hard red stone, yet in the end you find nothing of interest. N4]It takes quite a bit of energy to dig amongst the hard red stone, yet in the end you find !."mmyMO actorN4zMO actorN"4<m" ^N"4IYou scrape stone and dust into the shallow hole to fill it once again. !m7N"4+There are no holes to be filled in here. >MO actorN4?mMOactordobjN4 You bury ! # amongst the red stone and dust. &@>A?MO actorN4RMO actorN43The hard-baked ground is warm beneath your feet. ,MO actorN4-*MO actorN'4 Dusty... MO actorNW4MO actorN{4{There's not much that can be done with this dust. If you are really hankering for a dust storm, you can just create one. E.  groundyMO actorN14zMO actorNU4> m" ]NU4IYou scrape stone and dust into the shallow hole to fill it once again. !>m` b` c`A`A`L  white robes Layers upon layers of the finest silk and beaten linen drape the body of the mage from neck to tip of pointed slippers. The robe is a stark gleaming white except for the bright multi-colored embroidery along its edges... indecipherable mage symbols that seem to twist at the eye. \b That's right... mages are supposed to wear long billowing robes, not go romping around in boots and tight breeches...    6  N L Z Y   MO actorN$)QMO actorNH)2You refrain from getting that close to Lorekosi!nJKop,-[\LN LNLNLNPLQNRLSNVLWNMO actorN)4*MO actorN)!> IAIAIL golden slippers wwFlat-heeled golden slippers with pointed curled toes. And you'd lay a bet that those are real jewels bedecking them.     6  N L Z Y   MO actorN )QMO actorN1)2You refrain from getting that close to Lorekosi!nJKop,-[\LN LNLNLNPLQNRLSNVLWNMO actorN)4*MO actorN)!> XJ  /MO actorN!*.=MO actorNE*The north is eerily silent.  your northern borderoMN*>" N*This is the very edge of your lands bordered on all sides by... empty lands. You never knew how much you would miss your neighboring fey. Already the color fades from the fey trees lands. In its immobile shape, it stood no chance at all...WN*KThis is the very edge of your lands bordered on all sides by the domains of the fey tree standing before you. The lands to the north are flat and uniformly green with low lying vegetation as far as the eye can see and nothing particularly striking nor distinctive except the tree itself. The skies beyond are shadowy and ominous.J   south QQFrom this distance only the faintest glimmer of what may be water can be seen. SSSJ   massive trunk of the fey tree, ##the massive trunk of the fey treeMN*>" N*Nothing remains of your fey neighbor but a smoking crater with a scattering of dark twisted limbs clawing their way outside. And even those are fading before your eyes. N*The trunk of the fey tree is singularly enormous, dominating in width as well as height, and far more impressize-- in size anyway-- then any of your trees. It dwarves everything in the near vicinity, making its own oversized leaves seem tiny in comparison. DJ   mottled bark of the fey tree, ""the mottled bark of the fey treeMN$*>" N%*Nothing remains of your fey neighbor but a smoking crater with a scattering of dark twisted limbs clawing their way outside. And even those are fading before your eyes. N&*The bark of fey tree is weathered and old, its brown coloring faded and worn to an immutable gray. Moss has taken ahold of the many rough fissures that mark the face of the tree.  J   ingrained moss, the ingrained moss The moss that marks the fey tree appears to all senses to be nothing but normal. Imagine allowing orderinary moss to grown on oneself!. {{{J   peppering of knotholes9MN7*>" N8*Nothing remains of your fey neighbor but a smoking crater with a scattering of dark twisted limbs clawing their way outside. And even those are fading before your eyes. gN:*[A scattering of knotholes, each one ranging from the size of a baby human's head to the face of a full grown moose, pockmark the surface of the fey tree. When looked on straightly they are nothing but ordinary knots, gnarled and bumpy and plain; but when glimpsed from the corner of an eye it seems that many faces peer out of the holes at you. J   brimming of leaves\MND*>" NE*Nothing remains of your fey neighbor but a smoking crater with a scattering of dark twisted limbs clawing their way outside. And even those are fading before your eyes. NG*~The leaves of the fey tree are toothed and sharp, with many dark veins running through them. Each leaf has nine lobes that come to a jagged point with the top lobes forming a three pointed star. Every one is a perfect, if ordinary, dark green with no brown nor fallen leaves to be seen. While the leaves are large as dinner plates, they are dwarfed by the sheer size of the tree. P   J   broad tree boughs The limbs of the fey look as if they could be smaller trees of their own, writhing up and down and out from the central trunk. It is as if the tree was caught and frozen forever in the middle of its dance.   .   pregnant air, the pregnant air/MO actorNM*.KMO actorNq*,The wind steals quietly across the plains. The air is still and heavy, the calm before a storm, as if the very surrounding lands were holding their breath. Only the slightest of wafts from the north causing the motion of the grass. Above you, the butterflies seem completely untouched by any wind.-MO actorN*kYou inhale deeply. Beyond the immediate sharp taste of growing grass is a ... burning. A very wrongness. y bbYou taste the wind. Beyond the ripe flavor of growing grass there is a faint burning wrongness. MO actorN*MO actorN*@You reach out to touch the wind and it straggles between your !> feathers  fingers. MO actorNu*(MO actorN*>J   sky,  the skiesWMN*>" }N*nThe skies have darkened to the color of dull steel and every passing moment more and more light fades away. N*The few patches of clear sky, seen between the drifts of clouds, remains a brilliant crystal blue above your head. However, the skies beyond the fey tree are unnaturally darkened. 0J   clouds,  the cloudsMN*>" N*White puffy clouds hover nervously around the edges of the plains. They are almost consumed by the unnatural darkness in the skies N*The clouds in this area, although still feathery and white, are so thick in the sky that they cast shadows upon the ground. The skies to the distant north are darker, much darker, although the forms of clouds can not be seen there at all. x888J  ,  the sun sunMN*>" "N*The sun has fled.N*The sun is mostly hidden behind the many high floating clouds in the sky. Every now and then it bursts free from its covering and casts shafts of light shadow across the plains.  x555.  ,the sun shadows  sun shadows You idly gaze down at the shadows cast by the clouds and suddenly freeze. For a moment the shape of a dark hand seemed to reach out for you, but then the clouds stir around the sun and the shadows resume their shifting patterns. !l) ) )M   crimson and gold butterfly\MN*<  N*A butterfly clings stubbornly to your shoulder. Its crimson wings, marked by golden double eight figures, flicker slightly with your movement. N*< D  Whoo!N*yA lone butterfly drifts close to you, its wings of deep gold and crimson fluttering only slightly as it rides the wind.MO actorN*)FYou reach out towards the butterfly and it obligingly lands on your !> wing hand. MO actorN:*MO actorN^*UThe butterfly feels like taut silk, a fragile solidness. A faint powder dusts your !> feathers hands- from where you touched the insect's wings.-SMO actorN+*4The butterfly smells of flower pollen and nectar. MO actorN*6~MO actorN*FThe butterfly wriggles out of your grasp and flaps away in affront. N*> >!&)"<J   sea of butterflies/MO actorN;*.QMO actorN_*2The butterflies hover silently high in the air. MN*>" N*The sea of butterflies roils about in a frenzy, their colored wings pounding silently at the air, as they circle around and around the intruding pale figure of the mageEN*9A sea of butterflies drifts high above your head. Splashes of sunlight break through the clouds, highlighting the many-colored wings that barely seem to beat at all. The butterflies waft delicately and wait patiently. You have trouble imagining what they could be doing up there, so far from their own flowers. MO actorN*MO actorN*>" uN*fThe butterflies draw closer to you but return to their station around the mage as soon as he moves. iN*]You beckon towards the butterflies but they draw no nearer. How odd they are acting today! #  .   sea of green grass A sea of tall green grass swaying in the wind. The grass grows shorter as it travels south to the rest of your demesne and north beyond your borders. /MO actorN+.eMO actorN+FThe grass stirs and faintly, faintly can be heard the sound of seas.MO actorNh+MO actorN+You !> fly run your handsB through the top of the grass and it parts smoothly before you. -fMO actorN$+GIt smells of a ripe greenness, sharp with a hint of metallic flavor. mMO actorN+>" FCYou shouldn't overburden yourself with items while in this form. zMO actorOxN +-You pull free a single long blade of grass.N +$ZN +&$|: : :<MD  ""single blade of long green grass blades of long green grass zzA single blade of grass, jewel green and nearly as long as your arm. It has begun to sprout the tiniest bit at its tip. MO actorN+DMO actorN+%The grass is delicate, but coarse. -fMO actorNe+GIt smells of a ripe greenness, sharp with a hint of metallic flavor. +y ``You knaw on the end of the grass. It's sharp and and a bit acrid, with a metallic aftertaste. %w w w.    gathering of ripe golden grass/MO actorNG(+.eMO actorNk)+FThe grass stirs and faintly, faintly can be heard the sound of seas. The grass turns a ripe golden color with clusters of little white blossoms along their tips. When these stalks brush against each other a soft sibilant sound arises. MO actorN++MO actorN-+You !> flyrun your handsB through the top of the grass and it parts smoothly before you. -FMO actorN?/+'It smells sweetly of dried sunshine. mMO actorN0+>" FCYou shouldn't overburden yourself with items while in this form. vMO actorOxN2+)You pluck a single long blade of grass.N3+&ZN4+&&Q Q Q<MD  plucked golden grass plucked golden grass A single blade of grass, dark golden and nearly as long as your arm. It has a small cluster of white blossoms at its tip and lighter veins of yellow, where the sun has bleached its surface, run through the stalk. MO actorNBA+RMO actorNfC+3The grass is delicate, but coarse and a bit dry. -FMO actorNE+'It smells sweetly of dried sunshine. +y >>You knaw on the end of the grass. It's sweet yet a bit dry. 'W W W.   spread of sunset orange grass/MO actorNFO+.eMO actorNjP+FThe grass stirs and faintly, faintly can be heard the sound of seas. }}The hue of the grass deepens to the color of the burning sunset sun. Its swaying looks like flickers of fire in the field. MO actorNXR+MO actorN|T+You !> flyrun your handsB through the top of the grass and it parts smoothly before you. -MMO actorNV+.A pungent smell like extinguished charcoal. mMO actorNfW+>" FCYou shouldn't overburden yourself with items while in this form. {MO actorOxNY+.You pull free a single long snatch of grass.NZ+(ZN[+&(`  <M  snatch of sunset orange grass !!snatches of sunset orange grass A single blade of grass, sunset orange and nearly as long as your arm. The edges of the blade have turned a rich dark brown. MO actorNg+RMO actorNi+3The grass is delicate and crumbles at the edges. -NMO actorNtk+/A pungent smell like extinguished charcoal. +y LLYou knaw on the end of the grass and its pungent flavor fills your mouth. )m m m.   expanse of deep crimson grass/MO actorNFu+.eMO actorNjv+FThe grass stirs and faintly, faintly can be heard the sound of seas. The tint of the grass deepens further, into a deep crimson, a rich burgundy, the color of a lush old wine. A better color, a better wine than can be found at the tavern. MO actorNx+MO actorNz+You !> flyrun your handsB through the top of the grass and it parts smoothly before you. -5MO actorNB|+A rich spicy scent. mMO actorN}}+>" FCYou shouldn't overburden yourself with items while in this form. zMO actorOxN+-You pull free a single long plume of grass.N+*ZN+&*$  <MD  plume of crimson grass plumes of crimson grass vvA single blade of grass, deep crimson and nearly as long as your arm. Its color is unblemished with any impurities. MO actorN+AMO actorN +"The grass is strangely velvety. -6MO actorNQ+A rich spicy scent. +y NNYou knaw on the end of the grass and the bite of spice touched your tongue. +  .   00span of purple grasses in all different shades/MO actorNW+.eMO actorN{+FThe grass stirs and faintly, faintly can be heard the sound of seas. The span of purple grass ranges from a deep royal purple in the south to a light airy violet near the edge of your lands. The soothing waves of the grass are almost hypnotizing. MO actorN+MO actorN+You !> flyrun your handsB through the top of the grass and it parts smoothly before you. -\MO actorN[+=A light floral scent, almost the scent of a violet itself. mMO actorN+>" FCYou shouldn't overburden yourself with items while in this form. |MO actorO0xN@+/You pull free a single long tendril of grass.N@+,ZN@+&,_ _ _<M D tendril of violet grass tendrils of violet grass A single blade of grass, airy violet in color and nearly as long as your arm. Darker veins of purple cobweb through the curling tendril. The main body of the plant is almost tranparent. MO actorN.+NMO actorNR+/It reminds you of silk stretched over wires. -]MO actorN+>A light floral scent, almost the scent of a violet itself. +y MMYou knaw on the end of the grass. A sugary sweetness, faint but appealing. -s s s.  /MO actorN!+.eMO actorNE+FThe grass stirs and faintly, faintly can be heard the sound of seas. sweep of blue grass The grass here returns to a hue of blue that is only a few shades off the normal color. This line of vegetation marks the very outer edge of your domain. MO actorNm+MO actorN+You !> flyrun your handsB through the top of the grass and it parts smoothly before you. -UMO actorN(+6It smells almost, but not quite, like normal grass. mMO actorN+>" FCYou shouldn't overburden yourself with items while in this form. zMO actorOxN+-You pull free a single long stalk of grass.N+.ZN+&.$  <MD  stalk of blue grass stalks of blue grass IIGrass of middling blue with streaks of sheer green threaded through it.MO actorN+QMO actorN+2A mottled texture, half smooth and half coarse. -VMO actorN.+7It smells almost, but not quite, like normal grass. +y ++A faint taste, familiar but unplaceable. /D.  &&Edge of the Plains, Edge of the Lake 44Now is not the time to be gawking at your scenery!/MO actorN,.GMO actorN,(Silence beneath the sounds of battle. oMO actorN,p;MO actorN,There is no time for that!YMO actorN],Z^MO actorN,>" N,CN,C cYZYZ0 .  pool of spreading oil GGThick and viscous, this appears to be some concentrated form of oil. MO actorN,\MO actorN,=You dip a wing into the dark liquid and it clings thickly. ,MO actorN,-cMO actorN5,DA sharp tang, much like the burning oil found back in the tavern. YMO actorN,Z^MO actorN,>" N,CN,C oMO actorN&,p;MO actorNJ,There is no time for that!cYZYZ1YYYJ  ""empty lands beyond your boundary, &&the empty lands beyond your boundary/MO actorNuK-.MO actorNL-}Your senses do not extend to the empty lands. Undoubtedly normal sounds fill the normal lands from its normal inhabitants.  Uninhabited fields and trees stretch out before you. Undoubtedly there are animals and humans who live somewhere on this land, but no fey has possessed it for many years. You've been steadily pressing your influence upon it, in a contest between you and the other surrounding fey. 2J  ""empty lands beyond your boundary, &&the empty lands beyond your boundary/MO actorNuT-.MO actorNU-}Your senses do not extend to the empty lands. Undoubtedly normal sounds fill the normal lands from its normal inhabitants.  nnUninhabited fields and trees stretch out before you. Undoubtedly there are animals and humans who live somewhere on this land, but no fey has possessed it for many years. You've been steadily pressing your influence upon it, in a contest between you and the other surrounding fey. A chill runs through you as you gaze at the northern skies beyond the empty lands. 34  J  sculpted red hills, the sculpted red hillsMN`->vg" Na-To the south red earthen hills flow out of the ground, unnaturally smooth and rounded. They form a steep cavern blocked off by the tumble of red dust and stone that fills the arch of stone. Nc-To the south red earthen hills flow out of the ground, unnaturally smooth and rounded. They form a steep cavern which can be entered through a tall arch of red rock. /MO actorNd-.NMO actorNe-/A faint keening can be heard from the south. oMO actorNrf-p[MO actorNh->vg" Ni-You glare are the chaotic tumble of stones and it trembles, slowly sinking into the rocky ground, as the hills around you quietly lengthen, stretching outwards arms of earth and stone until they are perfectly curved and smooth once again. !vg.Nk-"The hills are fine as they are. 4~~~J\  red rock arch GGA tall arch of red stone, its shape and form is naturally irregular. ~~You gaze through the red rock arch and something flashes back at you... something reflective catching the light of the sun. /MO actorN w-.NMO actorN-x-/A faint keening can be heard from the south. 5PJ  forest BBTo the southwest the distant edge of a hazy forest can be seen. /MO actorNw-.=MO actorN-The forest is too far away. 6PPPJ  your boundary, your boundary your boundary You can sense towards the north the line where your influence ends and the Tree's begins. The skies beyond are shadowy and ominous. /MO actorN-.=MO actorN-The north is eerily silent. 7dddJ   far lake 00A shimmer of low lying water in the distance. 8J  plains,  the plains UUGreen stretches out further to the northwest and takes the form of rolling plains. 9p/ / /5M  Val's shovelFMNo<" NoThe smoothly curved head of a shovel, metallic and dark and larger than a man's own head, connected to a nub of a handle. How in the world was Val using this?NouA dark shovel, head smooth and curved, with a long, pale wooden handle. Where in the world did Val pull this from? MO actorNooMO actorNoPThe wooden handle is smooth and cool, the metal head smooth and cooler still. :". UUYou can sense your treasure room lying in the hollow ground underneath the fountain UUYou can sense your treasure room lying in the hollow ground underneath the fountain;". UUYou can sense your treasure room lying in the hollow ground underneath the fountain UUYou can sense your treasure room lying in the hollow ground underneath the fountain<J  treasure room UUYou can sense your treasure room lying in the hollow ground underneath the fountain=  <M  hunk of mixed heath yyA handful of vegetation pulled up from the heath... short dark grasses, peat, moss, lichen, and bits of sedge mixed in.y GGYou bite into the heath. It's soggy and not particularly delectable. -FMO actorN.'Deep earthy smell of wet vegetation. MO actorN^.4MO actorN.Soggy and squishy. >XJ  sky,  the skies The sky above you, seen between the many fluffy clouds, is a brilliant blue. Endless blue to the south and west, but greyness intrudes from the east and north. To the far north the greyness darkens even further. ?J  clouds,  the clouds iiThe clouds floating above you are fluffy and puffy, piling one atop the other until they form towering mountains of ethereal vapor. A raindrop standing on end can be seen over here, and there a tall tree, spiraling up into the heavens. At the edge of the horizon sits a puffy whorl, trails of cloud vapor nearly forming the perfect spiral of a pale seashell. @8J ,  the sun sunMN2.The light catches within the streams of water, golden glimmerings inside the fountain that burst free in the form of a fall of rainbows. You walk around the fountain, stand back, and it's as if the sun itself is caught within the sprays. N3.> > E >q" `N4.T"Tis dangerous to stare at the sun like that," Val says he gazes at you sideways. "qA  .  wind/MO actorN-<..dMO actorNQ=.EThe sound of the wind is drowned out by the music of falling water. zzThe wind here is crisp and cool, yet not half so pure or refreshing as the water that arches tantalizingly into the air.-:MO actorN;@.The sweet tang of water. MO actorN{A.MO actorNC.@You reach out to touch the wind and it straggles between your !> feathers  fingers. MO actorN0D.(MO actorNTE.>B  .  slender plume of water With a soft roar a slender stream bursts free from the ground. A few wisps of mist surround it and a smattering of water tendrils spiral outward before falling back to the earth. The water is clear and crisp, glimmering tantalizingly in the sun. uMNO.You carefully press your !> beak lips to the fountain. The water that flows down your throat is chilled and delicious, a pure rich flavor with a crisp aftertaste. ,MO actor-?MO actorN-Q. The sweet tang of pure water. MO actorNrR.MO actorNS.You stand in the way of the fountain and allow a few tendrils to trickle down your body. The water is cool enough that it will numb your skin if you tarry too long.t llYou prance through the fountain of clear waters and rainbows. Alas, its far too small to properly swim in.C   .  water droplets, the water droplets zzA few errant droplets of water shake free of the fountain and glitter in rainbows of color as they shower to the ground.u XXYou catch a droplet on your tongue. It's like a little kiss of coolness and moisture. MO actorN1`.DMO actorNUb.%The droplet is cool to your touch. ,MO actorNc.-9MO actorNd.The tang of pure water. MO actorNe.MO actorN&f.You catch a droplet on your !> wingfeather fingertip6. It gleams at you as it slides away to the ground. D@  .   fine mist The air is filled with a cool mist of tiny water droplets that gently coat your skin. Around the fountain itself a thicker haze has developed, like strayed clouds that have wanderd too close to the ground. u XXYou catch a droplet on your tongue. It's like a little kiss of coolness and moisture. MO actorNfo.DMO actorNq.%The droplet is cool to your touch. ,MO actorNr.-9MO actorNs.The tang of pure water. MO actorN7t.MO actorN[u.You catch a droplet on your !> wingfeather fingertip6. It gleams at you as it slides away to the ground. E0  .\<  symphony of rainbows Around the fountain, in every direction, rainbows shimmer in and out of being. Rainbows arc high into the heavens, cross and meld in midair, and swoop to touch the ground. One such seems to plunge into the ground beneath your feet u ccYou walk towards a rainbow, open your mouth, and allow an etherial sweetness to fill your being. y ccYou walk towards a rainbow, open your mouth, and allow an etherial sweetness to fill your being. You gaze through the rainbow and behold a castle in the sky, a mountain climbing to the heavens, a lake filled with stars, a maze of green, a river of blue, and a flickering of a thousand different images through your mind.MO actorN.MO actorN.You reach out towards a rainbow and it reaches back towards you. Colors play across your fingertips, streaming past you, streaming through you. ,MO actorN.-HMO actorN.)The tang of pure water and true light. MO actorN8.jMO actorN\.KAs much as you love rainbows, that really would draw too much attention. Fc c cWM#  big wooden washbowl A large shallow washbowl, round as a full grown pumpkin. It's sides are smooth and unstained from its short stint as the tavern's fruit and vegetable washer. MO actorN0<MO actorN0Smooth beneath your touch. -EMO actorNT0&There's not much of a scent at all. MO actorN0MO actorN0~You can't quite remember why you decided to take this... certainly you must have thought it a good idea at the time. G  .  air,  the air/MO actorN;..MO actorN_.kNothing but peaceful silence. That is until you drop a sword upon the stone ground with a great clatter.  The air within the treasure room is still and full of the scent of secrets. It also smells of staleness and mustiness... perhaps you ought to air it out sometime soon. -NMO actorN./You inhale a bit of dust with a great cough. MO actorN.jMO actorN.KThere are much more interesting things here to touch than the stale air. MO actorN.(MO actorN.>H`   .Z  heavy wooden chest~I|rMN.A heavy chest made of medium grade wood and of middling craftmanship. A slight edge of golden gilt has been applied to it, but otherwise the chest lacks any ornamentation besides the heavy iron lock that hangs from it. \b )MO actorNL.<MO actorNp.Smooth beneath your touch. -<MO actorN.It smells like musty wood. 3)MO actorN.J3I[MbD wrought iron key A rather large wrought iron key with three beveled teeth down its sides and three overlapping curlicues along its top. Its a random looking key, to fit random objects. MO actorN;MO actorN;7You think of a key, large and ornate, and it appears !>before your eyeswithin your hand. >I&J,  5 H brimming pile of plush toys IIA jumbled pile of stuffed animals, wooden toys, and various playthings.MO actorN/^MO actorN /?You plunge into the pile and are overwhelmed with fuzziness. -LMO actorN"/-It smells like sunshine and dried flowers. mMO actorNm#/>" FCYou shouldn't overburden yourself with items while in this form. uMO actorN%/VThe entire pile? Perhaps you could find something in particular you'd like to take. (+MO actorNe'/3_MO actorN)/#You paw through the pile of toys (N*/<(KN+/N,/?and find a fragile kite tucked into one corner of the chest. L&N-/N./N//7and find a small brass bird which piques your fancy. M&N0/@N1/N2/Gand find a plush sea creature in the middle of the pile of plushies. N&N3/N4/N5/>and find a lone playing card mixed in with everything else. O&N6/gN7/N8/and find a small toy boat. >&N9/!N:/N;/<and find a pair of dice buried at the bottom of the pile. P&N/N?/Bbut find nothing else that particularly catches your attention. N@/(NA/>6\[]KP. ~I  iron lock A simple iron lock with a wide toothed mouth for its matching key. Fate alone knows where the original key might have wandered off to.MO actorN.1MO actorN.Cool and heavy. -:MO actorN#.A musty, metallic smell. #MOactorioNc.MOactorioN.>H~ uN.7You unlock and open the heavy wooden chest to reveal H. N."H|N.!HrBN.\^! !n't fit the lock. {MO actorNu.}!MO actorN.-PMO actorN.!MO actorN/-P#MOactorioN /MOactorioN4/>H~ JN4/-You close and lock the heavy wooden chest. "Hr!|BN4/\^! !n't fit the lock. #MOactorioN/MOactorioN />H~ QN / You close and lock the chest. N /!H|N /"HrBN/\^! !n't fit the lock. LT     M HPMNL/<" (NM/kite trailing after youNO/kite 77You discover a a fragile kite tucked into one corner.SMNQ/A fragile kite of dried reeds and blue parchment, found tucked into a corner of your treasure chest for safe keeping. The roll of twine attached to it is bedecked with dainty little blue ribbons.NR/<" lNS/`The kite flits hither and thither through the sky, joined to you by the slender cord of twine.MO actorNT/CMO actorN9V/$A flimsy thing within your hands. -;MO actorNX/A faint smell of perfume. CgMO actorNZ/>  E >" _N]/FYou uncoil the roll of twine, lift up the delicate kite just so, and proceed to rush wildly about the edges of the room, upturning chairs and scaring cats and tavern patrons alike. \b "Good gods man, are ye daft?" says the tavern keeper. "Take that thing outside!" \b And you are not-so-gently escorted out of the tavern. \b>N^/> b D > d D > c N_/vThe kite goes skittering across the stone walls of the caves. Perhaps you ought to try this in a more open location?#N`/>  Na/You pull out the kite which bobs and weaves through the water, scattering little silvery bubbles in its wake. Suddenly the end of its line snaps in your grasp and the kite slowly rises upwards, floating to the surface and out of sight.)Nd/You carefully unroll the twine, gently hold the fragile kite in one hand, and break out into an elegant lope within a few strides. The kite twitches and fidgets within your grasp, and then with a final burst of wind, it breaks free and soars upwards into the sky, growing tinier and tinier as its blue ribbons trail gaily behind it. \b For a moment you stand back and watch the flying free of all restraint. But no, that's not quite right, its still bound to the earth by the string that connects it to you. "MO actorN0f/<" N0h/There is the softest flicker of feeling as the kite's string streams through your fingers. And then its gone, the twine, the bright blue ribbons, and the blue parchment of the kite, soaring higher and higher, free and unfettered by anything in this world. \b The kite begins to drift to the south as it rises, higher and higher, and then it sails out of your lands and beyond your sight. <&N0j/)32M M H small brass bird MMA small bird, molded entirely out of brass, that sings when you wind it up.MO actorN/WMO actorN/8The cold metal makes a pinging sound when you tap it. -DMO actorN/%A faint metallic smell of perfume. /MO actorNY/.BMO actorN}/#You'll need to wind it up first. MO actorN/NMO actorN/<" E >" E >  N/You reach over and grasp the metal nightengale within your hand, jamming your fingers into its winding mechanism. The song of the nightengale coughs to a stop and the hills finally shiver back into stillness.\b Val wipes at the coating of red now covering him and says, "That fountain up north is looking better and better." as he eyes the toy bird warily. And with great alacrity the mage leaves behind the red hills and walks off to the north. !C>>9&"9>&N/)LMO actorN=/NMMO actorNa/<" E >" E >  Na/You reach over and grasp the metal nightengale within your hand, jamming your fingers into its winding mechanism. The song of the nightengale coughs to a stop and the hills finally shiver back into stillness.\b Val wipes at the coating of red now covering him and says, "That fountain up north is looking better and better." as he eyes the toy bird warily. And with great alacrity the mage leaves behind the red hills and walks off to the north. !C>>9&"9>&Na/)(MO actorN/=MO actorN/|Hidden gears within the little bronze bird click and clack as you carefully wind it up. The bird whirs and begins to sing (N/<(KN/N/kan immitation of a nightengale's lovesong so pure and true that none would be the wiser for the forgery. !<N/YN/N/with the sound of violins wailing, flutes trilling, and the chiming of silver bells in the background. You have always found this a rather strange and sad song for a wedding march.!<N/zN/N/}a strange song of whispers, pitched just below the point of hearing, so that none can ever know exactly what is being said.!<N/N/N/ja sweeping aria that rises higher and higher until it concludes with a single drawn out note of triumph.!<N/AN/N/\a startling melody in a hundred children's voices, singing about the sun chasing the moon.!<N/N/N/Dan empty sound of whirs and clicks. The sixth song has been lost. !<N/ON/(N/0EISQMN/<  N/\bThe murmur of conversations stills as the tavern patrons begin to listen to the warbling of the brass bird. \b The tavern maid sighs happily. "That's a very beautiful song," she says. \b "It reminds me of an ol' story, " begins !>-. \b "Oh lord, here he goes again..." says !>F&. \b "About this here nightengale," !> continues on blithely. "Who sang so beautifully that twas enough t' make a grown man cry. The emperor heard o' this and sent all his men out to catch the lightninggale--" \b "Someone has had too much to drink, " laughs !>Fb. \b "--the nightengale, as I was sayin'. And I don't mind if'n you drink, Old Man, " continues !>. "So they chased the poor bird over hill and dale, across mountains and lakes, but they never could do no more than clap their eyes upon 'im. So finally the emperor just has a little nightengale o' his own built, out o' metals and springs and whatnot. \b And wouldn't you know, but the real nightengale takes one look at the fake and falls rightly in love! So then the emperor ends up having two light-- nightengales flutterin' all about his palace and-- " \b "He might have had three or more if one of them wasn't made of metal!" !>F laughs. \b \^!> scratches his head. " And then-- and then-- I believe one o' the princesses got into a fight with her father and threw the metal bird into the fire in some ol' hissy fit. And the real nightengale flew in right behind it and was burned all up..." \b "What?!" explodes !>F8. \b "That's a sad story," says the tavern maid. \b \^!>H finally speaks up. "I don't remember the story quite going that way."N0< > pN0d\bVal listens quietly to the song of the nightengale. "That is its mating call," he finally says. `MN 0<  N0\bThe murmur of conversations stills as the tavern patrons begin to listen to the warbling of the brass bird. \b The tavern maid sighs happily. "That's a very beautiful song," she says. }N0< > fN0Z\bVal slightly tilts his head back to you as he listens to the song of the nightengale. ,MN0<  uN0'\b "That there is an odd song," says !>2.\b The tavern maid nods her head in agreement. N0< > N0|Val gazes down at the little brass bird with a stange tilt to his lips until the toy winds down once again. He then raises his gaze to stare off into the far horizon. \b "Funny to hear those songs here, once again, " he says and his voice lacks any laughter at all. "Melodies like this were composed for the King of Panarche, quite a long time ago. " Val seems lost in thought. MN!0<  TN"05\b "Seems like the thing has gone and broke!" says !>.;N$0< > E <  N%0C)"MN)0ՠ<KVN*0\bSuddenly a grinding noise begins to emanate from deep within the bird. It continues to whir and click and grind, louder and louder, until the very hills begin to tremble with the sound. Startled, Val stops his chant and stares down at the little brass bird in some horror. [N,0Avalanches of red dust and stone stream down the groaning and convulsing hills. Val staggers and falls to his knees. \b "It will destroy the area if its not stopped! " he shouts over the clamor. N/0The little brass bird glows fire red hot, dark plumes of smoke rising from it, as it scorches the surrounding ground. The bird trembles and twitches like a live thing as it melt into the stone below it, smoldering and burning until it sinks from view. ~N10<The red hills shiver and shake all around you. Clouds of dust and red pebbles clatter to the ground and suddenly there comes a dull roaring, different from the groaning of the earth beneath you. Val curses and then runs full tilt into you, pushing you back and away, all the way to the other side of the red arch. 5N40N70A waterfall of red stone and dust follows you as the hills collapse in upon themselves, sealing off the red arch and the entrance to the rest of the area. Val wipes at the coating of red now covering him and says, "That fountain up north is looking better and better." And so both of you set off for it, you with many backward glances at the collapsed red hills. The damage doesn't appear to be too difficult to repair. >>"g"vg>9&"9!>&C)NM H plush sea creature It appears to be some kind of exotic sea creature, much like a fish only with a sidewise tail. Its skin is a soft gray velvet that has been stuffed full of goose down and two round buttons are its eyes.MO actorN/2MO actorN3/Squeezably soft. -LMO actorNk/-It smells like sunshine and dried flowers. OD H King of Hearts A lone playing card, the King of Hearts, made of a good heavy parchment and expertly inked. The king is white haired, but beardless and young-seeming, a rather dashing figure actually. But what happened to the rest? MO actorN/6MO actorNA/Smooth and flexible. -;MO actorN}/A faint smell of perfume. PM H You find a pair of dice. pair of dice 88An oversized set of dice, heavy and carved from ivory.MO actorNw/YMO actorNy/:You can feel the dots carved into the face of the dice. -EMO actorN{/&It smells a bit like dried flowers. MO actorNc|/|MO actorN}/*You roll the dice and they turn up with !< @ spots showing amongst them.SStwothreefourfivesixseveneightnineteneleventwelve=Q;M# H tattered brown journal {{A slender journal with a battered brown leather cover and tattered yellowing pages filled with large spidery handwriting.MO actorNH0MO actorNJ0>Q" NK0You vaguely recall, a century or two ago, taking a hedge wizard and his son on a merry goose chase across you lands and finally dumping them in your forest somewhere when the Beast once ahain intruded upon your lands. NM0sYou cannot recall who you took this journal from... whoever they were, they apparently weren't memorable enough. MO actorN}O0gMO actorNQ0HThe cover is cracked and the pages are fragile underneath your touch. -6MO actorNS0An old, musty scent. (MNU0PYou carefully page through the journal, glancing through various excerpts...\b(NV0<(KNW0NX0R... long roads to walk peddling my herbs and charms, with the odd incantation if the situation calls for it. I find myself more tired after the rituals than once before... I suppose that age is beginning to catch up.... but these far flung places where true mages seldom deign to travel are quite welcome to the sight of a hedge wizard.NY0NZ0N[0!...having returned to Ki-Nor for all too brief a visit and was quite surprised to have Maia ask to bring the little one along. She has often begged me to take up a practice within the town walls and so to send our son out... but it seems that he has begun to show not a little promise...N\0N]0N^0... quite different with Trey. We have crossed over the Orea, through some glorious scenery with the woods beginning to turn all different shades, and into some lands I am not familiar with. In our last stop Trey helped with an old woman suffering from...N_0N`0Na0... must be more careful now. We were attacked on a four way crossroads by little unseen things. Or at least unseen by me. Trey seemed to sense them and was able to throw them off with torches of living wood... Nb0Nc0Nd0...have found a quaint travel house and tavern. Very interesting indeed, as it is rumored that it is surrounded all sides by haunted lands. It sounds to me that we may have stumbled upon lands inhabited by the fey themselves...Ne0Nf0Ng0A...I am quite certain of it now, that this tavern borders-- if not on the land itself-- one of the fey's domain. From the stories told round the hearthfire it seems this fey may be more playful than malignant and perhaps offers an opportunity... although he does not speak of it, his eyes belie that he wants to meet...Nh0(Ni0Nj0...dallied longer than expected here, but the tavern patrons have been most accomodating... have recently met a stranger who has agreed to act as a guide into the nearby forest of the fey..."QNk0(7RMO quipnoN7 o0KN7 p0$Is this what you were looking for?~N7 q0$Why are you so interested in this?MN7 r0"What will you give me in return?npMO quipnoN u0K4N v0\b"Is this what you were looking for?" you ask the mage as you nod towards the tattered journal. "Nay," he replies. "Although I am glad to have this. What I came for may be even more precious." LN x0\b"And why would you be so interested in an old hedge wizard's journal?" you ask. "The secrets of the world are contained therein," Val replies. \b "What?" you say and look down upon the tattered book. "Maybe I'll tell you the secrets later," Val teases. N {0\b"And what will you give me in return now?" you ask Val. \bThe mage smiles wickedly at you. "My undying thanks and..." \b "Or perhaps I shouldn't ask," you say. -N }0>  N ~0His interest in the treasure room apparently sated, Val scrambles atop the piles of debris and hauls himself out of the hole and upto the surface of the fountain once again. "Heading to the west," his voice floats back to you. m>Sh'''.  piles of treasureMN0An underground cavern beneath the rainbow fountain, its obsidian walls reflect the light a hundredfold. Carefully heaped all around are your treasures, rusty parts of armour, discarded bits and pieces of clothes that caught your eye, piles upon piles of books about the outer world, a big gilded wooden chest full of something or other, pots and pans and baubles and knickknacks scattered hither and thitherN0>F  N0q, a crystal chandelier dangling darkly in one corner, and the big wooden washboard from the tavern's scullery. FN0:and a crystal chandelier dangling darkly in one corner. N0All things that you have tricked or snatched or cajoled from the various people passing through your lands over the many years.MO actorNN0lMO actorNr0You run your !>talons  fingers over your treasure.. -@MO actorN0!Perhaps it's a tad musty here. TA A A.  obsidian walls of the cavern The walls of this cavern are a brilliant smooth obsidian, placed at just the right angles to reflect the best light upon your treasure. MO actorN0<MO actorN0Smooth beneath your touch. 1MO actorN;00OMO actorN_00Everything here is already quite well buried. >MO actorN0?VMOactordobjN00Everything here is already quite well buried. @>A?U$.  parts of armourMN0JBits of armour, weapons, and shields are strewn about the room. There's N0V  )&a thickly rusted helm at your feet, N0!several swords of varying sizesN0W  , a pair of gauntletsN0>K  52, a full suit of silver standing in a far cornerN0X  :7, some black leather lying across a mound of things, N0 and N0Y  ,) a scythe balanced precariously across N0a glass stool. MO actorN70GMO actorN[0(Some of those pieces are quite sharp! -9MO actorN0A faintly metallic smellVt t tLM  --You pull the spiked helmet over your head.  OOYou carefully pull the spiked helmet off, careful especially of said spikes.  spiked helmetMN1DA spiked helmet with three jagged points sitting atop it's crest. N1<" 6N1'It's silver surface gleams brightly. N1uIt may once have been silver, but has since entirely succumbed to red rust. The rust mocks you with its rustyness. MO actorN1MO actorN1~It's quite sharp! If you were in the mood to mimic a stag and run head first into people, you could do quite a bit of harm. -9MO actorN!1A faintly metallic smellMO actorN#1^MO actorN%19You polish the spiked helmet until the rust falls away."WL  toecap zzYou pull on the armoured gauntlets. The sensation is a bit like wearing mittens... very bulky, very very heavy mittens.  ::You pull off the gauntlets and flex your tired fingers. MO actorN2-MO actorN2Cool metal. -;MO actorNH2A faintly metallic smell. X`  LM#  eeYou carefully strap and buckle yourself into the leather armour. Now this is more to your liking... &&You slip out of the leather armour.  leather armour, some leather armour A rigid black leather suit of cuirass, leggings, and dangling tassets. It was hardened by boiling in water and wax-- or so you've heard. MO actorN62DMO actorN82%It feels like leather-- no really. -8MO actorN:2A faintly musty smell. MO actorN-;2MO actorNQ<2When you stole away this leather armour, the young man took it as a sign from god and instead of heading for the war went off to become a monk on some distant mountain. YMMMM  scythe ttA long curved blade balanced on a hilt of smokey black metal. Somehow you doubt this was forged to harvest wheat. MO actorN%24MO actorN'2Cold to the touch. -?MO actorN )2 A faint acrid scent of blood. Z===.   shieldsoMN0You've always enjoyed collecting colorful shields. There's quite a few scattered about here, in different colors and shapes, wooden and metal and enameled. Diamonds and checks and stags on parade, birds on fields of blue, and many different trees, flowers and stars and some hideous beast that might be a unicorn if one squinted in the right way, and even a few shields with royal crowns on them. Nearly all of them are for display and probably couldn't stop a housewife with a scullery knifeN0[  LN0=, but there is a buckler lying on the floor close at hand. N0. MO actorN02MO actorN0Smooth and cool. -9MO actorN0A faintly metallic smell[  LM  ++You slip the buckler over your left arm.  ..You slip your left arm free of the buckler.   buckler NNSmall, round, and dented this may have actually been used as a shield once. MO actorN0AMO actorN0"The metal is pitted and dented. -9MO actorNX0A faintly metallic smell\.  glass pedestal Upon closer inspection this appears to be a crystal pedestal, casting faint rainbows in the light. Embedded within its center is a perfectly preserved pea. MO actorN0GMO actorN0(Your touch glides across the crystal. -EMO actorNL0&There's not much of a scent at all. ]{ { {. \ pea within the pedestal For some strange reason, someone has encased this pea within crystal. To all outer appearances it appears to be a perfectly normal, if somewhat shriveled, pea. MO actorN1GMO actorN 1(Your touch glides across the crystal. -NMO actorNY1/You can't smell the pea through the crystal. MO actorN 1MO actorN 1You have trouble imagining what you'd do with an old pea. If you're craving them that much, perhaps you could create some fresh ones? ^`  .#  collection of swordsMN-1cYou've amassed quite a collection of swords over the years, in varying styles and types. There's N.1_  2N/1&a crude little sword close at hand, N01`  5N11)a curved blade lying across the floor, N21a  HN319and a fancy gilded sword stuck within a pile of armour.BN516an empty space where some of your swords used to be.MO actorN618MO actorN 81Those are quite sharp. -;MO actorNJ:1A faintly metallic smell. mMO actorN;1>" FCYou shouldn't overburden yourself with items while in this form. eMO actorN<1FSurely your not planning on carrying around your entire collection? MO actorNi=1MO actorN>1bYou have always had a fascination with swords. They are amongst your favorite things to snatch. _  Mb  crude short sword QQA crude short sword, made all of one piece and little bigger than a long knife.MO actorNJ18MO actorNL1It's simple but sharp. -;MO actorNN1A faintly metallic smell. MO actorN:O16MO actorN^Q1>  E >" gN^R1GWith a flourish you tilt back your head and plunge the sword up to its hilt within your mouth. Seeing as how this is part of your treasure, you do not bite down, but instead pull the sword free and intact once again. There are a smattering of gasps amidst the applause within the tavern. "We've a regular gleeman here!" says !>F. =N^T11Maybe when you are in a more masochistic mood. MO actorN:U1fMO actorN^V1<You summon forth a sword and it rises up from the ground. > <&`  M  curved sword The blade to this plain sword is slightly curved. You can see the many ripples within formed by the folding of the metal during its creation. MO actorNf1NMO actorNh1/Very sharp. It fits easily within your hand. -;MO actorNGj1A faintly metallic smell. MO actorNk16MO actorNm1>  E >" gNn1GWith a flourish you tilt back your head and plunge the sword up to its hilt within your mouth. Seeing as how this is part of your treasure, you do not bite down, but instead pull the sword free and intact once again. There are a smattering of gasps amidst the applause within the tavern. "We've a regular gleeman here!" says !>F. =Np11Maybe when you are in a more masochistic mood. aZZZM   fancy swordMN|1<" N}1Light gleams impressively off the remains of this fancy sword. Its hilt is carved ivory, its pommel an elegantly swirled gold, its metal bejeweled and snapped neatly in half. Well, at least it looked pretty. N1Light gleams impressively off this fancy sword. Its hilt is carved ivory, its pommel an elegantly swirled gold, its metal bejeweled and thin as a wisp. |MO actorN1]This sword is rather uncomfortable to hold due to the jagged ends of the ivory and jewels. -;MO actorNc1A faintly metallic smell. LMO actorN1N\MO actorN17The fancy sword snaps like a twig beneath your blow. "%MOactordobjN*1rMOactordobjNU1As you attack ! ( the fancy sword snaps cleanly in half"oMO actorN1pMO actorN1_With a thought the fancy sword is whole once again. A very pretty piece, if utterly useless. !MO actorN{1MO actorN1You stole this off some bumbling prissy who had been stumbling around your forest. The sword is like its former owner, very pretty but pretty useless. MO actorN]16MO actorN1>  E >" gN1GWith a flourish you tilt back your head and plunge the sword up to its hilt within your mouth. Seeing as how this is part of your treasure, you do not bite down, but instead pull the sword free and intact once again. There are a smattering of gasps amidst the applause within the tavern. "We've a regular gleeman here!" says !>F. =N11Maybe when you are in a more masochistic mood. b@@@@2 MO actorNuc. K  ailettes Flat pieces of leather on the points of the suit's shoulders. Its coat-of-arms is a white feathered bird that bears a striking resemblence to a chicken. But that can't be right-- who would have their coat-of-arms be a chicken? MO actorN10MO actorNB1Tough leather. -8MO actorNx1A faintly musty smell. dP  .| K7MN1!<|closed openhelm The helm, which would cover the entire head almost down to the shoulders, is rounded in the back and with a birdlike beak in the front. Only the thinnest of eyeslits can be seen with the visor pulled fully down. There's a silly little red plume trailing from the top of the helm.MO actorN1SMO actorN14You pull open the visor for one last peek around. yMO actorN1zNMO actorN&1/The visor closes shut with a metallic clang. MO actorNz1-MO actorN1Cool metal. -;MO actorN1A faintly metallic smell. et444. d helm llA slender, long feather plume decorating the top of the helm. It looks to be a pheasant feather, dyed red.MO actorN1-MO actorN1Cool metal. -;MO actorN1A faintly metallic smell. f  . K helm A hinged piece that protects the eyes, only the thinnest of eyeslits can be seen when its pulled fully down. You've always thought that visors looked rather dashing. Cumbersome, but dashing. MO actorN1-MO actorN1Cool metal. -;MO actorNM1A faintly metallic smell. zdydddga a a. K  greaves,  the greavesMN19Plated and hinged armour that encircles the lower leg. N1<" `N1TUpon closer inspection, there are quite a few green tinted scratches on this pair.MO actorN 1-MO actorN01Cool metal. -;MO actorNc1A faintly metallic smell. MO actorN1MO actorN2You brush a !> wing handB across the scratches and they meld into the surrounding metal. "hp.... K toecap,  the toecaps OOPointed tips on the narrow strips of plate that form the armour for the feet.MO actorN 2-MO actorN 2Cool metal. -;MO actorN2A faintly metallic smell. i. X  cuirass If this was metal it would be called a breastplate. This molded piece of leather is sleeveless and protects the torso from front and back. Iron studs have been rivetted into the leather backing. MO actorNH2DMO actorN!J2%It feels like leather-- no really. -8MO actorNkL2A faintly musty smell. j___.M X  leggings, the leggings ggSupple leather leggings that run from the lower thigh, through a jointed knee, and down to the ankle.MO actorNV2DMO actorNX2%It feels like leather-- no really. -8MO actorN$Z2A faintly musty smell. kfff. X  tassets,  the tassets rrThese tassets are belted around the hips with dangling pointed squares of leather that protect the upper thighs.MO actorNd2DMO actorNf2%It feels like leather-- no really. -8MO actorN+h2A faintly musty smell. l0.  pots and pansMNv2Pots and pans in various conditions litter the room. Some of them are quite tarnished with more than a few holes and some have the sparkle of newly wrought metal.Nw2m  6Nx2*A shimmery frying pan catches your eye. MO actorN=y2JMO actorNa{2+The pots and pans are cool to the touch. -9MO actorN}2A faintly metallic smellmM ZMN2>" #N2Frying Pan of DoomN2normal frying pan hhA large iron frying pan, its surface shimmers in the light almost as if it had been glazed. How odd...MO actorN2EMO actorN2&The frying pan feels normal to you. -9MO actorN`2A faintly metallic smelln.:  crystal chandelier A small chandelier with nine curving iron-wrought spokes, atop which sits nine empty candleholders. Multifaceted bits of crystal dangle on silver chains forming an inverted pyramid.MO actorN2[MO actorN2<You can feel the carvings in the metal of the chandelier. -9MO actorN2A faintly metallic smello"Mn shard of crystal YYA shard of crystal, broken free from the chandelier. It glitters faintly in the light.  UUAmidst the pieces of the chandelier you find a crystal shard that has broken free. MO actorN2PMO actorN21Smooth on three sides and jagged on the other. -_MO actorNo2@It smells like crystal, which is not much of anything at all. pD.  baubles and knickknacksMN2A whole heap of miscellaneous things piled up and around the treasure room. Sparkly things and pointy things and things with odd shapes that caught your eye. In particular you've always been drawn to shiny things... N2q  RN2Fsuch as the crystal ball tucked underneath that handcarved stool andN2r  JN2;the gilded edge of a parasol poking up amongst the piles N2.MO actorN2MO actorN)2You run your !>talons through hands over< the baubles and knickknacks scattered amongst the piles. -6MO actorN2A faintly musty smellq M# gMN2>" -N2cracked mage's memory sphere"N2cracked crystal ballyMN2A crystal ball, the size of a small melon, unfortunately with one deep crack and several smallers ones. Tiny little pockets of air are sprinkled throughout the glass. What first drew your attention to this piece was the mottled colors within it, a pale greeny-blue at its core surrounded with washes of pink and deep yellow. Imperfections during the glassblowing, perhaps, but they make the sphere all the more beautiful.N2>" N2\b Val has informed you that the crystal ball is, in fact, a mage's memory sphere. What precisely a mage's memory sphere is supposed to do is a bit beyond you. MO actorN2MO actorN52CCool and smooth to the touch, as long as you neglect to jam your !>talons  fingers into the cracks. MO actorN2MO actorN2This crystal ball was an actual gift, given freely and not taken, from an old witchwoman who cackled and said that showing it to the right person would prove illuminating. r  M  dainty parasolMN3A dainty sun parasol formed of the thinnest colored linen and with a feathery curved handle. A nine-sided figure has been painted unto the parasol in stripes of dark blue, purple, and deepest red and it has a thin edge of what looks to be copper gilt. \b)MO actorNV3fMO actorNz3GThe stretched linen of the parasol feels fragile beneath your touch. -\MO actorN3=The sweet scent of wood mixed with an acrid bite of paint. MO actorNH3EMO actorNl 3 The parasol opens with a snap."|tm m m0M  delicately carved stool;MN2<" uN2fThe splintered remains of a wooden stool, pretty but far too delicate to actually sit on, it seems. N2A wooden stool delicately carved with round with deer, birds, and flowers. With its three legs elegantly splayed out, it seems far too fragile to actually sit on.MO actorN2PMO actorN21You finger the delicate filigree on the stool. -:MO actorN2The sweet scent of wood. MO actorNC2 MO actorNg2>" JNg2;For a moment you perch atop the delicate stool and rest. Ng2You sit upon the delicate wooden sit for all of a moment before, with a great creaking crack, its legs break apart and deposit you unceremonously upon the ground. oMO actorN2pMO actorN2<" +N2But it's not broken! Yet. kN2_With a thought the stool reassembles itself into its prior, highly delicate, state of being. u@  .:  piles of discarded clothes Colorful bits of clothing are strewn about the room. Carefully smoothed and folded lest they become wrinkled or damaged, yet otherwise placed with no rhyme nor reason. Leggings, vests, and tunics, bodices, full skirts, and frilly dresses, puffy shirts, robes, and underwear; all of them given or wiled away, snatched when they were out of sight or, most amusing of all, taken while they were still being worn.MO actorN3pMO actorN 3QCome to think of it, it has been several decades since you've cleaned in here. MO actorN3NMO actorN3/The piles of clothing are soft to the touch. -.MO actorN3A bit musty. (+MO actorN633MO actorNZ3,You rummage through the piles of clothing (NZ3<(KNZ 3NZ!3and find a dashing red cape. "vNZ"3NZ#3NZ$3 and find a broad brimmed hat. w&NZ%3NZ&3NZ'3!and find a dainty laced dress. "JNZ(3lNZ)3NZ*3NZ+3NZ,3NZ-3NZ.3NZ/3NZ03NZ13/and find nothing else catches your interest. NZ23NZ33Uand find... No really, put the underwear down now and step away from the clothing. NZ43(NZ53a ^     0v\  LM  cape of red satin EEYou settle the red cape over your shoulders with a dramatic swirl.  11With a flamboyant twirl you take off the cape. MO actorN>3BMO actorN@3#Smooth as satin, soft as velvet. -FMO actorN,B3'It smells of stale perfume and musk. =rMO actorNxD3<" 5NxE3)You swirl the red satin cape dashingly.NxF3> >v D> > vNxG3ZWith a snarl and a high pitched yowl the dog comes charging straight at the waving cape!> >&}NxI3qYou snap the red satin cape in the air, letting it flare out dashingly before folding it up neatly once again. ]^=w===LM  black felt hat 55You perch the hat on your head at a dashing angle.  You doff the dashing hat. MMA wide brimmed black felt hat with a thin band of leather around its base. MO actorNV3+MO actorNX3 Velvety...x  .   underwear In a bit of a kinky mood, aren't you? You don't normally make a habit of snatching people's underthings, unless they've done something, either good or ill, to really catch your attention. MO actorNy3NMO actorN{3/Soft, as one would expect underthings to be. -MO actorNn}3Out of nowhere a crystal ball suddenly falls and whacks you on the head. You wander off a bit befuddled, forgetting what you were about to do. MO actorN$~3hMO actorNH3IYou don't need to be carrying around someone else's underwear, really. y|,,,J  road The road is an unnatural dark streak that wends it way through the surrounding hills and valleys. Although this part of the road is seldom traveled, its magic keeps it pristine and unblemished from the encroaching territories of the surrounding fey. z   \.:#  Red Rock ArchMN3A towering arch of red rock stands at the mouth of the valley formed by the surrounding hills. Unlike the rest of this region the bridge of stone is rough and irregular, as if its shape had been worn down piece by piece by the wind over many passing years. \bN3>" iN3ZA shimmering distortion fills the archway making it impossible to see the lands beyond. N3"vgN3\bThe hills surrounding the red arch have collapsed upon themselves in a rather violent rockslide, blocking the entranceway to all those mortals who tread on feet. The messy tumble of stones annoys you with its un-artful sloppiness. xN3lBeyond the archway your lands stretch onwards to the north where there is a slight darkening of the skies.oMO actorNV3pXMO actorNz3>vg" Nz3You glare are the chaotic tumble of stones and it trembles, slowly sinking into the rocky ground, as the far off hills quietly lengthen, stretching outwards arms of earth and stone until they are perfectly curved and smooth once again. !vg.Nz3"The hills are fine as they are. GMN3>" ON3@All you can see through the archway is a flickering of light. N3You gaze through the red rock arch and the glimmer of living water can be seen to the north. Suddenly before your eyes a rainbow arcs free of the water and buries itself into the ground at the fountain's base. MO actorN%3MO actorNI3The stone is warm beneath your touch. You can feel the slight edges and traces of faint carvings scrolled through the surface of the arch. ,MO actorN3-*MO actorN3 Dusty... MO actorNO3~MO actorNs3UGracefully you scale up the archway until you are balancing across its flat top. \b{>BCMO actorN3MO actorN+3>" N+3You pass through the curtain of light. Every sense in your skin flares and tingles for an endless moment and then you are through and in the shadows beyond. \b|>C|N+3You tilt your head up as you pass under the arch and the large span of rock many lengths above your head glitters with a sprinkling of crystals in the sun. \bMO actorN 3MO actorN 3A trap for those smart enough to activate it, but not smart enough to avoid it. But the truth is also threaded within the lie it offers. {X    *. z(MN4 archway \b !<,  the archwayMN4JYou stand on top of the red stone arch with your back to the red hills. !~N4>! xN4iA rainbow ends right at your feet, shimmery but seemingly solid, a bridge that leads off to the north. =N41A flickering and shimmering fills the archway. N4MEmbedded within the stone is a pale seashell, gleaming faintly in the sun. MN4  balancing atop the offeMN4"~EBalancing carefully, you walk back down the red stone arch with your eyes fixed upon the dirt road. It lies tantalizingly before your eyes, seemingly so ordinary and drab with its unpaved and uneven surface. A flutter of excitement, a flicker of madness fitfully sparks in your heart as you brashly step unto man's road. \buWGMN4"~-You need to slide down the red arch first. NoMN4"~OYou drop off the rec stone arch and head towards the greenery to the north.\bUIMN4"~/You need to slide down the red archway first.TIMN4"~/You need to slide down the red archway first.QMN4"~vYou drop off the red archway and circle around the sculpted hills, towards the bulk of a pale forest to the east. \bSMN 4"~You skid down the archway accompanied by billowing clouds of dust and manage to bound upward at the last moment, before landing in an untidy jumble on the hard baked ground. \bRMN!4"~N"4{You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.MO actorN #4MO actorN8 $4"~You skid down the archway accompanied by billowing clouds of dust and manage to bound upward at the last moment, before landing in an untidy jumble on the hard baked ground.|DA+ A sterile scent of nothing. '  Trap Room \(Trap Room\), The Trap Room~MN9> | N9\bThe nine sided room is covered from floor to ceiling in glass and silver, the surface forming one continuous mirror. There is no noticeable way out. This ought to be interesting. N9A nine sided room covered from floor to ceiling in glass and silver, the surface forming one continuous mirror. There is no noticeable way out. MN9> | KN9<You don't truly want to leave yet, it's just getting fun! N9Your trap room is rather boring without anything being trapped inside of it. You phase through the mirrored walls and find yourself back within the red hills. \b(MO actorN09> | E > | 1N09CC)N09)/N09> | N09CN09)) MN9(<(KN9"You follow Val into darkness. Suddenly there is a flare of light and, blinking, you behold Val standing in the center of the room, a blue-gold glowing sphere hovering above his opened palm.>" }So you have decided to join me, have you? Alas, there is nothing interesting to behold but your own gorgeous reflection. \b|N9~N9\bVal paces in a circle around the nine sides of the room, carefully poring over every bit of mirrored wall, ceiling, and floor. All is perfect glass, casting perfect reflections back of both of you. N9\bVal continues his pacing.}N9\bVal paces yet still.XN9\bVal trails his hands along every fingerswidth of mirrored wall. You know that there is nothing to be felt there but smooth, flawless glass. Its rather amusing to watch ten Vals wander aimlessly around the room. tN90Val continues his exploration of the mirrors. 7N94Val continues to run his hands along the mirrors. N9For a moment your sight seems to twist and you find yourself confusing a reflection with the true Val. The mage has stopped before the mirrored wall that faces south.AN9#Val draws back his fist and though his hand never touches the mirror it shatters into a rainfall of broken glass and silver. Behind the wall is a deep unbroken darkness. Softly a faint glow suffuses the darkness, a pattern of intricate designs and scrollwork lacing through stone walls.\b N9>" ON9C"It's time to go, Snugglebums," Val calls as he steps forward.\b N9,You follow the mage as he disappears into the darkness. As you cross the threshold separating the trap room from the shadows beyond, the air around you trembles and splinters into a thousand jagged bits. \b Then you and Val are standing, blinking, outside in the bright light of the hills. The mirror in the cleft lies broken amongst your feet revealing the opening of a cave beyond. \b "That was certainly interesting," says Val. "Yet I think I've had my fill of the hills." And so saying, the mage walks through the empty red arch to the lands beyond. ">&!!|>C)E \  MN9ՠ<KN9N9N9N9N9yN9jN9[N9LN9=N9.N9N9N9N9N9N9N9N9N9N9N9N9zN9kN9\N9MN9>N9>  xrBehind you comes the clattering of shattering glass and an explosion of... darkness and silence. Val emerges from the mouth of the uncovered cave, the broken mirror lying in pieces around his feet. \b "That was certainly interesting," says Val. "Yet I think I've had my fill of the hills." And so saying, the mage walks through the empty red arch to the lands beyond. N9In the distance you sense an explosion of foreign power carrying with it the faint echo of breaking glass. It seems that the mage has found his way free of your trap room.">&!>"|C) !)19 A I Q Y aiqyMO quipnoN9KN9 Your reflection is here too...N9(It seems I had a lapse in judgement...hN9=I'm glad you're here...at least there's something to eat...Sy/MO quipnoN9KN9N9z\b"But your reflection is here too," you say. \b "Aye, but I'm much rather spend the time admiring yours." Val answers. >##9N9N9^b"It seems I had a lapse in judgement in following you," you say. \b "A pity..." replies Val>##N9N9 \b"I'm very glad to find you here as well," you say. \b "Truly?" Val quirks a pale eyebrow at you. \b "Aye," you reply. "At least now I have something to eat."\b "Then I had better work on finding a way free before you start getting peckish," says Val with a laugh.>##}."#z  carvings Flowing designs have been cut into the stone surface of the arch. The edges are crisp and unworn, yet so faint that the overall pattern would be nearly indecipherable to anyone who did not know what they are looking for. \b MO actorN4\MO actorNB4=The symbol of yours... nine concentric nine sided polygons.~8J  far fountainTMNo4>" \Np4MThe shimmering within the archway blocks your view of the fountain beyond. Nr4You gaze through the red rock arch and the glimmer of living water can be seen to the north. Suddenly before your eyes a rainbow arcs free of the water and buries itself into the ground at the fountain's base. /MO actorNs4.?MO actorNt4 The fountain is too far away.  .\ { bridge of rainbows ttA bridge of shifting rainbows connects the stone archway with the sky. Where it leads beyond that cannot be seen. u ccYou walk towards a rainbow, open your mouth, and allow an etherial sweetness to fill your being. y ccYou walk towards a rainbow, open your mouth, and allow an etherial sweetness to fill your being. You gaze through the rainbow and behold a castle in the sky, a mountain climbing to the heavens, a lake filled with stars, a maze of green, a river of blue, and a flickering of a thousand different images through your mind.MO actorNpN4MO actorNP4[You reach out towards a rainbow and it reaches back towards you. Colors play across your !> feathertips fingertips/, streaming past you, streaming through you. ,MO actorNqQ4-HMO actorNR4)The tang of pure water and true light. MO actorNS4jMO actorNT4KAs much as you love rainbows, that really would draw too much attention. `lJKMO actorNV4MO actorNW4You traipse over the rainbow, climbing high in the sky until the clouds surround you and the world falls in miniature below you. You follow the rainbow to the earth once again... through the earth...\b>n n nJ#  ""empty lands beyond your boundary, &&the empty lands beyond your boundary Uninhabited fields and trees stretch out before you. Undoubtedly there are animals and humans who live somewhere on this land, but no fey has possessed it for many years. You've been steadily pressing your influence upon it, in a contest between you and the other surrounding fey. /MO actorNb4.MO actorNc4}Your senses do not extend to the empty lands. Undoubtedly normal sounds fill the normal lands from its normal inhabitants. MO actorN^d4MO actorNe4Unless a greater power intervenes, it is only inevitable that the empty lands will be parted piecemeal between all the fey who border it. You haven't quite decided what to do with your new area yet...DJ  dim shape of a forest LLNot much but the hazy outline of a forest can be seen from this distance. /MO actorN~4.MMO actorN4.The forest is too far away is too far away. kkkJ  song on the wind Breezes blow through cracks and niches, hidden clefts and chinks, through the curves and spirals of the Unicorn's Horn and a melody is risen, keening high and then low. Something beautiful but very lonely. The sound dies away with the wind. /MO actorN24.MO actorNV4Breezes blow through cracks and niches, hidden clefts and chinks, through the curves and spirals of the Unicorn's Horn and a melody is risen, keening high and then low. Something beautiful but very lonely. The sound dies away with the wind. oooJ  breeze QQThe wind gusts and swirls about the hills raising clouds of red dust as it passes on its way. Breezes blow through cracks and niches, hidden clefts and chinks, through the curves and spirals of the Unicorn's Horn and a melody is risen, keening high and then low. Something beautiful but very lonely. The sound dies away with the wind. /MO actorN4.pMO actorN4QThe wind gusts and swirls about the hills raising clouds of red dust as it passes on its way. Breezes blow through cracks and niches, hidden clefts and chinks, through the curves and spirals of the Unicorn's Horn and a melody is risen, keening high and then low. Something beautiful but very lonely. The sound dies away with the wind. MO actorN 4(MO actorND4>@J  sky, thesky The sun beats down through a clear blue sky. In the distance wisps of cloud can be seen around the edges of the horizon. However, to the north there seems to be a gathering and a darkening. J  clouds,  the clouds OOThe far clouds are wispy bits of dragon's breath with no real form or shape. d###J ,  the sun sunMN4IThe sun shines down resolutely, warming the surrounding stone and rock.N4> > E >q" `N4T"Tis dangerous to stare at the sun like that," Val says he gazes at you sideways. "qtttM  chunk of red rockMN4:An uneven chunk of rock pried up from the red hills. It !> would fit fits snugly within your hand. MO actorMO actorN4<Rough and nubbly, it leaves a coating of red dust on your !> feathers  fingers.   ./  hidden alcove You search amongst the hills and come across a perfectly circular alcove inset between the crossing of two steeply sloped hills. Nestled is a trio of little holes lanced straight through the stone. When the wind blows just right a strange lilting melody can be heard. MO actorNL5YMO actorNp5:The shadowed stone of the alcove is cool to your touch. ,MO actorN5-FMO actorN5'The alcove smells of stone and dust. /MO actorN?5.;MO actorNc5A strange lilting melody.  K K K *. v*MN5red hills \b !<, the red sculpted hills \b As you gaze from atop the hills the surrounding countryside stretches out around you. Directly before you the dirt path winds away into the distance, disappearing into the haze of far off hills. The Unicorn's Horn towers above, its shadow falling across you. The glimmering view of the distant fountain is blocked by the red stone arch, but from the top of the arch itself something can be seen faintly gleaming. MN5<   atop the offTMN5<You slide down the hills to the red baked earth below, your eyes fixed upon the dirt road. It lies tantalizingly before your eyes, seemingly so ordinary and drab with its unpaved and uneven surface. A flutter of excitement, a flicker of madness fitfully sparks in your heart as you brashly step unto man's road. \buW ..You need to climb down the red hills first. NMN5You slide down the hills to the red baked earth below and continue through the red archway. The rainbow bedecked fountain is perfectly framed as you pass under the stone.\bU --You need to climb down the red hills first.T --You need to climb down the red hills first.QMN5You slide down the hills to the red baked earth below and walk through the red stone arch, circling around the sculpted hills towards the bulk of a pale forest to the east. \bSWMN5;You slide down the hills to the red baked earth below. \b>R {{You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.MO actorN5dMO actorN5;You slide down the hills to the red baked earth below. \b>.   gleaming ggThe sunlight hits the red stone arch just so from this angle to cause a faint glinting of reflection.L   .  giant's hand=MN25>" oN35`You won't be able to behold these "giant's hands" until you change back into your human form. N55The hills seem as if they were sculpted by a giant's hand. You look down upon your human hands in wry amusement. Not exactly gigantic, but they do get their work done. MO actorNx65MO actorN85>" oN95`You won't be able to behold these "giant's hands" until you change back into your human form. -N;5!You press your hands together. ,MO actorNc<5-MO actorN=5>" oN>5`You won't be able to behold these "giant's hands" until you change back into your human form. WN@5KYou take a whiff of your hands. Whew.. what have you been holding lately?MO actorNxA5jMO actorNB5KI should certainly hope that your hands are still connected to your body!,  .  swirls of red dust, the swirls of red dust NNEvery now and then the wind will kick up swirls of red dust that dance sinuously on the breeze, indistinct shapes and figures taking form for a fleeting moment before flowing away. One puff looks looks a bit like a bee with a long extended stinger, and another swirl is dancing lion that shifts into a bird with wings widely spread.MO actorNM5KMO actorNO5,Fleeting sensation of dust on the breeze. ,MO actorN"P5-MO actorNFQ5oYou inhale deeply and nearly hack up a lung as dust clogs your throat. Not exactly your wisest moment there. mMO actorNR5>" FCYou shouldn't overburden yourself with items while in this form. MO actorNMS5{There's not much that can be done with this dust. If you are really hankering for a dust storm, you can just create one.  N N N *. 3MN[5the highest plateau \b!<MN]5From this height you gaze across all the surrounding countryside. The red hills lie below you resembling a giant sandbox or perhaps lumps of clay that have been half molded and left to harden in the sun. Behind you is your fountain, marked more by the haze of rainbows that surrounds it than by its waters itself, and further along lies the pale shadows of the forest... and past even that the greenery of the rest of your lands.\b Far below, the road is a dark ribbon winding into the distance, leading to nearby villages, and past that to cities, to kingdoms and mountains and oceans and other lands that you have never seen, except perhaps, in your mind's eye when listening to the stories told by the travellers passing by. \bN^5  N_5There is a tarnished silver ring lying atop the uppermost spike of the Unicorn's Horn. So this is where you left it! You had been idly searching your treasure room for it for quite awhile now.MNa5<  atop offNMNc56You wind your way back down the Unicorn's Horn, your eyes fixed upon the dirt road. It lies tantalizingly before your eyes, seemingly so ordinary and drab with its unpaved and uneven surface. A flutter of excitement, a flicker of madness fitfully sparks in your heart as you brashly step unto man's road. \buW 55You need to clamber down the Unicorn's Horn first. NMNe5You wind your way back down the Unicorn's Horn and through the red archway. The rainbow bedecked fountain is perfectly framed as you pass under the stone.\bU 44You need to clamber down the Unicorn's Horn first.T 44You need to clamber down the Unicorn's Horn first.QMNh5You wind your way back down the Unicorn's Horn and through through the red stone arch, circling around the sculpted hills towards the bulk of a pale forest to the east. \bSPMNi54You wind your way back down the Unicorn's Horn. \b>R {{You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor.\b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body.MO actorN l5]MO actorN m54You wind your way back down the Unicorn's Horn. \b>  .  Unicorn's Horn Towering over the surrounding land is the slender peak of the Unicorn's Horn, its stone spiralling upward into a perfect tip that can easily be spotted from the nearby road. A soft silvery-gray lichen covers its surface, giving the monument a red-speckled look.MO actorNDz5MO actorNh|5aYou press up against the spiralling rock. The stone is hard underneath the soft, furry lichen. /MO actorN}5.lMO actorN~5MThe wind plays music across the Unicorn's Horn, a fluting melancholy tune. MO actorN5MO actorN5Carefully you scale the spike that is the Unicorn's Horn. The grooves that spiral around the stone seem almost to form a steep ramp leading ever upwards. Around and around until... \b>wwwLM  You slip the ring unto your finger. For a moment the world blurs and you see a flaming-- nay, nay, simply a bit of sunlight caught in your eye.  ))The ring slips easily off your finger.   silver ringMN5<" IN5:A silver ring, highly polished and gleaming in the sun. QN5EA silver ring, slightly tarnished from its exposure to the climes. N5<Its three plaited bands of silver form an unbroken circle.MO actorN5@MO actorN%5!The ring is cool to the touch. -yMO actorNk5ZYou put your nose close to the ring and inhale deeply. It smells faintly of... vanilla? MO actorN5RMO actorN5-You polish the silver ring until it gleams."mMO actorNl5>" FCYou shouldn't overburden yourself with items while in this form. MO actorN5<" dN5LYou singe your fingers as you reach into the fire and pluck the ring out. !)N5)L   .  !!covering of silvery-gray lichen A thin covering of silvery-gray lichen clings to the surface of the spiralled promontory. Upon closer inpection you can see the tiny webs and spirals formed by overlapping layers of vegetation, giving the surface of the stone the mottled appearance of mother-of-pearl.\b This silvery lichen will glow eerily in the dark, often frightening any careless wanderers at that time of night. You're quite proud of the effect.MO actorN5MO actorN5,The lichen is soft and furry beneath your !> touch fingertipsfingertips. -MO actorN5rYou put your nose close to the lichen and inhale deeply. It smells of stone and dust and faintly of... vanilla? MO actorN55MO actorOYxNi5You scrape up a !> mouthful  handful of lichen.Ni5ZNi5>[[Ni5&6<M kMN5<  3N5$faintly glowing scraping of lichen N5scraping of lichen scrapings of lichen ddA scraping of silver-gray lichen with bits of red rock and dust still entangled within its roots. MO actorN5wMO actorN=5,The lichen is soft and furry beneath your !> touch fingertips. -MO actorN5pYou put your nose close to the lichen and inhale deeply. It smells of stone and dust and faint of... vanilla? y IIThe lichen is sweet on your tongue with a faint aftertaste of vanilla. +MO actorN5MO actorN5> b D > c D > d }N5BYou decide it wouldn't be wise to dispose of that now.. without !< ! you might become lost in here!N5) ( ( ( .|   first holeMN5wThe first in the trio of perfectly circular holes set into the stone of the alcove. This one is furthest to the left N5<|! ,N5and has been pinched shut. N5.MO actorN5uMO actorN55)The hole is slightly smaller than your !> claw finger1 and is fully plugged shut when you press your !> talon fingertip~ against it. A high piping melody that had been rising and falling within the hills abruptly cuts off until you remove your !> talon fingertip once again. yMO actorN5zMO actorN5With a quick thought the first hole pinches tightly shut. A high piping melody that had been rising and falling within the hills abruptly cuts off. !|MO actorN5MO actorN5tYou carefully remove all obstructions from the first hole, allowing the wind to blow freely through it once again."|,MO actorNX5-FMO actorN|6'The alcove smells of stone and dust. /MO actorN6.;MO actorN6A strange lilting melody. cMO actorN-6MO actorNQ6>|! Q6LYou will have to uncover the hole once again if you wish to blow upon it. TNQ6|! E |! NQ6You lean close and blow a great gout of air directly into the first hole, all the while plugging the third. A melody rises high into the air, the sound of lilting sound of flutes and pipes.gNQ 6>|! E >|! NQ 6You lean close and blow a great gout of air directly into the first hole, all the while plugging the second. A melody rises high into the air, the sound of lilting sound of flutes and pipes.{NQ 6>|! D >|! NQ 6You lean close and blow a great gout of air directly into the first hole, all the while plugging the other holes, and are suddenly startled by the blast of flutes and pipes that oversaturate the air.NQ6zYou lean close and blow a great gout of air directly into the first hole. A high fluting sound echoes across the hills.    .|   third holeMN_6wThe third in the trio of perfectly circular holes set into the stone of the alcove. This one is furthest to the left N`6<|! ,Na6and has been pinched shut. Nc6.MO actorNd6MO actorN5f6)The hole is slightly smaller than your !> claw finger0and is fully plugged shut when you press your !> talon fingertip against it. And so it dies away, a soft humming sound that you have taken no notice of until it suddenly stops. It starts up once again the moment you remove your !> talon fingertip. yMO actorNg6zMO actorNh6With a quick thought the third hole pinches tightly shut. And so it dies away, a soft humming sound that you have taken no notice of until it suddenly stops. !|MO actorNi6MO actorNj6tYou carefully remove all obstructions from the third hole, allowing the wind to blow freely through it once again."|,MO actorN~k6-FMO actorNl6'The alcove smells of stone and dust. /MO actorNm6.7MO actorNn6A soft humming sound. cMO actorNOo6 MO actorNsq6>|! sr6LYou will have to uncover the hole once again if you wish to blow upon it. Nss6>|! E >|! Nst6You lean close and blow a great gout of air directly into the third hole, all the while plugging the first. A vibrant humming noise fills the alcove, loud enough to be rather unpleasant to your keen ears. Nsu6>|! E >|! Nsv6You lean close and blow a great gout of air directly into the third hole, all the while plugging the second. A vibrant humming noise fills the alcove, loud enough to be rather unpleasant to your keen ears. Nsw6>|! E >|! Nsx6You lean close and blow a great gout of air directly into the third hole, all the while plugging the other two holes. A grand humming noise fills the air, dislodging rivulets of red dust and sending you vibrating out of the alcove. Nsz6You lean close and blow a great gout of air directly into the third hole. A humming sound seems to vibrate through your entire body. ,.|   second holeMN6The second in the trio of perfectly circular holes set into the stone of the alcove. This is the central one, placed a little higher than the rest N6<|! ,N6and has been pinched shut. N6.MO actorN06[MO actorNT!6)The hole is slightly smaller than your !> claw finger1 and is fully plugged shut when you press your !> talon fingertipd against it. A roaring sound coming from the lion's mouth suddenly cuts off until you remove your !> talon fingertip once again. yMO actorN"6zMO actorN#6}With a quick thought the second hole pinches tightly shut. A roaring sound coming from the lion's mouth suddenly cuts off. !|MO actorN$6MO actorN%6uYou carefully remove all obstructions from the second hole, allowing the wind to blow freely through it once again."|,MO actorNE&6-FMO actorNi'6'The alcove smells of stone and dust. /MO actorN(6.;MO actorN)6A strange lilting melody. cMO actorN*6MO actorN>,6>|! >-6LYou will have to uncover the hole once again if you wish to blow upon it. )N>.6>|! E >|! N>06You lean close and blow a great gout of air directly into the second hole, all the while plugging the first. A faint roaring sound can be heard coming from the lion's mouth.NN>26>  E >" E >|! E >|! sN>56YYou lean close and blow a great gout of air directly into the second hole, all the while blocking the flow to the first and third holes. Suddenly a great roaring shakes the sculpted hills, sending rivulets of dust and red rock cascading to the ground as all other sound is drowned out by the sheer clangor.\b You stagger back from the alcove, !>$head hidden under your wing.!hands clutched to your ears. Much to your chagrin, it seems that you forgot about that particular bit of whimsy. \b Val is leaning up against the curved slope of one of the nearby hills, his head tightly clutched in his hands. You come waddling over to stand before him and the two of you end up blinking repeatedly at each other in confusion.\b Val says something, to you perhaps, but you can not make it out over the great ringing in your head. The young seeming mage tilts his own head, clapping at his ears as if trying to dislodge an irritant, and finally he straightens up and, weaving slightly unsteadily, walks under the red arch to the north and away from the hills. N>86>>9&"9>& N>;6>  E >" E >|! E >|! N>>6YYou lean close and blow a great gout of air directly into the second hole, all the while blocking the flow to the first and third holes. Suddenly a great roaring shakes the sculpted hills, sending rivulets of dust and red rock cascading to the ground as all other sound is drowned out by the sheer clangor.\b You stagger back from the alcove, !>$head hidden under your wing.!hands clutched to your ears. Much to your chagrin, it seems that you forgot about that particular bit of whimsy. \b Val is leaning up against the curved slope of one of the nearby hills, his head tightly clutched in his hands. You woozily wander over to stand next to him, all the while wondering what in the nine hells possessed you to design the alcove holes to do that. The young seeming mage lifts his head at your approach and says something to you. \b Something that you have no chance of actually hearing, through the great clanging still ringing through your head. "What?" you say. \b Val frowns and stares at your face. A bit perturbing until you realize he's trying to read your lips. He tilts his head, clapping at his own ears as if trying to dislodge an irritant, and says something else. To you, presumably. You concentrate all of your vast powers on the mage, but alas, it is still not helping with your non-existent lip reading skills.\b "What?" you repeat again, beginning to feel more than a bit foolish. \b Val gazes back at you and finally gives an elegant shrug of his shoulders. He straightens up, beckons towards you, and then proceeds to walk, rather drunkenly if truth be told, under the red arch and away from the hills. N>H6>>9&"9>&N>J6>|! E >|! E >  N>K6You lean close and blow a great gout of air directly into the second hole, all the while plugging the third. A faint roaring sound can be heard coming from the lion's mouth.N>M6>|! E >|! N>P6YYou lean close and blow a great gout of air directly into the second hole, all the while blocking the flow to the first and third holes. Suddenly a great roaring shakes the sculpted hills, sending rivulets of dust and red rock cascading to the ground as all other sound is drowned out by the sheer clangor.\b You stagger back from the alcove, !>$head hidden under your wing.!hands clutched to your ears.W Much to your chagrin, it seems that you forgot about that particular bit of whimsy. N>S6You lean close and blow a great gout of air directly into the second hole. A strange mewling sound seems to emanate from the direction of the lion rock.  a a a .   three holesMN6>|! N6Three perfectly circular holes set into the stone of the alcove. The central one is raised slightly higher than the rest and the first one has been pinched shut. ON6>|! N6Three perfectly circular holes set into the stone of the alcove. The central one is raised slightly higher than the rest and has been pinched shut. N6>|! N6Three perfectly circular holes set into the stone of the alcove. The central one is raised slightly higher than the rest and the third one has been pinched shut. N6>|! E >|! N6Three perfectly circular holes set into the stone of the alcove. The central one is raised slightly higher than the rest and it and the first one have been pinched shut. N6>|! E >|! N6Three perfectly circular holes set into the stone of the alcove. The central one is raised slightly higher than the rest and the others have been pinched shut. -N6>|! E >|! N6Three perfectly circular holes set into the stone of the alcove. The central one is raised slightly higher than the rest and it and the third one have been pinched shut. UN6>|! E >|! E >|! N6Three perfectly circular holes set into the stone of the alcove, all of them pinched shut. The central one is raised slightly higher than the rest. N6|Three perfectly circular holes set into the stone of the alcove. The central one is raised slightly higher than the rest. MO actorNT6!MO actorNx6+The holes are slightly smaller than your !> claws  fingers1and are fully plugged shut when you press your !>talons fingertipsY against them. There is quiet for a moment as the sound of the wind briefly dies away. ,MO actorN6-FMO actorN6'The alcove smells of stone and dust. /MO actorN6.;MO actorN36A strange lilting melody. cMO actorNt6 MO actorN6>|! D >|! D >|! ^N6OYou'll have to uncover all three holes before you can blow into all of them!.rN6fYou lean close and blow a great gout of air directly into all three holes. A great cacophony of sound resonates throughout the sculpted hills. Shrill piping sounds and a jangling sound of flutes, a great roaring of noise, a low humming that seems to reverberate through your bones, and even, oddly enough, the far off bleating of what sounds like a sheep. yMO actorN 6zMO actorN 6With a quick thought the three holes pinch tightly shut. There is quiet for a moment as the sound of the wind briefly dies away. !|!|!|MO actorN 6MO actorN 6vYou carefully remove all obstructions from the three holes, allowing the wind to blow freely through it once again. "|"|"|  .  mirrored cliffMN6tDirectly before you rises a small rounded cliff, its smooth sides forming a shallow scooped cleft that faces you. N6" RN6CA few shards of broken glass litter the opening to a small cave. N6Wedged within the opening is a circle of silver, its surface so polished that it throws back a perfect reflection of anything that comes near it. MO actorN6zMO actorN65The stone face of the cliff is smooth beneath your !> touch hand. ,MO actorNj6-EMO actorN6&The cliff smells of stone and dust. /MO actorN6.MO actorN6>" UN6FA faint keening noise can be heard from within the small dark cave. xN6lAs you stand before the clefted hill a strange muffled keening sound can be heard from behind the mirror. MO actorN6MO actorN6ZYou climb atop the clefted cliff and from there unto the taller hills surrounding it. \bv>   .  perfect circular mirrorMN6<" ^N6OOnly a sprinkling of silver and crystal shards remains of the etched mirror. N6The mirror before you is a flawless circle of highly polished silver. Interlocking, elaborate patterns have been thinly etched around its edges. MO actorN_6MO actorN6>" E >" N6You reach out towards the mirror and as your fingers should touch the glass a faintly cool sensation runs through your body. You hand passes straight through the mirror. N6>" E >" WN6HYou reach out towards the mirror and nearly fall straight through it. N6<" (N6Broken shards and bits.nN6Your !> feathers  fingers3 glide silently across the mirror's chilly face. MO actorN6MO actorN6<" 0N6!There is nothing left to take. N6The mirror is wedged tightly within the cleft, its edges flush against the stone. You can get no purchase on the mirror's slippery surface. LMO actorN6NMO actorN6<" ,N6It's already quite broken. 9N6-Seven years bad luck, ah well. As one, you smash your fist and your Will into the circular mirror and it shatters into a thousand fragments. Bits of silver rain down through the opening before dissolving away like melted snow. Only a few jagged shards remain in the mouth of the newly revealed cave.&"""MO actorNw6EMO actorN6>" N6The mirror reflects the archway. A reflection of the portal. A reflection of the pattern...a reflection...a reflection... you step into the reflection. \bjN6^You walk face first into the mirror and soundly whack your head. Not your brightest moment. oMO actorN6pMO actorN 6<" *N 6There is nothing to fix. PN 6DWith a shimmer of light the mirror coalesces together once again. !!!>&!!MO actorN64MO actorN6<" =N6.The mirror is broken in to a thousand bits. lN6<" ZN6BYou look into the mirror and your reflection gazes back at you. !>N6>" N6\b Behind your own reflection looms the red arch, filled with its shimmering light. So perfect is the surface of the mirror that it seems the light filled portal stands before you as well as behind you. . $$scattering of broken mirror shards All that remains of the circular mirror is a sprinkling of glass shards that crunch underneath your feet as you step within the mouth of the cave.MO actorN7MO actorN7vThe jagged shard draws blood, a single drop of dark wine that wells up and disappears before it touches the ground. mMO actorN7>" FCYou shouldn't overburden yourself with items while in this form. MO actorOxN74You carefully pull free a slender shard of mirror.N7ZN 7&p///A.   hidden cave 99The destruction of the looking glass has revealed a small cave opening, half as tall as your human form and deeply shadowed. The stone walls that lead deeper within are smooth and circular, engraved with the same patterns that once decorated the mirror that now lies within a pile of jagged shards at your feet./MO actorN7. FFA faint keening noise can be heard from within the small dark cave. within out ofMO actorN 7MO actorN17>" N17It would not be wise to enter the caves in that form. You remember quite vividly being dashed against all and sundry the last time you tried.  N17You stoop down and step into the hidden cave. The stone presses closer until you find yourself crawling along as the light of the outer world is left behind. After squeezing through the narrowest part of the tunnels, the walls widen outward once again. \bbMO actorN74WMO actorN778You peer into the cave and darkness peers back at you.+MO actorN73tMO actorN7UYou search the opening of the cave but find nothing but darkness and broken shards.T5Mmirror shards shard of broken mirror IIA slender shard of mirror, ragged and jagged with a wicked looking tip.MO actorN7MO actorN7vThe jagged shard draws blood, a single drop of dark wine that wells up and disappears before it touches the ground. MO actorN\76XMO actorN79Maybe when you're feeling really masochistic...   .  lion shaped hill ..A range of hills forms the tail and follows the spine of the lion, rising upward into a series of jagged peaks that give the impression of a snarling head. Shallow ridges form the flowing mane and the tuft of hair at the tip of a tail, and low-lying hills make dainty paws for the lion to rest upon. MO actorNm!7IMO actorN#7*The red rock is warm beneath your feet. ,MO actorN$7-*MO actorN%7 Dusty... /MO actorN4&7.MO actorNX'7You listen attentively to the lion's stone hill. For many moments there is silence and then a sudden roar as the wind catches in the right place. MO actorN(7nMO actorN5)7BYou pull yourself atop the lion hill and peer into its mouth.\b !   :.  mouth of the lion The mouth of the lion is a small cave ringed by stalactites and stalagmites of red rock. Moisture drips from these stone teeth as if the creature itself is slavering for its next meal. Darkness awaits further down the lion's gullet. MO actorN-27WMO actorNQ478The teeth are very sharp and could easily draw blood. -_MO actorN67@Hot and dusty and yet, beneath that, an elusive sweet scent. /MO actorN77.MO actorN787You listen attentively to the lion's stone hill. For many moments there is silence and then a sudden roar as the wind catches in the right place. mMO actorN97>" FCYou shouldn't overburden yourself with items while in this form. xMO actorOcxNs;7+You gingerly yank free a red rock tooth. Ns<7ZNs=7&  5M  //a tooth of red rock plucked from a lion's maw lion's stone teeth ]]A sharp fragment of red rock, long as your forearm, that was plucked from the lion's hill. MO actorNK7XMO actorNM79The tooth is very sharp and could easily draw blood. . -gMO actorNUO7HIt smells like a rock, which is to say, not much of anything at all. +s s s.  beads of moisture, beads of moisture QQBeads of moisture run down the red stalactites and pool within the lion's maw. u WWYou catch a droplet of moisture and swallow it. It tastes of dust and metallic rock. ,MO actorN ]7-EMO actorN-_7&The water smells of water and dust. MO actorNx`7BMO actorNa7#The water is warm to your touch. MO actorNb7hMO actorNc7IIf you need water you can create much more than these piddly droplets. ^ ^ ^:.  !!darkness down the lion's gullet SSYou examine the darkness pooled at the back of the cave. In the shadows you can make out nine tiny chinks along the roof of the lion's mouth and beyond that... something... \b The lion suddenly roars and hot breath puffs in your face. The wind steams through the nine cracks along the lion's throat and pushes you back out of its mouth. SSYou examine the darkness pooled at the back of the cave. In the shadows you can make out nine tiny chinks along the roof of the lion's mouth and beyond that... something... \b The lion suddenly roars and hot breath puffs in your face. The wind steams through the nine cracks along the lion's throat and pushes you back out of its mouth. ,MO actorNq7-^MO actorN r7?Hot and dusty and yet, beneath that, an elusive sweet scent. /MO actorNs7.MO actorNt7You listen attentively to the lion's stone hill. For many moments there is silence and then a sudden roar as the wind catches in the right place. DDD". something in the darkness, something in the darkness kkYou search the mouth of the lion. There in there darkness, further down the lion's gullet... something... kkYou search the mouth of the lion. There in there darkness, further down the lion's gullet... something...DDD.  something in the darkness, something in the darkness kkYou search the mouth of the lion. There in there darkness, further down the lion's gullet... something... kkYou search the mouth of the lion. There in there darkness, further down the lion's gullet... something..."<M#D ethereal kisei blossom, an ethereal kisei blossom ??You find a single kisei blossom growing amongst the shadows. @@A single kisei blossom with stem and sharp little leaves of pure black. Its many close-clustered petals are so translucent that they hardly appear to be there at all. While rather beautiful, in its own way, this flower is regarded as ill luck. Highly poisonous to all mortal creatures, the kisei is a symbol for death.MO actorN7=MO actorN!7Ephemerial brush of petals. -7MO actorNd7A sweet sickly smell. y //You take a taste of death. It is bittersweet.MO actorN7MO actorN7mHow odd... you don't remember putting this kisei flower here. You don't recall ever making a kisei at all. .  cave walls The stone walls of the cavern have faded from a dark red to dull grey. Light reflects off the carvings that scroll through the walls, making the script seem to glow with an earthly light. MO actorN7MO actorN7The walls are smooth and cool to the touch. Your fingers trace the pattern of engravings that spider through the ceiling, floor, and walls. They are filled with a glossy, slick substance, much like glass but more lustrous. .  cave walls aaThe engravings are overlaid with a glossy, slick substance, much like glass but more lustrous. MO actorN71MO actorN7Cool and slick. DB B B./  stone floor jjThe stone beneath your feet is covered with the same engraved patterns that fill the walls and ceiling. MO actorN7MO actorN7The ground is smooth and cool to the touch. Your fingers trace the pattern of engravings that spider through the ceiling, floor, and walls. They are filled with a glossy, slick substance, much like glass but more lustrous. 1MO actorN70MO actorN7jThe stone here is too hard to dig in. Besides that would ruin the pattern you worked so hard to create. >MO actorN{7?MOactordobjN7jThe stone here is too hard to dig in. Besides that would ruin the pattern you worked so hard to create. @>A?. wind ,,The wind blows invisibly, if not silently.MO actorNW7MO actorN{7You face into the wind and allow it to blow through your body. It is chilled and full of moisture, like a cloud about to rain or a child about to cry. MO actorN97(MO actorN]7>` b` b` bD. b north You glance down the northern passageway. The air seems still and quiet there although the light from the engravings intensifies, as if trying to make up for the absence of the wind.. b south ZZThe passage to the south noticeable narrows at the edges of the halo cast by your light.ccc. b west 33The wind weeps and whispers from this direction. ^^^ dXMNK9 keening wind held within your !>talons hand. |MNM9> > SNN9DThe wind flails about the room, moaning about open skies and seas.UNP9IThe wind writhes about in your grasp, chilling you through and through.MO actorNPQ9aMO actorNtS9BThe touch of the wind is ice, numbing your skin within moments. MO actorNT96BMO actorNU9#The wind tastes bitter and cold. /MO actorNGV9.9MO actorNkW9The wind gibbers madly. ,MO actorNX9-IMO actorNY9*The wind smells like the salt of tears. MO actorNZ9MO actorNA[9You eye the flailing outline of the wild wind and then, with a quick darting movement, you reach out and grasp it within your !>hands.  talons. It wails and twists about in your grip, but is unable to escape. \b \t "Set me free, \b \t \t set me free, \b \t \t and to you \b \t I will tell a secret ..." \b the wind whispers.NA`9>&MO actorNa9MO actorNb9GYou let the wind go and it rushes madly about the room, sending your !< hairhair and clothesJ fluttering in its wake. \b \t "This stranger is \b \t \t no true stranger to you. \b \t \t \t You know of him, \b \t \t \t you know him, \b \t \t you have met him \b \t and perhaps lost him, " \b the wind says in your ear, \n and then it is hurtling away, whizzing through the tunnel, out the flue, and away beyond the caves.Nd9!>&!|"32MO actorNf9(MO actorN3g9>L   . c flues @@There are not as many flues here as in the surrounding passages, yet the three times three flues behind the lake more than make up for in quality that which lacks in quantity. Faces have been carved in the stone surrounding the flues... a bird, a dragon, a horse, an insect, a stag, a dog, a rodent, a lion, and a man.MO actorNtw8qMO actorNy8RYou can feel the wind streaming out of the dark little holes in the cave stone. p   J c  insect flue The head of some kind of insect has been carved into the stone surrounding that flue. It may be a locust, or a bee, or a beetle, or a firefly, or a spider or maybe even a butterfly... you never were very good at identifying insects by their headsMO actorN28MO actorNV8Okay, technically a spider is an arachnid, not an insect, but you are probably the only one is leagues all about that would know the difference J c sharp toothed rodent eeA sharp toothed rodent, incisors bared, its fur is jagged tendrils of stone curled round its head. J c  lion flue SSA lion with a wavy stylized mane, its muzzle wrinkled back as it bares its teeth.PPPJ c  stag flue qqThe proud head of a stag, its elaborately branched antlers rise all the way up to the very roof of the cavern. MO actorN8MO actorN8aIn fact, the antlers of the stag are the main column supporting the entire cave infrastructure.DDDJ c  bird flue Even from here you can see the detailing carved into the feathers of the bird's head. Each little puff and arch of the plummage. The beak of the creature curves down into the flue such that it splits the stream of wind, making it sound even more shrieking than normal. L   J c  dragon flue(MN8The long, elegant muzzle of a dragon has been carved around the stone of the flue. Intelligent elongated eyes hover over slender whiskers that gracefully curl around the wall and (N8<(KN8N85...wait a moment, did the dragon just wink at you?!N8N8"around the reptile's neckfrill. mN8N8"around the reptile's neckfrill. N8("4xzJ c  man flue iiThe staring blank face of a young man with high cheekbones and tousled hair. A rather pretty specimen. @J c  equine flue The proud face of an equine with nostrils flared and ears tilted back in challenge. It looks like a horse, but a broken bit of stone on the animal's brow suggests it may once have been a unicorn. $J c  canine flue A plume of shaggy fur surrounds the snarling rictus of the beast. With narrowed eyes and wickedly sharp teeth, this canine looks more like a wild wolf than a tamed dog. ` c` c` c . c pinpricks of light, the pinpricks of light RRLittle balls of phosphorescence, glittering within the dark waters of the lake. 4+3vvv. c still dark waters of the lake, ##the still dark waters of the lake  The lake lying before you is perfectly round and perfectly still despite the disturbances in the air all around. Its waters are dark and murky, of unfathomable depth, yet full of tiny pinpricks of light that remind you of stars in a night sky. The waters call to you.u QQThe water is cold and crisp, it fizzes slightly as it slides down your throat. MO actorN8HMO actorN8)The lake water is chilly to the touch. ,MO actorNM8-UMO actorNq86The smell of moisture and stone dust fills the air. MO actorN9ZMO actorN9;Not necessary... you can create better drinks than this. MO actorNP9MO actorNt9You wade into the dark depths of the subterranean lake. The waters that rush to meet you are cool and brisk, sending a tingle of sensation through your body, and then it pours over your head and you are consumed. \b You are falling through darkness. The night sky spins all around you, stars blaze by within easy reach as the earth turns about you. Up is down, down is up and you...\b ... suddenly find yourself within the clear waters of the lake. \bst\\\. c north ++You glance down and see that except for the narrow path circling the lake, the ground is uneven with layers of rock overlapping until they reach the waters edge. The lake itself is dark and murky, of unfathomable depth, yet full of tiny pinpricks of light that remind you of stars in a night sky. L   . c  upwards The path upward is a bit steep and very narrow with nothing to prevent a person from falling off into the lake --or worse yet, the stony shores-- below. It would probably be a dangerous path to walk for a mortal. . c south ||You look to the southern trail that circles round the lake. It seems to wend its way to the foot of the nine carven flues.. east ^^The pattern of engravings seems to increase the further down the tunnel your gaze proceeds. IIIM d gentle zephyr 11A gentle breeze playfully darts about chamber. MO actorNuw9TMO actorNy95The breeze is slightly warm and smells of flowers. ,MO actorNz9-<MO actorN{9A smell of summer flowers. /MO actorNY|9.BMO actorN}}9#The zephyr is quiet as it plays. MO actorN~96EMO actorN9&The faint ephemeral taste of honey. MO actorN49MO actorNX9mYou beckon towards the zephyr and it obediently leaps to your side, batheing you in a warm, gentle breeze. C)MO actorN9(MO actorN9>X    4M gentle zephyr ..A gentle breeze playfully darts around you. MO actorNdETMO actorNE5The breeze is slightly warm and smells of flowers. ,MO actorNE-<MO actorNEA smell of summer flowers. /MO actorNHE.BMO actorNlE#The zephyr is quiet as it plays. MO actorNE6EMO actorNE&The faint ephemeral taste of honey. MO actorN#EMO actorNGElYou beckon towards the zephyr and it obediently leaps to your side, bathing you in a warm, gentle breeze. )MO actorNEWMO actorNE,You release the zephyr to play as it will.C))MO actorN\E(MO actorNE>)MNE> <h iMNE<  NEA gentle breeze darts about the tavern, sending the sparks along the hearth and playfully lifting the tavern denizens clothes and hair. RNE<  gNEXA soft zephyr flits about the heavy smell of apples, carrying the scent far and wide. NE<  gNEXA soft zephyr flits about the heavy smell of apples, carrying the scent far and wide. `NE<  dNEUA gentle zephyr playfully darts about the meadow, trailing long ribbons behind it. NE<  jNE[A peaceful breeze blows across the sands, sending a few grains drifting through the air. nNE<   FNE7A gentle zephyr flits about the edges of the plains. NE<  lNE]A quiet breeze blows about the fountain, sending sprinkles of water drops through the air. NE<  bNESA gentle breeze happily kicks up clouds of dusts until you calm it with a touch. $NE< b ;NE,A zephyr zips playfully through the cave. NE< c FNE7A gentle zephyr dances about the shores of the lake. NE< | >NE/A gentle zephyr breezes about the trap room. /NE#A gentle zephyr flits about you. M2MNE \nA gentle zephyr flits about.$  . |  sterile air, the sterile air/MO actorNK:.)MO actorNo : Silence. OOWhat little air there that can be found here is still and smells of nothing. -?MO actorN : The sterile scent of nothing. MO actorN8 :RMO actorN\:3There is nothing to touch and you touch nothing. MO actorN:MO actorN:> | E >" 0N:!That would give the game away! N:> | E >" rN:cYou flutter about the trap room in amusement watching nine Vals explore the nine mirrored walls. N:>. |  mirrors,  the mirrors/MO actorNC :.)MO actorNg!: Silence. ;;Nine mirrors walls throwing back nine reflections of you.MO actorN#:4TMO actorN$:)You gaze within the mirrors and see... !>LMO actorNU%:NIMO actorNy&:*And bring upon nine times nine bad luck?-?MO actorN(: The sterile scent of nothing. MO actorN ):ZMO actorN1+:;Smooth and cool to the touch. Absolutely flawless glass. DDD)  placeholder WWThis is the place where your inventory is stored when you transform in between forms.MO quipnoN\:KN]:$But your voice is so abominable...gN^: Shut up...NN_:#And drive a man to distraction...MO quipnoNab:KNac:T\b"But your voice is so abominable, that it tortures anyone within earshot," you retort.\b "Oh, is it as bad as that?" asks Val with laughter in his voice. "Then I had better stop, as I wouldn't wish to cause you pain." And so saying, the mage brushes himself off. "Shall we continue our journey?" he asks and then proceeds to the north. >##Naf:\b"Shut up, simply shut up at once!" you finally snap at the mage. \b Val gazes at you for a moment before giving you a small bow. "I am your to command and thus, I obey," he says with a sardonic smile. "Shall we continue our journey, then?" he asks and then proceeds to the north. >##Nai:?\b"And drive a man to distraction with your ceaseless mumbling," you retort. \b "Actually, the words have meaning behind them. In an ancient language from a dead kingdom far away..." Val leans closer and whispers to you. "Some flower within my heart opens, I feel something within me rising, absolute destiny apocalypse..." The words are still fascinating, although they do not quite have the same power over you as when in their original language. You stare at the mage until he pulls back. \b "Shall we continue our journey, then?" he asks and then proceeds to the north.>##`bd### afterd$$$ backof`    itd### alongd### ontoph%%%  ontopofd$$$ before`    upd""" open`    ond### aboutd""" downh%%%  againstd!!! ford$$$ insideh'''  inside ofh(((  underneathd### aparth%%%  beneathd### outofh%%%  outsideh'''  outsideofd### in ond### below`    ifd""" awayd### closed$$$ Allthed$$$ overatTX.X.  <M satchet of catnip DDA thin brown satchet filled with dried and crushed catnip leaves. MO actorN~;VMO actorN;7You feel the dried leaves crunch within the satchet. ,MO actorN;-nMO actorN";OA bitter acrid smell... you dont' quite understand cats fascination with it. MO actorN;63MO actorN;You are not a cat!MO actorN;xMO actorN;OYou desire catnip and within a thrice, a little bag of it appear before you. >&8bMO actorN;MO actorO=xNM;eYou form a mouse, tiny little paws, a pink little nose, slender whip of a tail and soft white fur. NM;ZNM;> &D  <M+  white mice tiny white mouse A tiny white mouse with its slender tail wrapped around its pink little nose. Alas, it's... well, not dead since it was never alive. Not alive either. Unalive? You forgot to breath in the spark of life when you created it. MO actorN2<RMO actorNV<3Soft anf furry and completely cold to the touch. ,MO actorN<-BMO actorN<#It smells like fur and... catnip?MO actorN<63MO actorN><You are not a cat!MO actorNw<eMO actorN<<You summon forth a mouse and it appears before your eyes. >&5M yellowed parchment A yellow crinkled parchment, recently uprooted from the some forgotten corner of the tavern. Small spider script covers one side. MO actorN<LMO actorN<"You summon forth the parchment. > <&MO actorN5<5tMO actorNY2<U The true unicorn is the most gentle of beasts who runs with the wind forever at its back and flowers sprouting wherever its hoof may step. And though the single mighty horn upon its head is strong as forged steel and sharp as the sharpest sword, lo but it is a weapon never once used and that has never drawn blood.\b The unicorn traveled far and wide round the whole world and everywhere it went it was met with merriment and gladness for the appearance of the unicorn is a blessed event. Yet the day did dawn that the unicorn came upon a crossing on a lonely deserted road and lying in wait was a lion of dusky gold long parched with the thirst for blood.\b "Let me past," called out the unicorn, "For all who help me on my way are thrice blessed and those who hinder out of the spiteness of their hearts are thrice cursed."\b "The only blessing I seek is the taste of your blood upon my tongue," said the lion as it prepared to pounce.\b And even though its life was in mortal peril, never once did the unicorn think to defile its horn with the lion's own blood. Instead it began to spin tales, full of wonder and excitement, full of tears and joy, and so the lion was struck still in awe. And finally the unicorn came to the tales of merriment, of farmer's wives and wise old chickens, of men and brassy donkeys, and mice cleverer than all.\b And so struck was the lion by these tales that it began to roll about in the dirt, laughing and laughing until tears clouded its eyes. And thus the unicorn passed through the crossing, unhurt and unhindered and was long on its way before the lion realized what was done.     D#(MOvN <  you  yourself,  yourself %%You look about the same as always.   `VMO actorN )NYou can't follow yourself! N2MO verbdobjprepiobjN -MO roomNGC (NGGNGNGNG$! NG&f#NG)g<NG*NG+< D NG.NG/SNG3< ! NG4< NG7 NG:NG;NG<NG=&MO roomNzFC BNzL! NzMENzU NzVNz]G&Nz^Nz_eMOactordobjN b\^!<p accept!<u !  from %youm%.N dC&N ep youq yourr you'res yout you'veu v w havex doy arez me( % E% E% 21MO actorN&v0?MO actorN='vYou fuss about with !<MO actorN(v|MO actorN)vAs !<M is still hopefully attached to your body, that would be quite hard to do. MO actorN(*vnCMO actorNL+v$That's already part of your body! MO actorN,vMO actorN-vOh, to see the look on everyone's faces if you started pulling body parts off. Maybe when you're in a more masochistic mood. Or a sadistic one. MO actorNp.vCMO actorN/v$That's already part of your body! EMO actorN0vFOMO actorN1v0That would require quite a bit of contortion! LMO actorNV2vNeMO actorNz3vFYou are less than thrilled with the prospect of attacking yourself. EFEFJEKFLNPLQNLNLNRLSN32deMO actorN8vQMO actorN9v2You are not quite done with that body part yet. MO actorN :v8MO actorND;vYou preen to yourself.  MO actorNv MO actorN ?voAfter you spent so much time getting your forms perfect? It takes quite a while to fully master a new shape! oMO actorN@vpKMO actorNAvThere's nothing wrong with !<. MO actorNBvMO actorN8Dv>" 5N8Ev&You wrap your arms around yourself. 3N8Gv'You wrap your wings around yourself. MO actorNHvNMO actorNIv You are rather fond of !<. SMOactorioNCJvYou defend yourself against ! .SMOactorioNLvYou defend yourself against ! .MO actorNMvRMOactordobjN OvYou defend yourself against !< .,MO actorNq Pv-MO actorN Qv\^!<V smells of flowers and greenery, perhaps from your recent walk through the meadows. MO actorN RvsMO actorNC SvTYou lovingly kiss yourself. Perhaps next time you might try kissing someone else? MO actorN Tv[MO actorN Uv<You really would rather do this with someone else. YMO actorNA VvZMO actorNe WvAs amusing as it would be to see everyone's faces if you lit yourself on fire, that would really and truly destroy your disguise beyond repair. MO actorN XvkMO actorN@ YvLWere you sold when you weren't looking? You have no need to buy yourself. aMO actorN ZvbMMO actorN [v.Try feeding the food to your mouth instead.  s s s #$MOvantageN5>""MO actorNE6>"MN;>>" N<> your hair]N=>>" N>>your feathers-N?>>" N@> your scales,MNB>>" NC> your hair]ND>>" NE>your feathers-NF>>" NG> your scales MNI>>" NJ> your hair]NK>>" NL>your feathers-NM>>" NN> your scalesMNP>>" NQ>Your hair is a pure glossy black, although not quite so glossy as your feathers or scales in your other forms. It's slightly wavy and falls to the nape of your neck with a wildish windblown look, even if you haven't been walking around in the wind. This was actually the part of your human disguise that took the longest to perfect... no wonder humans seem to have so many supplies to fuss about with their own hair.NR><" DNS>5A single braid has been interwoven into your hair. NT>>" NU>Your feathers are a deep glossy black that shimmers with green, blue, and purple in the light. They are sleek at their tips and through their lengths upto the soft down that covers their bases. NV>>" NW>Your scales are glittering obsidian, tough yet flexible, each one as large as a grown man's palm. They would make a fine fire resistant armour for any who possessed them-- of course, they'd have t get them off of you first. MO actorN9X>MO actorN]Z>>" O]xN\>zYou carefully run your fingers through your hair, tracing them over a single lock that falls obediently into your palm. N]>ZN^>&N]_>>" yO]xNGa><With your curved beak you carefully pluck free a feather. NGb>ZNGc>> &N]d>>" O]xNf>^With a slender taloned claw you carefully scratch free one of your many overlapping scales. Ng>ZNh>> & MO actorNj>MO actorNl>>" NNm>?You run your fingers through your hair, fluffing and combing.Nn>>" 0No>!You smooth down your feathers. ZNp>>" FNq>:You polish your scales with the tip of one folded wing. MO actorN r>MO actorN t>>"  N u>Soft and silky.hN v>>" #N w>Smooth and silky. 3N x>>" N y>Smooth and hard. MO actorN z>@MO actorN |>>" E<" zN }>hYou carefully plait a single lock within your hair, twisting a knot in it to keep the braid in place. "N ~>>" E<" 5N >&You have already braided your hair! HN ><You might have better luck doing this in your human form. MO actorN ><MO actorN4 >>" E<" N4 >nYou carefully unplait the single braid within your hair, untwisting the knot and shaking the strands loose. !N4 >>" E<" +N4 >Your hair is not braided! HN4 ><You might have better luck doing this in your human form. kkk5 locks of hair lock of hairMN>]A single curling lock of hair dark as night. The light shimmers faintly across its length. N><" HN><The lock has been plaited into a single continuous braid. MO actorN>MO actorN9><" -N9>The lock is already braided!/N9>You braid the lock of hair."MO actorN>MO actorN><" 1N>"The lock of hair is not braided!`N>NYou carefully unplait the lock of hair, shaking free all the loose strands. !MO actorN>nMO actorN>cNow that your lock has been plucked free there's no use trying to put it back on your head again!MO actorNH>NMO actorNl>/Your hair is not nearly long enough for that.,MO actorN>-MO actorN>Your !<S smells of green things and flowers, perhaps from your trek through the meadows. pLMD plucked feathers plucked feather JJA single loose feather, plucked from your own plumage, dark and glossy. MO actorN>nZMO actorN>>" iN> Now that !<D has been plucked free there's no use trying to put it back again!N>>" LN>:You twist the feather into your hair at a jaunty angle. )nnN>>" ZN>NYour raven feathers would crisp away on the dragon form you now have taken. ,MO actorN$>-MO actorNH>Your !<S smells of green things and flowers, perhaps from your trek through the meadows. MO actorN>rMO actorN>HYou toss the feather and it wafts gently away on an itinerant breeze. > <&MO actorNn>bMO actorN>CNot to your great surprise, you find the feather to be feathery. cMO actorN>`MO actorN>6The feather blows away on the winds of your breath. > <&]MO actorN>^IMO actorN>*You wave your feather about in the air. u u u5M loose scales  loose scale KKA glittering loose scale of obsidian, pulled free from your dragon form. MO actorN>nyMO actorN> Now that !<D has been plucked free there's no use trying to put it back again!,MO actorN6>-MO actorNZ>Your !<~ smells of green things and flowers, perhaps from your trek through the meadows, but above all is the smokey scent of fire. MO actorN>?MO actorN3> Smooth and cool to the touch. y y y#$MOvantageN>""MO actorNE>"MN>>" N> your legsZN>>" N> your talons,N>>" N> your claws,MN>>" N> your legsZN>>" N> your talons,N>>" N> your claws MN>>" N> your legsZN>>" N> your talons,N>>" N> your claws$MN>>" N>A pair of human legs, shapely and long, with well proportioned feet free of callus or blister, and toes with perfect scalloped nails. Pretty much unremarkable save that they are attached to you. 8N>>" pN>aDark, slender bird legs with sharp curving talons atop each toe, good for grasping or clawing. N>>" N>Your back legs are thicker and heavier muscled than your front, but each one of them ends in slender, elongated toes tipped with knife-edged claws. MO actorNM>MO actorNq>>" ?Nq>0Your human skin is soft and warm to the touch.Nq>>" #Nq>Smooth and silky. lNq>>" XNq>LSmooth and hardness obsidian scales overlapping tough sinews and muscles. @  #$MOvantageN?""MO actorNE?"iMN?>" N? your arms7N?>" D >" N ? your wings,iMN ?>" N ? your arms7N ?>" D >" N? your wings iMN?>" N? your arms7N?>" D >" N? your wingsFMN?>" 9N?*The human form is worth taking if only for the agile fingers and thumb that it possesses. Other animals, other shapes, other forms also possess claws and talons and appendages for clasping, and grasping, and holding close or far apart; but none are half so flexible as these simple pale fingers. N?>" N?Dark feathered wings that stretch nearly the length of your body, from beak to tip of tail. They are sleek and powerful enough to give you aloft with few flappings in between. "N?>" N?Taut leathery skin pulled tight over light bones, these wings while unfurled are nearly three times the size of your already massive draconian body, and yet the long fingerbones laced through them allow the wings to also be pulled tightly close around you.MO actorN?MO actorN*?>" ?N*?0Your human skin is soft and warm to the touch.oN*?>" N* ? Feathery. BN*!?>" .N*"?"Smooth and supple to the touch.   #$MOvantageN&?""MO actorNE'?"  your body,  your body  your bodyMN.?>" N/?It's a human body, a fine specimen of such, gauging by others reactions to you and your own studies of human anatomy before you took your form. Symmetrical and pale and not particularly interesting save for the fact that it belongs to you. N0?>" oN1?`Your avian form is lean and smallboned, every fingerswidth of your shape dedicated to flight. _N2?>" KN3??Massy and well muscled, covered in overlapping scales as strong as plates of steel, your draconian form is the embodiment of power. It took you many years upon years to craft this precise shape, this perfection of form, as you sought to duplicate a dragon's form without ever laying eyes upon one in the first place. MO actorN4?MO actorN6?>" ?N7?0Your human skin is soft and warm to the touch.~N8?>" N9? Feathery. QN:?>" =N;?1Smooth and with rippling muscles to the touch. \  #$MOvantageN??""MO actorNE@?"  your head,  your head  your headMNG?>" NH?A pretty human face, although not quite so pretty as you could have made if you were not worried about bringing down too much attention. All sleek curves and planes, with a flawless pale skin that contrasts very nicely with your dark hair and golden eyes.YNI?>" aNJ?RA strong, slightly curved beak protrudes out beneath glinting intelligent eyes. NK?>" NL?Your head is long and rather delicate & graceful looking. Your muzzle ends in a tip with a silvery gray streak that swoops between elongated nostrils and great golden eyes. Two wickedly pointed horns sweep back elegantly atop your head leading to the slightly ruffled frills around your throat. Alas, far too few creatures have the chance to admire your most powerful form and those that do behold it tend to have more pressing matters on their minds. MO actorN'M?MO actorNKO?>" ?NKP?0Your human skin is soft and warm to the touch.gNKQ?>" NKR? Feathery. :NKS?>" &NKT?Steel sheathed in silk.   LM   dark cloak 44You allow the cloak to settle over your shoulder.  **You sweep the cloak off your shoulders. A deep black cloak of soft material, fitted perfectly to your body as it sweeps from your shoulders to your feet. The cloth is interlaced with threads of blue-green. You could have used silver or gold, but that would have been far too suspicious for a traveller in these parts. MO actorNa?HMO actorNc?)Soft but with a good weight behind it. ,MO actorN;d?-wMO actorN_f?XIt smells of greenery and flowers, perhaps from your recent trek through your meadow. h& & &LM  pair of boots %%You slip your feet into the boots.  $$You kick the boots off your feet. eeA pair of soft leather boots, formed exquisitely to your feet and rising halfway up your calves. Or they have the appearance of leather anyway...they never were the hide of any animal, cow or not. The heels are a bright shining black of some material or other... you really ought to pay more attention to what mortals usually use as soles to their shoes. MO actorNs?ZMO actorN(u?;A good beaten leather with an almost velvety feel to it. ,MO actorNv?-wMO actorNx?XIt smells of greenery and flowers, perhaps from your recent trek through your meadow.   LM  high collared tunic CCYou button up the tunic, carefully straightening out its collar.  99You unclasp the shirt and shrug it off your shoulders. And so it appears that this is your dark period, as even your tunic is deep black in color. Its high collared and unadorned save for the strange metal clasps running down its center. MO actorN?KMO actorN?,Silky, if perhaps a bit on the thin side. ,MO actorN?-wMO actorN*?XIt smells of greenery and flowers, perhaps from your recent trek through your meadow. |;;;.M  metal clasps Thin metal clasps that can act as buttons to close the front of the tunic when they are twisted about each other. Upon closer inspection one can tell that the clasps have been molded into the shape of tiny little feathers. MO actorN?4MO actorNB?Cold to the touch. ,MO actorN|?-MO actorN?yThe clasps are too tiny to have their own smell, but the shirt they ride upon has the smell of growing things upon it. t4 4 4LM  pair of black breeches 88You step into the breeches and casually pull them up.   You step out of the breeches. DDA pair of black breeches, of snug fit but otherwise unremarkable. MO actorN?4MO actorN?A good stout wool. ,MO actorNY?-MO actorN}?It smells of greenery and flowers, perhaps from your recent trek through your meadow. You doubt that another's breeches would smell quite so nice. G G GLM   circlet ))You slip the circlet around your head.  &&You pull the circlet off your head. 88A headpiece of suitably common copper, its a mere twist of metal that keeps your long bangs out of your eyes. You could think of a thousand more ornate decorations for your hair, but it would cause quite the stir if you waltzed into the tavern with a dazzling diamond diadem or a flaming coronet on your head. MO actorN?|MO actorN?]Smooth to the touch except for the little twist that rests at the center of your forehead. ,MO actorN}?-MO actorN?It smells of greenery and flowers, perhaps from your recent trek through your meadow, with just the faintest tang of metal to it. D1111.#  Butterscotch %%A yellow tabby, twice as wide as he should be, with golden eyes and a dark twitchy tail. You call him 'Butterball' although you're not quite sure what the others have named him besides 'that stupid cat'. He's currently in his favorite resting spot, splayed across the tavern's back counter. (MO actorNv?JMO actorN?< N?You give Butterball a good scratch. The yellow tabby mewls happily at you for a moment and then leaps heavily, well heavily for a cat, down upon the floor. Tail twitching ferociously, Butterball stalks over to the corner where the counter lies flush against the wall. He claws delicately at the sliver of a crack that separates the two until something thin and pale catches upon his sharp, extended nails. \b Butterball drags the parchment out to the middle of the floor and stands purring up at you for a moment. Then with great dignity he scrambles up atop the counter once more, stretches each leg daintily, and proceeds to doze away. >&!N?>" _N?Unlike humans, Butterball is not so easily fooled by your different shapes. The yellow cat purrs happily as you rub up against him. \b "Would y' look at that!" exclaims !>. "The balmy bird is petting the cat!"\b "And the cat's just sitting there letting him!" answers the tavern maid with a sigh. N?<N?(<(KN@N@fButterball arches into your hand, a purr rumbling deep in his chest, as you gently stroke his back. <sN@N@You scratch in between Butterball's ears, in the exact place you know he likes best, and his purr grows even louder as he closes his eyes in pleasure. <N@N@bYou pet Butterball's round tummy that he has bared to you and the kitty lolls about in ecstasy. <N@(Z,MO actorN@-MO actorN @You lean over and give Butterball a good sniff. He smells of milk and cream, with a distinct overtone of cat. Butterball sniffs back at you, and deciding that you smell like you, he yawns widely and goes back to sleep. LMO actorN @NMMO actorN4 @.Attack poor Butterball? Perish the thought! MO actorN @dMO actorN @EYou jump around Butterball. The cat blinks up at you in curiosity. MO actorN @eMO actorN9 @7Butterball purrs happily as you smooth down his fur. <MO actorN @nMO actorN @iA yellow fur stole might be interesting to wear, but you don't think Butterball would appreciate that. MO actorNV @|MO actorNz @]You give Butterball's blubber a good poke. Butterball bats back at you with his front paw. MO actorN @MO actorN @>" >N @/Butterball is far too heavy for you to carry.]N @QButterball slithers through your hands and back atop his perch on the counter. MO actorN @>" >N @/Butterball is far too heavy for you to carry.]N "@QButterball slithers through your hands and back atop his perch on the counter. aMO actorN #@bgMO actorN $@HA nice sentiment, but you'll have to decide what you want to feed him.MO actorN=%@nMOactordobjNa'@< Na*@You give Butterball a good scratch. The yellow tabby mewls happily at you for a moment and then leaps heavily, well heavily for a cat, down upon the floor. Tail twitching ferociously, Butterball stalks over to the corner where the counter lies flush against the wall. He claws delicately at the sliver of a crack that separates the two until something thin and pale catches upon his sharp, extended nails. \b Butterball drags the parchment out to the middle of the floor and stands purring up at you for a moment. Then with great dignity he scrambles up atop the counter once more, stretches each leg daintily, and proceeds to doze away. >&!Na+@ qNa,@HButterball laps up the milk with relish, tail twitching his pleasure. &<Na-@ Na.@nButterball gives a low mew of delight before digging into the fish, snarfing up every piece, bones and all. &<wNa/@ Na0@With a slight pang of guilt, you offer the tiny gleaming fish to Butterball. The yellow cat swallows it hole with a happy mewl. >&<Na1@ fNa2@WButterball looks up disinterestedly at the mouse. Not the mouser, our Butterball is. ENa3@ Na4@YButterball rolls round and round, playing playfully at the catnip you hold within your !> claws hands. <Na5@" E " oNa6@(Butterball pounces upon and snarfs up !  in a thrice. &<Na7@" E " KNa8@Butterball laps up ! &<Na9@" E " Na:@Before Butterball has a chance to anything more than stick out his rough pink tongue, the tavern maid has rushed up and snatched ! M away. \b "Don't give that to him!" she scolds you. "You'll make him sick!"Na<@" E " q)Butterball gives a distainful sniff at ! 7. Perhaps you ought to try something more nutritious?de#MOactorioN?@QMOactorioN@@-Attack poor Butterball? Perish the thought!MO actorNeB@SMOactordobjNC@-Attack poor Butterball? Perish the thought!MO actorNF@MOactordobjNH@" \NI@MButterball stares up at you with round golden eyes and mewls pathetically. BNK@$Butterball bats his front paws at ! . +MO actorNM@3rMO actorNN@SYou search Butterball but all you find is lots of blubber and pale yellow hairs. MO actorNsP@ MO actorNR@>" eNS@V"KAW! KAK KRAK KAK!" you say. Apparently raven beaks were not made for such sounds. NX@wThe sidle behind Butterball and suddenly begin howling, barking, growling and otherwise raising quite a ruckus. Butterball shoots to his feet, snarling and hissing, his back fur standing straight on end. The fat yellow cat looks around confusedly for the dog on the loose while the other tavern occupants simply stare at you. \b The tavern maid tsks. "Don't tease the cat!"MO actorNY@MO actorNZ@tYou whistle at Butterball. Not even bothering to open his eyes, the fat yellow cat merely flicks his ears at you. oMO actorNg[@pMO actorN\@pThere's nothing wrong with Butterball! Well... except for all the blubber, but that simply adds to his charm. MO actorN ]@MO actorND^@(You reach around Butterball with your !> wings armsJ and give him a good snuggle. Butterball purrs loudly and snuggles back.MO actorN_@MO actorN!`@You gently shake the sleeping cat. Butterball opens one eye in disgruntlement, stares at you pointesly, and then drifts off to sleep once again. /MO actorNa@.ZMO actorNb@;You hear Butterballs breath wuffling gently as he dozes. cMO actorN]c@MO actorNd@~You lean close and blow a thin stream of air on Butterball's fur. Butterball leans forward and gives you a good bop on your !> beak nose for your trouble. MO actorNZ e@fMO actorN~ f@GAs much as you like Butterball, you don't like him that much. MO actorN g@MO actorN!h@uHe's not for sale. And anyway, its doubtful that you have the attention to care for a real, normal, mortal animal. MO actorN!i@QMO actorN!j@2You coo at Butterball and Butterball mews back. }MO actorN#"k@~MO actorNG"l@kYou gently squeeze Butterball. Between his thick yellow fur and layers of fat, he's a very soft squeeze. MO actorN"m@AMO actorN"o@< N"r@You give Butterball a good scratch. The yellow tabby mewls happily at you for a moment and then leaps heavily, well heavily for a cat, down upon the floor. Tail twitching ferociously, Butterball stalks over to the corner where the counter lies flush against the wall. He claws delicately at the sliver of a crack that separates the two until something thin and pale catches upon his sharp, extended nails. \b Butterball drags the parchment out to the middle of the floor and stands purring up at you for a moment. Then with great dignity he scrambles up atop the counter once more, stretches each leg daintily, and proceeds to doze away. >&!lN"t@`You stare down at Butterball and Butterball stares back at you in wide golden-eyed adoration. <MO actorNB&u@MO actorNf&w@>" Nf&y@You hear the old men giggling in the background as you creep up to Butterball and give him a good peck. Butterball continues dozing away. \b "The bird is in love with the cat!" !>( crows. "Oh, what starcrossed lovers!"Nf&}@You lean down and give Butterball a good smooch right on his pink nose. Butterball's rough tongue flicks out and gives you a few swipes on your own nose in return. \b "Heh, he sure likes that cat," says !>F. <MO actorN(~@rMO actorN(@SYou squawk at Butterball and Butterball bats at you with his paw for the effort.  MO actorN)@!MO actorNA)@`It doesn't take much, simply a few soothing strokes, and Butterball is slumbering once again. MO actorN)@MO actorN)@You remember when Butterball was just a pudgy little kitten. Although not one your creatures, the yellow cat always seemed to enjoy your company. Probably because of all the sweets and goodies you plied him with. "#$%=1_^VWPLQNLN LNL6NLNLNLNLNLNLNLNJLKN[L\NLNYLZNLNRLSNTLUN#MOactorioN,@^MOactorioN,@>" N,@"KRAW! KAK KAK KAW COA! Kaw?" you ask the yellow cat. Butterball merely blinks at you and yawns, his little pink tongue poking out amongst his sharp teeth. ~N,@You ask Butterball about ! 6. The cat merely mews and flicks his tail at you.\b !<@N,@#MOactorioN3.@WMOactorioN\.@>" oN\.@`"KRAW! KAK KAK KAW COA!" you tell Butterball. The cat merely mews and flicks his tail at you. N\.@You tell Butterball about ! l. Butterball merely blinks at you and yawns, his little pink tongue poking out amongst his sharp teeth.\b !<@N\.@FFi"The wisdom of the cats, though priceless beyond compare, is foolishly sought" the old man says sagely.F"Holdin' conversations with cats now, are y'?" cackles the old coot.KThe maiden in shadows eyes you warily as you continue to speak to the cat@"You won't get much out of that cat" the tavern maid tells youL  M  mug of milk ccChilled milk, foamy with cream, fills one of tavern's plain earthenware mugs nearly to its brim. MO actorNXMO actorOxNXaThe milk slides down your throat, delicious and sweet. You lick the last bit of foam from your !> beak lips. <&NXAZNX> &,MO actorNX-EMO actorNX&The milk smells fragrant with cream.MO actorNX[MO actorN2Y<Beads of moisture slide down the outer surface of the mug.MO actorNY4HMO actorNY)Filled to the brim with milk and cream.  <M steaming fish A whole fish rests upon the plate before you, nearly as long as your forearm. Wisps of steam waft from its slightly charred body, including its shriveled tail and its glazed blank staring eyes. At least they removed the scaled for you.MO actorN#X6MO actorNGXYou dig into the fish, carefully eating around the myriad of small fragile bones. It is... a bit dry. Not quite so fresh as they would have you believe. The other tavern patrons surrepticiously watch as you snarf the whole fish within a few minutes. "Quite hungry, were y'?" says !>@ as the tavern maid bustles by and removes your finished plate,MO actorNX-GMO actorNX(It smells of... cooked fish, actually.MO actorNDX?MO actorNhX Hot and slippery to the touch.MO actorNX4JMO actorNX+A large fish lies stuffed into the plate.6v6v6v6D&  tavern drunkard the tavern drunkardMN@%The tavern drunkard, and most favored tavern customer, is slumped over in his usual seat, head buried within his arms. From memory, not much is missed by not seeing his face. His hair is longish, dark brown peppered gray, and has grown wild and unkempt, and not in an artful way like yours. N@<" LN@@A dainty little braid has been plaited into this shaggy hair. N@Despite long hours spent whiled away inside the tavern, his skin has been burnt and even reddish-brown, perhaps indicating he's a farmer. An aura of alcohol clings closely to this man who rests in a slovenly puddle of his own clothes. M #MOactorioN@ MOactorioN @>" N @}"KAK KAK KRAW KAW?" you ask the tavern drunkard. Mumbling curses under his breath, the drunkard takes a wild swipe at you. UN @5The drunk mumbles incoherently under his breath.\b !<@#MOactorioN1@6MOactorioNZ@>" jNZ@["KAK KAK COA COA!" you tell the drunkard, who buries his head all the deeper in his arms.NZ@;You sit down next to the drunkard and tell him all about ! :. He continues to snore away before, during, and after. !<@K"You'll not get anything useful from that one" the tavern maid warns you.@"Heh, might as well talk to that there wall" says the old man.>"Come talk to us instead!" the old coot calls out cheerfully#MOactorioNp@FMOactorioN@"The drunkard dozes on oblivious.MO actorN@8MO actorN @You'd much rather not. 1MO actorNG@0TMO actorNk@5He's quite dirty, but not quite that dirty. MO actorN@!MO actorN@>" N@With a flutter of feathers you land atop the drunkard's shoulder. You hop about the folds of his cloak, but he takes no notice. kN@SYou jump upon the drunkard's shoulder. \b "Wakey, wakey morning sunshine!" you sing out. Without moving his head from the table, the drunkard reaches back and tosses you several feet away. \b You roll and land gracefully to the side of the two old men, who have stopped chattering to stare at you. \b "Try that with me instead!" cackles !>MO actorN @wMO actorN4 @XYou give the drunkard a light push. He wobbles slightly but is otherwise undistrubed. MO actorN @n_MO actorN @@You find the thought rather appalling. Amusing, but appalling.MO actorN: @tMO actorN^ @>" :N^ @+He's far too heavy for you in this form. N^ @>6" E >7" EN^ @VCasually you stroll over to the drunkard's table and give it a quick push. It skids away with a screech, depositing the drunkard upon the floor. He looks up in startlement as the two old men burst into laughter, staggers over to the new placement of his table, and collapses atop it once again. \b "Shame on you!" scolds the tavern maid as !> look on in disapproval. "A fine looking gentleman as yourself picking on that poor man. And shame on you two as well! " she says and shakes her finger at the two old men, who look properly chastized. "7N^ @"7`N^ @?Casually you stroll over to the drunkard's table and give it a quick push. It skids away with a screech, depositing the drunkard upon the floor. He looks up in startlement as the two old men burst into laughter, staggers over to the new placement of his table, and collapses atop it once again. \b "That be enough of your shenanigans for today!" the tavern keeper declares and begins dragging you out by the ear. Or she tries, but you are far too quick to submit to a humiliation like that. \b For a moment you ponder bringing down a swarm of bees, or slavering dogs, or even simply setting the tavern keeper's hair on fire for her impudence. You finally decide not to risk destroying your disguise for generations to come with such a display, and so with quiet dignity you bid farewell to the tavern and walk out on your own. \b"8>BN^ @VCasually you stroll over to the drunkard's table and give it a quick push. It skids away with a screech, depositing the drunkard upon the floor. He looks up in startlement as the two old men burst into laughter, staggers over to the new placement of his table, and collapses atop it once again. \b "Shame on you!" scolds the tavern maid as !> look on in disapproval. "A fine looking gentleman as yourself picking on that poor man. And shame on you two as well! " she says and shakes her finger at the two old men, who look properly chastized. "6MO actorN@MO actorN@Just what you always wanted! A tavern drunkard of your very own! You could hug him and squeeze him and call him George... this strange thought finally runs its course through your mind and you decide that Val might be more fun to play with anyway. MO actorN@4MO actorN?@You carefully rifle through the drunkards clothes and pockets. Nothing there but the heavy smell of beer and wine and a few pieces of lint. MO actorN@MO actorN@>" jN@[You perch atop the the drunkard's head, making a nice nest for yourself within his hair. aN@UYou eye the drunkard carefully, but there's really no way to do that in this form. MO actorN @6RMO actorN0@3The very thought makes you feel a trifle queasy.  MO actorN@tMO actorN@UYou pull on the drunkward's arm. He wobbles slightly but is otherwise undisturbed. MO actorN&AMO actorNJAThat would take such a great amount of power that your disguise would be immediately destroyed. You settle for sweeping a few flecks of sod off his shoulder. MO actorNA1MO actorN3AThere's nothing but wooden table underneath the drunkard. Perhaps some empty bottles or mugs are stashed away under there as well. MO actorNA2mMO actorNANYou see nothing behind the drunkard but a empty space and a tattered cloak. MO actorNt AiMO actorN AJYou give the drunkard a good poke. He mumbles incoherently in his sleep.MO actorN A{MO actorN+A\You smile winningly at the drunkard. Alas, all your charm is wasted on the oblivious man. [MO actorNA\jMO actorNAKYou give the drunkard a good pinch. He mumbles incoherently in his sleep.MO actorN@AUMO actorNdA6All your efforts are wasted on the dozing drunkard. MO actorNA'TMO actorN8A5You burst into song. To your great surprise the drunken, passed out man suddenly bolts upright. He slings an arm around your shoulder and you both stagger around the room, singing an old tavern song as the other patrons look on in amusement. \b "O'er mountain, o'er valley\n through the forests, through the plains\n lies this land of pomp and splendour\n treasures vary, gilded chains\b See the shadows softly lying\n see the gold in the sun\n Sea of rainbows, sea of jewels\n sparkle, glitter, burn and run\b All is gold, all is silver\n everchanging, all the same\n price of finding, price of catching\n shoulder this and bear the blame\b This love is ephemeral\n this love is set in stone\n My soul for this jewel\n for this heart walks alone\b Coins in the flowers\n gems in the trees\n flesh bound to earth\n and spirit in the breeze.\b King of the phantoms\n wisps through the age\n my soul for this kingdom\n gild the lily, gild the cage!" \b As soon as the last note vanishes into the air, your fellow singer collapses back unto his table and proceeds to snore away.(MO actorN=!:A)MO actorNa! calls out to you. oMO actorN">ApBMO actorN:"?A#You have no idea where to start. MO actorN"AAMO actorN"BAYou wrap your !> wings arms lovingly around the drunkard. He remains an unresponsive lump under your touch but his smell of stale wine is more than happy to transfer to you. >`&3MO actorN#DA2AMO actorN#EA"Alas, that is beyond your power.MO actorN$GAMO actorN,$JAThe day around you darkens as you pull down abominable hexes, cursing the tavern drunkard and its kin to the ninth generation. \b "Good lord," says !>( "What did he do to curdle your milk?"/MO actorN%LA.MO actorN@%MATIn between incoherent mumbles you hear the drunkard's breath wheezing in and out. !<*@*ZZ_He suddenly sits up and loudly proclaims "Cheese!" before collapsing on the table once again.)He mutters about jewels in the flowers.fHe thrashes a bit, perhaps caught in a nightmare, and whimpers about something coming from the north)..."truth in the reflection" he mutters9...you've met him before...he mumbles around his snores,MO actorN-'QA-MO actorNQ'RAYou lean close and take a hesitant sniff. The drunkard smells strongly of stale alcohol, wine and beer and rum and who knows what else. MO actorN(TAMO actorN$(UAYou lean close and...balk at the last moment. There are prettier, more pleasant smelling, more conscious, people to steal kisses from. MO actorN(WARMO actorN(XA3You decide that you aren't truly that desperate. MO actorNN)ZAwMO actorNr)[AXYou belch hot air at the tavern drunkard, who raises his head and belches right back. }MO actorN)]A~eMO actorN*^AFYou give the drunkard a good squeeze. He takes a wild swing at you. aMO actorN~*`AbxMO actorN*aAYThe thought passes through your mind that he's probably not interested in food. MO actorN +cAYMOactordobjND+dA3He doesn't seem interested in your offer of food.dMO actorN+fAe:MOactordobjN+hA" N+kAThe drunkard reaches out, snatches the drink, and gulps it down in one swallow before collapsing atop the table once again. \b "Your generosity is probably lost on him," the tavern maid says. <N+mA0The drunkard dozes on oblivious to your offer.MO actorN-qA}MO actorN+-rA^You hesitate... somehow you think that would bring the wrong kind of attention down on you. MO actorN-tAMO actorN-uAFYou plait a pretty little braid into the drunkard's tangled hair. \^!>E disapproving look is ruined by the giggles that keep leaking out. "MO actorN.wARMO actorN.yA>" N.zA"KRAK!!!!" you squawk right into the drunkard's ear. He sits up so fast that he falls out of his chair. The old men burst into guffaws as the drunkard shakes a fist up at you circling above before returning to his nap on the table. 4N.|A(You squawk at the oblivious drunkard. TMO actorN0~AUMO actorN50A>" YN50AYou stand atop the drunkard's head, pecking desultorily at his neck. He wildly swings at you a few times before giving up and returning to his sleep.\b "That reminds me o' something..." says !>2. \b "Breathing reminds you of something," says !>o "Too bad it's never anything useful, like where you lost your silverpurse. " \b "Never you mind that," says !>. "That there crow reminds me o' the story of those strange birds the next kingdom over. The one who ride atop the horses and stags and whatnot and eat the bugs off o' them! Handy birds, that!"N50A)UMO actorN2ADMO actorN2A%You coo at the oblivious drunkard.  MO actorN53A!QMO actorNY3A2The drunkard is already as calm as he could be. MO actorN3A^MOactordobjN3AYou try to put ! T on the drunkard but you end up snatching it back before it topples to the floor. MO actorNs4AMO actorN4AmYou try to tickle the drunkard, but all he does is shrug his shoulders and mumble incoherently to himself. _^VWRS]^+346JK=LNPQ$%KKKM  lint  A pocketful of gray fuzzy lintMO actorNUA0MO actorNyASoft and fuzzy.,MO actorNA-uMO actorNAVYou cough as you inhale the lint. It smells as one would expect... dusty and stale.  .  incoherent mumbling AAThe tavern drunkard is mumbling incoherently under his breath. /O actorNA.x888_ fee.89PGJ|22224b creatable stagMO actorN1^CK2MO actorNU_C>  E >" DNU`C5Creating that here would bring too much attention. 1NUbC>  E> > E >z" E >" XOUxNtCThe space before you twists and solidifies, the curve of slender legs, the graceful arch of a back, the spray of sharpened horns. The stag takes form, twin plumes of steam snorting from its nostrils. It majestically wheels about, tilts forward its tangled crown of antlers, and charges straight at Val. \b The music of the flute cuts off sharply as the mage adroitly leaps out of the way. The stag pulls up atop a nearby incline and wheels round again, its dark eyes watching the mage's every movement. As Val raises the flute to his lips once again, the stag leaps forward, flower petals breaking free and fluttering through the air around the rapid pound of his hooves. \b Val dives away once again but his cloak flares out, catching on the many grasping tips of the stag's antlers, and he is dragged back several paces before the cloth rips free. Val crouches, breathing slightly hard, eyes locked upon the stag, who wheels about to face him once again. \b "He does not seem to like your music," you call to the mage. \b Val's head tilts back slightly towards you, but his eyes remain upon the deer. "You think so? And here I thought myself a rather good musician," he says and carefully tucks the flute away within his torn cloak. \b The stag's dark expressionless eyes takes this all in. He snorts to himself, flicks his ears towards you, waves his tail like a banner, once, twice, thrice and then bounds off towards the forest to the east. \b "Has no proper ear for music," says Val and his eyes flit over to you. \b "I can't say I was all that impressed myself," you tell the mage. \b "On no?" Val's lips twitch upward. "I shall endeavor to do better next time," he says and then drawing his cloak about him he begins walking towards the north. >"z>||>&!>&NuCZNvC&C*NUyC>  E> > E >z" E >" OUxNC$The space before you twists and solidifies, the curve of slender legs, the graceful arch of a back, the spray of sharpened horns. The stag takes form, twin plumes of steam snorting from its nostrils. It majestically wheels about, tilts forward its tangled crown of antlers, and charges straight at Val. \b The music of the flute cuts off sharply as the mage adroitly leaps out of the way. The stag pulls up atop a nearby incline and wheels round again, its dark eyes watching the mage's every movement. As Val raises the flute to his lips once again, the stag leaps forward, flower petals breaking free and fluttering through the air around the rapid pound of his hooves. \b Val dives away once again but his cloak flares out, catching on the many grasping tips of the stag's antlers, and he is dragged back several paces before the cloth rips free. Val crouches, breathing slightly hard, eyes locked upon the stag, who wheels about to face him once again. \b With a small shrug, Val carefully tucks the flute away within his torn cloak. The stag snorts to himself, flicks his ears towards you, waves his tail like a banner, once, twice, thrice and then bounds off towards the forest to the east. \b "Has no proper ear for music," says Val and then drawing his cloak about him he begins walking towards the north. >"z>||!>&>&":NCZNC&_$NUC>  E >  OUxNaC<The space before you twists and solidifies, the curve of slender legs, the graceful arch of a back, the spray of sharpened horns. The stag takes form, twin plumes of steam snorting from its nostrils. It majestically wheels about, tilts forward its tangled crown of antlers, and charges straight at Val. \b The mage lifts his pale head and the stag stumbles over a roll of sand that emerges suddenly beneath its hooves. The stag stumbles to its feet, staggers a few strides closer to Val once more, and then plows head first into another dune. The stag's eyes roll wildly as it flails about with its legs, trying to find stable ground that will not shift and change beneath it. Finally it gathers its leg beneath itself and bolts over the dunes, away and to the north. Val has long since returned to his drawings in the sand. >||NaCZNaC& NUC>  E >  OUxNCA new shadow takes form within the forest. The stag steps out from beneath the trees and begins nibbling upon the buds along the low growing branches. A bloody lot of good that did. >||NCZNC&NUC>  E >  OUxN7CiFrom out of the red dust a pale form rises, coat of creamy brown with sharp flint hooves and a crown of tangled antlers. The stag tilts forward its head and charges straight towards the chanting Val. For a moment the mind numbing song halts as Val quickly scrambles out of the way and up a nearby hill. \b The stag bounds after him as Val climbs ever higher and then makes the leap to the red arch. The deer circles around beneath the arch as Val once again begins his chant, but the mage is far above his reach. The stag turns towards you, gives a slight shrug of his brown shoulders, and wanders off to the west. >||N7CZN7C&NUC>   E >    NUCsThe space before you twists and solidifies, the curve of slender legs, the graceful arch of a back, the spray of sharpened horns. The stag takes form, twin plumes of steam snorting from its nostrils. It lowers its crown of horns and charges straight and true towards the white mage.\b And within a few steps it has exploded, raining crimson droplets across the plains. >  NUC>  E >   NUCThe shadowed shape of the stag rises from the rolling ground. Without hesitation nor pause, he leaps straight towards Lorekosi, catching the white clad mage by surprise. The stag charges right through, its cascade of horns catching nothing at all as the mage's form turns wispy and insubstantial. \b The stag staggers as it pulls up and then with a quiet groan is falls to the ground, bursting into flits of fleeing shadow. NUC>  E >  OUxNC]The space before you twists and solidifies, the curve of slender legs, the graceful arch of a back, the spray of sharpened horns. The stag takes form, twin plumes of steam snorting from its nostrils. It makes a feint at Val, who merely ducks down into the hole he was digging. \b The stag flicks it ears about and them ables off to the southwest. >||NCZNC&QNUC>  E >   OUxNoCA shape takes form upon the green shores of the lake, pale shadows coalescing into the graceful form of a stag. The deer sniffs at the moist air and begins grazing on the green grass. >||NoCZNoCm&&NUC>  E >  FNUC$From twists of light and shadow the graceful shape of a stag bounds forth. It tilts its tangled crown of antlers towards the mage and charges forward... managing only a few strides before it's slammed backward. \b The stag crashes into the ground and disintegrates into flits of darkness. >NUC>  E >  NUCThe ground trembles with the pounding of numerous hooves causing the apple barrel to rattle and shake and sending rivelets of straw falling from the thatched roof of the nearby stable. Your companions look about in perplexity. Or some of them do... \b "What in the world--" begins !>. \b And then they come. A storm of hooves, a river of moving bodies, a stampede rushing straight through the pebbled courtyard. Deer and elk and antelope and moose, cows with little bells tied to their necks and bulls snorting red fire, heavily lumbering buffalo and wildebeest and even a few horses mixed in with the others. \b They descend upon the tavern, sending its walls and windows to rattling, their legs kicking stone dust into the air, their passage drowning out all other sound but the thunder of their hooves. And just as quickly they are gone, disappeared over a nearby rise with no trace, nothing left but the clouds of dirt and dust left hanging in the air. \b With an expressionless face Val gazes after the stampede, having somehow managed to scramble atop the stable's roof. Layna is curled up in a corner of the courtyard, head buried in her arms, as for the Old Coot... \b "Good gods, what happened to the old man?" exclaims Layna as she sits up. \b Val leaps down and lands lightly upon his feet. "Look over there," he says and points towards the tavern's nearby windows where the old man is sheepishly waving. "Although I don't believe he's coming out again. " \b "I don't blame him in the least!" says Layna as she scrambles to her feet. "What in the nine hells was that?" \b "Stampede," you reply mildly. \b "I saw that much for myself. What were those animals doing here? Was it the fey?" says Layna. \b "Undoubtedly," says Val who waves back at Old Coot as the old man finally disappears from the window. "I am not so easily scared off." \b "I might be..." Layna mumbles as she pulls her cloak closer and looks around suspiciously. \b One down, two to go.NUC> NUC>  E >  E >   NUCThe ground trembles with the pounding of numerous hooves causing the apple barrel to rattle and shake and sending rivelets of straw falling from the thatched roof of the nearby stable. Your companions look about in perplexity. Or some of them do... \b "What in the world--" begins !> . \b And then they come. A storm of hooves, a river of moving bodies, a stampede rushing straight through the pebbled courtyard. Deer and elk and antelope and moose, cows with little bells tied to their necks and bulls snorting red fire, heavily lumbering buffalo and wildebeest and even a few horses mixed in with the others. \b They descend upon the tavern, sending its walls and windows to rattling, their legs kicking stone dust into the air, their passage drowning out all other sound but the thunder of their hooves. And in their midst stands Val, his cloak held protectively over the cringing Layna. The stampede parts around them like a rock within a river until one bull breaks free of the stream of animals and charges straight at them. The roar is too loud to hear Layna's scream. For a moment the bull is heedlessly running them down and in the next it has rushed into an invisible barrier and is flipping head over tails to disappear under the hooves of the rest of the stampede. \b And then just as quickly they are gone, vanished over a nearby rise with no trace, nothing left but the clouds of dirt and dust left hanging in the air. Layna pulls away from Val with a jerk.\b "You did that," she says and her tone is half accusation. "You forced the beast away. You are a--" \b "A mage?" says Val lightly as he shakes the dust from his cloak. And suddenly every scrap of your attention has been pulled to him. Layna recoils almost as if struck. "So..." she says and pauses. A long pause where nothing is said. "You have come for the fey." \b "Perhaps." The mage's gaze is far away, looking at neither the maiden nor you, but towards the distant north. \b "I will have no truck with this," says Layna quietly. She gives a small curtsy to Val and then another to you before striding back into the tavern. \b "More frightened of me than of the fey," Val says dryly. \b "And yet I can't blame her," you reply and finally Val turns to look at you. \b "And what of you? Will you draw back now?" he asks with an expression that is half smile and half smirk. \b That would be the wisest choice. Of all the creatures in all the lands, the only true enemy of the fey, besides themselves, are the mages. And yet... you were never really all that wise. \b "I am not so easily frightened off," you say and the mage inclines his head to you. \b "Then shall we be off?" he asks and slings his satchel upon his back. And with that Val strides off to the northwest. NUD>>>&!"OUxN1D4The space before you twists and solidifies, the curve of slender legs, the graceful arch of a back, the spray of sharpened horns. The stag takes form, twin plumes of steam snorting from its nostrils. It majestically wheels about, looks around itself, and then with three shakes of his tail it wanders off. >||>N1 DZN1 Dm&X  L  44You allow the cloak to settle over your shoulder.  **You sweep the cloak off your shoulders.  hooded cloaklMNL The cut of the cloth is simple, but the dark material is quite fine. A deep hood rises from the close collared neckline, that could cover one's face entirely in shadow if it was pulled fully up. An unadorned silver pin above the left breast holds the cloak closed. NL<:" ?NL3\b The edge of the cloak has been torn in twain. MO actorNLMO actorN;LYou brush your !> feathers  fingersl over the trailing edge of the cloak. It's soft to the touch, almost springy, but with a good heft to it. ,MO actorNL-MO actorN)L>  N)LYou stealthily edge towards !>! Val,the cloaked stranger,7 waiting for an inattentive moment to make your move.N)L You give !>! Val'sthe cloak a surrepticious sniff. It smells of woods and travel, of green earthy dirt mixed in with the unique smell that must be !>! Valthe cloaked stranger himself. MO actorNLMO actorNL>  :NL0You reach out and give the cloak a good pull. !>! Val'sThe cloaked stranger- turns back to you and arches a pale brow. !>>8You give a great caw and flutter off in embarrassment.TQ"You had a bit of leaf on you," you say as you brush nonchalantly at the cloak.NL>   mNLAQuickly you strip the fine dark cloak off of Val's still form. >&>NL)xxx5  dead stag zzThe once proud stag lies crumpled amongst the pebbles of onyx and turquoise, its glazed eyes staring accusingly at you. ,MO actorNlE-oMO actorNmEPIt still smells of woods and earth, of the living. It has not been dead long. MO actorNCoEXMO actorNgpE9Its cream brown coat is soft and velvety to the touch. TMO actorNrEUMO actorNtE>" ANuE5You stand atop the dead stag and peck at its body. NwE> > ;NyE,Val grimaces slightly and waves you away. N{E)UaMO actorN}EbPMO actorN~E1Oh, you've done quite enough with the feeding. MO actorN/EDMO actorNSE%You howl mournfully over the stag. MO actorNEMO actorNEYou wrap your !> wings arms8 around the stag's neck and give it a gentle squeeze. /MO actorNPE.*MO actorNtE Silence. MO actorNE<MO actorNEIt already belongs to you. MO actorN EJMO actorN.E+You really have no use for the dead stag.MO actorN~E9MO actorNEAlas, its not the easy. oMO actorNEppMO actorNEIThe dead stag breaks apart into shadows and sinks back into the ground.!>&```JbMpMND<  CND4far distant gryphon perched atop the highest hillsNE gryphon [[The gryphon is darkly furred brown with great golden wings streaked with black. His beak is large, coiled, and sharp, his eyes are a bright green and slit like a cat's, and his eartufts stand proudly erect, flickering in every direction for a sense of danger. The long sleek tail of the animal lashes back and forth as it pointedly ignores you. MO actorNEEMO actorNE>  E >  NEThe air before you twists and darkens, takes form and substance in the shape of long gleaming claws and wickedly hooked beak and with bright glowing eyes that belong to a predator. \^!>J gives a little shriek as she falls back at the sight of the gryphon. \^!> gives an even louder shriek and falls back so much he goes right into the tavern.\b The gryphon shakes itself and looks around boredly. It clicks its beak and makes a halfhearted pounce at the maiden which sends her collapsing down upon her hands and knees. And apparently feeling that its duty is performed, the gryphon's wings sweep out and upwards and, with a wild keening cry it flies off to the northeast. \b "That... that was a real gryphon, was it not?" says !> as she trembling drags herself back to her feet.\b "So it seems," replies. "It seems our fey has a liking for the magical animals."NE>>&";PNE>  E >  E >  E >;" (NEThe air before you twists and darkens, takes form and substance in the shape of long gleaming claws and wickedly hooked beak and with bright glowing eyes that belong to a predator. \^!> gives a little shriek as she falls back at the sight of the gryphon. The half-bird's eyes gleam as it espies the girl and slowly it stalks forward, claws clicking against the stone. \b Val moves forward in between the maiden and the beast. The gryphon turns its head towards the man with interest as he raises his hand... and then sparks flare about all around Val and sweeping out towards the gryphon. The beast gives a cry of defiance, but feeling its duty was performed, the gryphon's wings sweep out and upwards and, with a wild keening cry it flies off to the northeast. \b Layna is gawking up at Val now, and all your own attention has been pulled to him as well. "You--" she says and falters. "You are..."\b "A mage?" Val asks lightly and you draw back slightly. \b Layna's indrawn breath in quite audible. For a moment there is silence and then... "I see," she says. "I think it would be best if I returned to the tavern. " and she rises to her feet and, with many a backward glance, makes her way back inside. \b "More afraid of me than of the fey," Val says with a soft, dry laugh. \b "That makes perfect sense to me," you reply and Val turns to gaze at you. \b "You're not running off as well, are you?" he asks and yes, the damn mage is smirking. \b "The others have far too much common sense to go on a fey hunt with a mage, " you say. "All except for me, who has no sense at all. "\b Val laughs at that. "Then let's be off, shall we?" he says, and hiking his satchel up upon his shoulders, the mage strides off to the northwest. N.E>>!"";>&>&N0E>  E >  E >;" N8EZThe air before you twists and darkens, takes form and substance in the shape of long gleaming claws and wickedly hooked beak and with bright glowing eyes that belong to a predator. Val's eyes narrows as he looks upwards towards the fast approaching beast. \b The gryphon swoops downwards, deadly talons extended and reaching for the mage. Val plays a single shrieking note upon his intrument and the gryphon's wing buckle for a moment as it veers wildly. Yet it still reaches outward and its talons hook up the silver flute, wresting it away. Val staggers slightly as the beast gives a cry of defiance, but feeling its duty was performed, the gryphon's wings sweep out and upwards and, with a wild keening cry it flies off to the east. \b "Well," says Val and \Well," again. It seems that is all he means to say as he then turns and proceeds to the north. ";>&!>&>&!. N;E>  E >  E >;" N?EThe air before you twists and darkens, takes form and substance in the shape of long gleaming claws and wickedly hooked beak and with bright glowing eyes that belong to a predator. The beast stalks forward, lighting gleaming gold upon its coat. It paws at the ground, uprooting Val's patterns and sits upon its haunches, daring the mage to redraw them. "I do believe that is a hint to move on," Val drawls as he carefully backs away to the southeast. ";>&!>& NAE>  E >  zNCEkA cry of aggravation echoes from above as the gryphon cannot descend into the close canopy of the trees. yNEE>  E >  E >;" YNJEThe air before you twists and darkens, takes form and substance in the shape of long gleaming claws and wickedly hooked beak and with bright glowing eyes that belong to a predator. The gryphon swoops downwards, deadly talons extended and reaching for the mage. \b Val jumps back and lets loose with a single piercing scream. The sound shivers through the air and for a moment as the gryphon veers wildly. The mage takes this chance and escapes through the red arch, moving away from the hills with far more speed than when he approached. ";>&>&>9&"9NLE>  E >  QNNE8The air before you twists and darkens, takes form and substance in the shape of long gleaming claws and wickedly hooked beak and with bright glowing eyes that belong to a predator. Val ducks deep into his trench as the gryphon passes overhead, giving a single keening cry before it wings its way to the south. >&NPE>  E >  NREThe gryphon springs out of thin air, its front forpaws outstretches, talons reaching towards the mage. It may have even brushed against his skin before it disintegrated into swirls of white smoke. >xNTE>   E >   NVEThe gryphon dives from the sky, hurtling straight towards the white mage. And even though it breaks apart within the air, raining down upon the plains, the force of its attack still sends !>  reeling. >  ^NXE>  E >  NYE The air before you twists and darkens, takes form and substance in the shape of long gleaming claws and wickedly hooked beak and with bright glowing eyes that belong to a predator. The gryphon gleefully circles above, diving in and out of the fray at its leisure. $N]EThe air before you twists and darkens, takes form and substance in the shape of long gleaming claws and wickedly hooked beak and with bright glowing eyes that belong to a predator. With a wild keening cry its wings lash out, catching the air, and it flies off and out of sight. >&p...Fjh i    V& ''Val lying unconscious upon the ground, ''Val lying unconscious upon the ground ''Val lying unconscious upon the ground It seems that the pale haired mage has somehow been shocked unconscious by merely touching the memory sphere. His breathing remains deep and even and he appears rather charmingly innocent in his sleep. Of course, lions look the same in their repose. MO actorNNzMO actorNN=With a wicked cackle you strip all the clothes off of Val.  >sDMO objNLNL"E NLN"! MO actorO listN N<N NCs<tN N>5" N NNN INN\b\^!< !<} clad in !. GNN\b\^!< !<} naked as the day is long.   2 2 b<M   blue rose A perfect blue rose, the color of the pale summer sky, with soft velvet petals just opened from the bud. Its leaves are a deep complimentary green and slightly jagged along their ends. And along its stem grows nine wicked sharp thorns. MO actorN.oMO actorNRo< " KNRo)The petals are the softest down beneath your touch to the ragged, jagged feel of the leaves. And then you make the mistake of brushing against a thorn and it draws forth blood, even with the gentlest of touches. A dark crimson drop wells up and falls to the earth with a slight chiming clatter. " > >t&NRo< " NRoThe petals are the softest down beneath your touch to the ragged, jagged feel of the leaves. This time you remain wary of the thorns. -rMO actorNloSThe scent is bittersweet, and yet like nothing else you have come across before. MO actorNp6 MO actorNpYou bite into the head of the blue rose. The petals are like silk in your mouth, fragrant and honey sweet. And yet when you swallow, its burns and turns sour as it slides down your throat. You toss the empty leaves and stem away. !<&MO actorNpnHMO actorN?p)You carefully tuck the blue rose away. MO actorNp9MO actorNpBut that would crush it! LO actorNp~NO actorNp_One by one you pull the petals from the rose..."He loves me, he loves me not, he loves me..."oMO actorNppDMO actorN p%The blue rose is perfect as it is. MO actorN p@MO actorN* p!It is rather perfect, isn't it?MO actorNp pkMO actorN pYou gently press your !> beak lips to the blue roseJKPQ}~RSVWTU6op o pLNMO actorNpMO actorNp>  8Np)That would bring too much notice here. ZNp> -" NpIt took a surprising amount of power to create the first one. You should probably conserve your energy with a mage wandering about your lands. NpA slender dark stem claws its way above the ground. It grows delicate green spindles that fatten and unfurl into flowers amd pale threads, like gossamer spiderwebs, weave together into petals atop its heads. The petals deepen in pigment as they uncurl, as slowly the color of skies seeps into the flower and dark thorns spring forth forth from the stem. You stare down upon the blue rose. > > &" - bbbL  OOYou hang the gold chain around your neck and its ends meld cleanly together. MNM<  0NM!slender chain around his throat@NM4blue rose charm dangling upon a slender gold chainMNM<  BNM3A slender curve of a necklace can be seen around !>! Val'sthe stranger's throat. Upon closer inspection you see a small charm dangling upon the pale gold chain. Backed in gold, it appears to be the stylized image of a rose in full bloom, petals softly tinted the faintest of blues. NMyA stylized charm of a a rose in full bloom, petals softly tinted the faintest of blues, dangles upon the golden chain. MO actorNMoeMO actorNMFNow that you have it on, you have no idea how to take it off again! MO actorN~MMO actorNM<" UNMFNow that you have it on, you have no idea how to take it off again! NM)MO actorN.MMO actorNRM>   E >" NRMYou reach out and gently lift the charm up to the light. Its cool against your fingers. Val quietly waits until you release the necklace once again. NRM>   E >" zNRM0With a flutter of dark feathers you land upon !>! Val'sthe cloaked stranger'sx shoulders and peer down at the glinting charm. Its smooth and cool to your touch as you rub your head against it. \b !>! ValThe strangerh laughs. "I know it's a bright shiny thing that you like, but I'm afraid you can't have it," he says. <NRM0The necklace is smooth and cool to the touch. ,MO actorNM-MO actorN)M>   E >" N)MYou stealthily edge towards !>! Valthe cloaked strangerP, waiting for an inattentive moment to make your move. You bend over and give !>! Val'shisq tunic a good sniff. There is a faint sweetness to the metal. \b "Do I really want to know what you're doing?" !>! Valthe cloaked stranger; asks over your bent head. \b "Probably not," you reply. N)M>   E >" N)M0With a flutter of dark feathers you land upon !>! Val'sthe cloaked stranger'sA shoulders and peer down at the glinting charm. You crawl over !>! Val'sthe stranger'sN shirt and give it a good sniff. There is an odd sweetness to the metal. \b !>! ValThe strangerh laughs. "I know it's a bright shiny thing that you like, but I'm afraid you can't have it," he says. 6N)M*There is an odd sweetness to the metal. MO actorN MMO actorN> M>   E >" N> M(As you reach out to take the necklace !>! Val'sThe stranger'sk hands close around yours. For a moment you merely look at each other and then, uneasily, you back away. N> M>  E >" nN> M0With a flutter of dark feathers you land upon !>! Val'sthe cloaked stranger'sl shoulders and peer down at the glinting charm. You take it within your beak and give it a few good tugs. !>! ValThe strangerh laughs. "I know it's a bright shiny thing that you like, but I'm afraid you can't have it," he says. N> M>    eN> MVTry as you might, you cannot find the clasp to open the necklace around Val's neck. N> M)  L  88You step into the breeches and casually pull them up.   You step out of the breeches.  brown breeches, brown breeches PPAn ordinary pair of brown breeches with a belt fastened by a large iron loop. MO actorN >M MO actorN1@M>   N1AMYou skulk about !>! the magethe strangerZ circling closer and closer until finally you reach out and brush against the breeches. N1BM@They seem to be made of a good stout wool, much like your own.N1CM>   N1DM!>! Valthe stranger laughs. "Can't keep your !> claws handsn off my old rump, can you? " he teases and you feel a rush of blood to your head. You can't blush, can you? ,MO actorNBEM-MO actorNfGM>   NfHMtYou are not a dog. Going about sniffing other people's rumps will definately bring about some unwanted attention. NfJM You give !>! Val'sthe stranger's breeches a good sniff. It smells of woods and travel, of green earthy dirt and faintly a spicy perfume, and mixed in with all is the unique smell that must be !>! Valthe stranger himself. MO actorN/KMFMO actorNSMM>   E >" 8NSNMYou stride up to !>! Valthe cloaked stranger: and reach towards the loop of his belt to unbuckle it. !>! ValHe grins wickedly at you, puts his hand atop yours, and pulls you closer. You back off and suddenly decide you don't need the breeches after all. NSOM>   E >" @NSPMWith your mind you reach out towards the breeches, preparing to snatch it away with your unseen powers. And then you run up against... a barrier? Something seems to be pushing you away, if not physically than at least mentally. It seems !>! Valthe cloaked stranger came prepared. }NSQM>    SRM/With a wicked cackle you purloin Val's pants > &>NSTM)  ===L  MMYou lace up up the shirt, carefully straightening out its slashed sleeves.  88You unlace the shirt and shrug it off your shoulders.  green laced shirt {{A deep jewel green tunic that laces up the front with leather thongs. Slashes of white run up and down the long sleeves. MO actorNRMMO actorNvM>   NvM%You sneak up upon the unsuspecting !>! mage  stranger* and surreptitiously brush against him. NvM0Soft as silk but with a heavier weight to it. ,MO actorN_ M-MO actorN"M>   You stealthily edge towards !>! Valthe cloaked stranger8, waiting for an inattentive moment to make your move.N#M You give !>! Val'shis tunic a good sniff. It smells of woods and travel, of green earthy dirt and faintly of a spicy perfume, and mixed in with all is the unique smell that must be !>! Valthe stranger himself. N$M>   E >" N%M0"Do I really want to know what you're doing?" !>! Valthe cloaked stranger; asks over your bent head. \b "Probably not," you reply. N&MMO actorN(MMO actorN9*M>   =N9+MWith your mind you reach out towards the tunic, preparing to snatch it away with your unseen powers. And then you run up against... a barrier? Something seems to be pushing you away, if not physically than at least mentally. It seems !>! Valthe cloaked stranger came prepared. N9-M>    kN9.M?You loot the jewel green tunic off of the mage's prone body. > &>N90M) MMML  brown ankle boots, brown ankle boots %%You slip your feet into the boots.  $$You kick the boots off your feet. A pair of brown leather boots, ankle high, and in suspiciously good condition for being worn by a supposed traveler. While they don't precisely gleam, they are free of all scuffs and dents, with precious little travel dust on them. MO actorNdMMO actorNfM>  NgM!You stealthily skulk over near !>! Valthe stranger+, bend over, and brush against his boots.NhM3They feel like normal leather, touch and smooth. ,MO actorNiM-XMO actorNkM9You have quite gotten past your shoe sniffing festish. MO actorN0lMMO actorNTnM>  E >" NToMYou wander up to !>! Valthe cloaked strangerB crouch down and begin pulling at his boots as he blinks down at you in surprise. \b "Have you been listening too much to the old man's stories?" he asks. "And now you wish to reinact the scene where the prince wanders all over the land to find the one lady who's foot will fit within his dead mother's golden slippers? NTqM>  E >" NTrMYou squawk and flutter about !>! Val'sthe cloaked stranger'sI feet fruitlessly trying to pry his boots off. All the while the young !>!seeming mageman$ looks down at you in puzzlement. NTtM) yyy2MO quipnoN0 iKN0 i,I am quite capable of protecting myself...pN0 iProtecting me from who?JN0 iWho will protect me from you?ttMO quipnoNiK8Ni\b"I am quite capable of protecting myself," you tell the mage. \b "Aye," says Val. "I can well guess how... adept... you are at that. But even the greatest of warriors has something to fear..."PNi1\b"Protecting me from who?" you ask. "If not you?"\b Val falls silent for a moment. "This land has passed unnoticed for many a year but... I am here, and the others will come as well. If they are not here already as well. "\b "Other mages?" you say. Val does not reply, but you already know the answer. Ni\b"And who will protect me from you? " you ask. "I, my darling Snugglebums, am not the one you must worry about. " the mage replies. -2MO quipnoN0iKN0iWhat is it precisely?N0iAnd what have you learned?ZN0i/I have heard nothing good ever comes of it...vMO quipnoN"iKVN#i\b"What is it precisely?" you ask the mage. \bVal leans back his gaze drifting past you. "A leap of faith," he tells you. "The mage links his soul to that of the fey, and thereby gains some control over it." \b "That sounds rather lopsided," you reply. \b "Not precisely..." says Val. "The fey, while losing its dominion over its own lands, gains the ability to rove far and wide. And it is the fey who has the power to rescind the bond... although doing such usually kills them both." JN%i\b"And what have you learned?" you ask the mage. \b"That, like any partnership, this relationship must be entered with great discretion. A bad marriage ends in tears, a bad bonding ends in death."GN'i\b"I have heard nothing good ever comes of it," you say to the mage. \b "True, one often hears of the spectacular failures such as Delerian and his fey, but there are others out there such as Keilantra, you have heard of her, surely?"AAA2MO quipnoN0/iKsN00iWhat about your eyes...fN01iWhat about my eyes...BN02iI like to eat eyes...YMO quipnoN5iKN6i\b"What the hell is wrong with your eyes?" you say to the mage. \b "Hmm?" Val replies. \b "They keep changing colors!" you say, tone half accusation.\b "Do they?" says Val. "It must be you imagination," he says as he winks and his eyes slide from blue to green. N8i\b"What about my eyes?" you ask the mage and then slightly flush as he stares at your face for a precious few moments. \b "Very pretty," Val says. "But the gold could be polished more."N:iN;i\b"I like to eat eyeballs!" you proudly declare as Val stares at you. \b "Umm... that's... nice...?" says Val as he carefully back away from you. %444bM A little fluffy fuzzball of a creature with a bob of a tail and a delicate pale pink nose and tummy. Upon its forehead grows a pearly nub of a spiral horn. It is a... unicorn?MO actorN&nMO actorN(n>You summon forth a unicorn and a beam of light shines down from the heavens. Motes shimmer and glow, slowly coalescing into a shape... hooves, tail, the flaxen of a mane. And then the light sputters out and you behold the fluffy white fuzzball in front of you, pink nose twitching as it bleats happily. A unicorn...?> >&N)n> > E >" NN*n:\b Val gazes down upon the creature in some perplexity. "-N+n>  E >  E >" N,nVal's chant stumbles to a halt as he gazes down upon the little unicorn that has suddenly appeared before him. "What is that?" Val's tone is half puzzled. You draw yourself up in affront.\b"-)MN-n> <h **\bThe unicorn ambles happily after Val. i $$\bThe unicorn trundles after Val. MO actorN`3nMO actorN4n.The unicorn bleats happily as you wrap your !> wings arms around it. Squeezably soft. MO actorN6nEMO actorN<7n&The unicorn already belongs to you. LMO actorN9nNMO actorN:nqTheir is no need to attack your own creation. Especially something as fluffy and innocent as this shee-unicorn.MO actorNAthat much.MO actorN+ NngMO actorNO OnHYou coo affectionately at the unicorn as it rubs its head against you.MO actorN Qn^MO actorN Rn?The unicorn bleats happily as you sing a soft lullabye to it.TUJKRLSNLN LN[L\NPLQNLNMO quipnoN ]nKN ^n*You fool, can't you recognize a unicorn?N _nTis a...unicorn, I believe...N `nTis a unicorn, of course...UN an#A dragon! What does it look like?%"BrMO quipnoN dnKN enN gn:\b"You fool!" you tell the mage peremptorily. "Are you too blind to not recognize a unicorn when you see one?" \b Val stares at you and then back at the little white fluffball. "A... unicorn?" he says. When you deign to nod your head at him in affirmation he bursts out into laughter.\b "A unicorn!" Val exclaims and clutches at his sides. Meanwhile the aforementioned unicorn wags its tail and ambles up happily to the mage. This causes him to laugh even harder. A gust of wind blows up a swirl of red dust and Val begins to choke as much as laugh, much to your approval.\b "A unicorn," Val finally wheezes as leans over and pets it head. "Well, shall we be off, Lord Unicorn?" asks Val and when the shee-unicorn baas in agreement, the mage, still chuckling to himself, walks back under the red arch and away to the north. >>##N hnC) N jnN rn\b"Tis a..." for a moment you hesitate and then finally admit, "...a unicorn."\b Val blinks back at you. "A unicorn?" he repeats and you nod your head in affirmation. "A unicorn!" he says and looks down upon the fuzzy white creature in front of him.\b "A unicorn!" and he bursts into peals of laughter. \bThe unicorn bleats in excitement and wags it tail. You glare witheringly at the at the mirth filled mage, which makes him laugh even harder. A gust of wind stirs up a swirl of red dust which Val sucks in and begins choking upon. Serves him right. \b "A unicorn," says Val as he wipes at his eyes. \b "Yes," you reply with an edge to your voice. "So you have said. Repeatedly."\b "Tis just... a wee bit smaller than I was expecting. And fluffier." says Val. \b "Well," you say airily. "Mortals hardly know what a true magical creature loo--" and your words are cut off as Val begins laughing and choking again. \b "Oh gods, we need to get out of here," says Val as he crouches down next to the unicorn. "What do you say, my little unicorn? Shall we leave this place?" And the shee-unicorn baas in agreement. \b And so the mage sets off for the north, still chuckling to himself, and wandering back underneath the red arch with the little unicorn in tow. >>##N snC)N unN wnb\b"Tis a unicorn of course!" you say emphatically. \b "A unicorn?" repeats Val. "Yes," you reply. "You can see the spiral horn upon its forehead--" and your words are cut off by the pealing laughter of the mage. "A unicorn!" he exclaims and bursts into another fresh bout of laughs. "Oh, how mighty thy beast... with coat of sterling white... stars in thine eyes and upon thy brow... sword of... sword of... of li--" and the mage cannot finish the poem he is quoting. You glare witheringly at the mage, which causes him to laugh all the harder. \b A gust of wind kicks up swirls of red dust and Val begins to choke. Serves him right. \b "Oh gods," says Val. "We need to leave this place. Isn't that right, my little unicorn?" he coos at the fluffy creature, who baas in agreement. And still chuckling to himself, Val walks under the red arch and off to the north. >>##N xnC)N znN {n\b"Tis a dragon!" you snap at the mage. "What does it look like? Tis a unicorn of course!"\b Val blinks at you and then down at the white fluffy creature standing before him. "A unicorn?" he says. "Are you certain?" And when you nod your head ina affirmation, he bursts into laughter. "A unicorn!" he exclaims. \b Meanwhile the aforementioned unicorn wags its tail and ambles up happily to the mage. This causes him to laugh even harder. A gust of wind blows up a swirl of red dust and Val begins to choke as much as laugh. Serves him right.\b "A unicorn," Val finally wheezes as leans over and pets it head. "Well, shall we be off, Lord Unicorn?" asks Val and when the shee-unicorn baas in agreement, the mage, still chuckling to himself, walks back under the red arch and away to the north. >.C)"ce D Val5#MOactorioN%&J_MOactorioNN(J>  D >  oNN)J`Attack him directly in front of everyone else? Perhaps you would be better to bide your time. NN+Jm E >mm" NN,Jՠ<KNN-JYou heft the heavy frying pan within your hand and then swinging it in a graceful arch to knock Val upside his head. The mage turns and stares at you as if you've gone daft. >##" NN/J"Behold the Frying Pan of Doom!" you trumpet as you once again brain Val with the aforementioned skillet. The mage staggers slightly beneath the blow and favors you with a withering glare. >##ANN1JAgain you approach the mage with the frying pan held ready within your hands. But this time Val is prepared and he snatches the thing from your hands and whacks you upside the head. "Now it's the Frying Pan of Doom!" he announces as he waves it around."mm>m&C%NN3Jm E >mm" BNN4J3You've had enough fun with the frying pan today. -NN6J&" E m NN7Jա<KNN8J7Without a sound you launch yourself towards the mage ! i thrust ahead of you. Val shifts away in a blur of darkness and you pass through thin air, the side of ! | scratching at the mage's cheek. \b Val wipes away the trail of red from his face. "What are you doing?" he barks at you. NN:J>##:NN##%NN?J.For the third time you attack the mage with ! &. And the last thing you see is his !>k @w eyes gazing down sadly at you before...\n ...the world...\n ...slipping\n away... \b You have been consumed by Val. NNDJ^NNGJAVal gives you strange looks as you fruitlessly attack him with ! .#D$MOvantageN!H""MO actorNE"H"]#MOactorioNm$H^MOactorioN&H>  E >  N'HCN(H> > 7N)H(That would require for Val to be here.zN+H>A fit of insanity almost has you babbling your true name to !>! the magethe stranger.`_ba(  L   !!slender chain around his throat  A slender curve of a necklace can be seen around Val's throat. Upon closer inspection you see a small charm dangling upon the pale gold chain. Backed in gold, it appears to be the stylized image of a rose in full bloom, petals softly tinted the faintest of blues. MO actorN^MOMO actorNM0The necklace is smooth and cool to the touch. ,MO actorNM-IMO actorNM*There is an odd sweetness to the metal. MO actorNJMuMO actorNnMVTry as you might, you cannot find the clasp to open the necklace around Val's neck. @%%%%bM bird 55The dark shape of a bird of undeterminable species.MO actorNbns!MO actorNn> m NntYou think of feathers, of sharp bills, and arching wings and swans suddenly appear upon the lake. Eight pure white swans with golden bills and one of ebony with break of crimson red. They float elegantly upon the waters of the lake, sasshaying and fluttering around each other in an elegant dance before, all at once, they sweep into the skies and fly off to the south. >Nn> > E >  E >  E >  E >  NnYou think of feathers, of sharp beaks, and arching wings and a flock of birds passes high overhead, as free as any of your creations can be. UNn>  E >  E >v" 'NnYou think of feathers, of sharp bills, and arching wings and summon forth a bird. It bursts away from you in a flurry of shadowed feathers, now seeming blue in the light, then red, or even purple, colors and outline shimmering faintly.\b The bird wheels about in the sky and with a wordless cry it swoops down upon the mage. Val draws back but the bird extends its talons and snatches the silver flute right of his hands. The mage whirls about, following the path of the bird as it ascends once again into the heavens.\b Val thrusts out his right hand and the bird screams again, flickering feathers falling down from its struggling body. Yet it continues on its way, up and away, and disappears from sight. \b Val tsks softly. "Stole my flute. That was rather expensive to make too," he says Nn>  E >  E >" E >v" VNn.\b"No great loss," you inform the mage. "Your flute playing was hideous anyway." \b "Is that so?" says Val as his lips quirk. "Well then, we'd best find another way to entertain ourselves." The dark cloak of the mage flares around his figure as he turns about to heads to the north. !>&>>&!"vNn>  E >  E >" E >v" Nnjand shrugs. The dark cloak of the mage flares around his figure as he turns about to head to the north. !>&>>&!"vNn>  E >  GNn8You think of feathers, of sharp bills, and arching wings and summon forth a bird. It descends from the sky in a flurry of shimmering feathers, now seeming lean like a hawk, or brightly plumes like a parrot, of fluttering lightly like a hummingbird.\b The bird swoops down, rushes past the crouching mage, and flies up into the branches of the dark metal trees. It then crashes head first into a clear pane of glass and falls to the ground with a muffled thump, whereupon its body breaks apart into flits of darkness and dissolves away.\b Not your smartest creation. Nn>  D >  D >  D >  D$>  E >  E >v" nNn9You think of feathers, of sharp bills, and arching wings and summon forth a bird to claw and peck away at the intruding sutras. A red-headed woodpecker swoops down from the pale branches and begins diligently pecking at the papers, one by one, tree by tree he goes until the all fall away to scraps upon the forest floor.\b The woodpecker circles overhead, once, twice, thrice and then it flies over Val, leaving behind a present of thick, chunky liquid upon the mage's left shoulder. You hadn't commanded the bird to do that... yet the look on Val's face...\b!>&"o"vC)Nn>  E >  NnYou think of feathers, of sharp bills, and arching wings and a trio of birds appears high in the sky, circling around the hills. Around and around they circle, not being any particular detriment to Val's chanting, around and around and around, looking more and more like buzzard's with each pass. \b With a sigh you turn away from the birds, allowing them to fly away or dissolve away or something away, you do not particular care at the moment with the song pounding into your head. Nn>  E >  NnYou think of feathers, of sharp bills, and arching wings and a flock of colorful birds descends upon the fountain. They are blue jays and cardinals and storks, blackbirds and cranes and honking geese, toucans and hawks and chickens, all different birds, some of them natural enemies, all squawking and pecking and fluttering about the sprinkles of the fountain. Creating quite a racket yet not deterring the mage in the least.\b "Oh, go away," you tell the birds when one particularly bold one starts croaking on your ear. The birds pause for a moment to stare at you and then all at once, in exodus the take to the skies and fly off. \b "At least they didn't leave behind any presents," Val mumbles to himself as he continues with his digging. ~Nn>  E >  )NnYou think of feathers, of sharp beaks, and arching wings and a bird of prey bursts free of you, sharpened talons outstretched as it dives straight for Val. The mage raises his hands before him and the bird breaks apart into water foam that falls upon the lake. >4 Nn>   E >    MNn6In desperation you summon forth a flock of birds with sharpened beaks and razors upon their legs. With shrill raucous cries they descend upon the mage and seek to tear him limb from limb. Within arms reach of Lorekosi they scream and explode into bits of smokey char that fall upon the grasses of the plain. "  Nn>  E >  nNnQYou think of feathers, of sharp beaks, and arching wings and a flock of birds descends upon your companions in a flurry of claws, talons, and shrieking beaks. The birds are little yet fast, flitting hither and thither, scratching and pecking at all, even a few bothering to fuss with you lest you feel left out. \b "Great gods!" yells !> "It's the horde of flesh-eaters! The fey has sent down--" and the old man's words cut off as he the tavern door slams shut behind him. \b With a great chirp from a hundred throats, the birds rise into the air as one, ascend high into the sky, and disappear into the horizon. Silence descends upon the courtyard and for a moment you think you have miscalculated and scared them all away at once. Yet here is !> and Val, coming out from the shelter of the stable.\b "Was that really the horde of flesh-eaters?" asks the maiden with a shiver as she straightens her clothes. \b "If it was, then that was the mildest horde I've ever seen. " says Val. "Although our friend !>8 does not seem to agree. I doubt he'll be returning." Nn>7Nn>  E >  E >  E >v" Nn?You think of feathers, of sharp beaks, and arching wings and a flock of birds descends upon your companions in a flurry of claws, talons, and shrieking beaks. The birds are little yet fast, flitting hither and thither, scratching and pecking at all, even a few bothering to fuss with you lest you feel left out. \b \^!> screams as she stands in the center of the courtyard, flailing around at the biting birds all about her. Val pushes his way through the frenzies flock to the young maiden's side, and suddenly the birds are pushed back, fingerswide by fingerswidth, away from !> and Val. \b The birds grow ever more frenetic as they fling themselves open the invisible barrier between them and their prey. A barrier... and you turn your attention upon the cloaked stranger and command the birds to go away. \b Silence. And then the ragged breaths of !>. "What was that?" she gasps. "They were attacking and then... and then..." she looks towards her rescuer. "You drove them away... away with..." and then the color drains from her face. He is, he could only be... "...a mage," says !>T as she draws back.\b "I do know a bit of magic," Val admits.\b "A mage," murmurs !>. "Come here for the fey. Nay, nay... I will not be a part of this. Thank you for that... but..." And the maiden hurriedly tugs her clothes straight and reaches out for the tavern door. "I won't be a part of that..." and she is gone. \b "More afraid of me then of the fey," Val says.\b "Sensible to me," you say. "I am more afraid of you than of any fey as well."\b "And yet you are not running for the tavern door," says Val. "Shall we be off then?" and the mage pulls the satchel upon his back and sets off for the northwest. Nn>>>&!""v()MNn(<(KNnaVal curses long and loudly as he holds the shoulder of his cloak and tunic away from his body. >aNnYThe mage continues to curse as he brushes at the white stuff leaking into his clothes. Nn.Val shakes his cloak, muttering to himself. NnhFor a moment the mage glares accusingly towards you before turning his attention back to his clothes. KNnfWith a last flick of his fingers, the 'present' from the woodpecker dissolves away without a trace. Nn"I suppose that should be taken an invitation to leave," Val says as he begins to make his way out of the forest to the east. >!C)0Y)]7W W W   silver pinMNL%A plain unadorned pin used to hold !>! Val'sthe stranger's% cloak closed. Its not even sharp. MO actorBMO actorNM#A cool, blunt splinter of metal. ,MO actorN#M-#MO actorNGM>  NGM>That would require for you to come to a closer proximity to !>! Valthe cloaked stranger than you'd like. kNGM+A faint smell of woods, a faint smell of !>! Valthe cloaked stranger. MO actorNpMMO actorN M>  E >  BN MYou reach out and put your !> claws hand upon !>! Val'sthe cloaked stranger's chest. !>! ValThe cloaked stranger' reaches back and puts his hand atop !> your head. yours.1 You decide that there's easier pins to filch. 0N M$You take the pin from Val's cloak.>& ,,MO listOcnttotiobjjNxNxNx@Nx+mO scNx6Nx/Nx@NxNxNxINxppMO list O5icounttotcurdisptot prefix_countNxNxNxNxNx@NxNx+Obeforeafter j scNx6 Nx  _Nx @>Nx NxNxNx Nx NxNxNx 4NxNx,   and Nx  ,(Nx NxNx* a   E foo  La foo!`MOactorioN3N<SNARF! This is where the eating description in FEEDTO goes)MOactorioN!NFI!%MO actorN"NFOO!MOactordobjN$N" ?N%N0Maybe when you're in a more masochistic mood. N'N!y#MOactorioN}(N4MOactorioN*N  FOO!tqqqD?MO actorN%y1MO actorN=&yAs amusing as it would be to start flinging the tavern people to all and sunder, that would really give away the game, wouldn't it? No way could the humans delude themselves into thinking they were outside the power of the few if they were yanked through space at a whim. R R RL 44You allow the cloak to settle over your shoulder.  **You sweep the cloak off your shoulders.   pale cloak%MNPA long pale cloak, perhaps white tinted with a trace of gray or perhaps a cream color that has turned brown with age, and wrinkled entirely along its length. It covers !>] from the soles of her feet to the tips of her shoulders as she clutches it about herself. MO actor@MO actorNP!Musty and rough with wrinkles. ,MO actorN'P-CMO actorNKP$It smells of must and old perfume.MO actorNPMO actorNPxIt would draw too much attention to take that here. Besides you can't fathom what you would do with the thing anyway. D2MO quipnoN0CiKN0DiIdle curiosity...N0Ei.I should like to perfect my kisses on you...\N0Fi1You look like someone well versed in kissing...fMO quipnoNIiKyNJiO\b"Idle curiosity," you say. "You should not idly wonder about such things!" !> says, still blushing.NLiD\b"I should like to perfect my kisses on you," you say suavely. \^!>c blushes an even darker red. "To-- to say such things!" she sputters. "You are too presumptious!"NNie\b"You look like someone well versed in kissing," you say. \b "And what is that supposed to mean?" !># demands as her blush deepens. \b5 9 9 9 L|  44You allow the cloak to settle over your shoulder.  **You sweep the cloak off your shoulders.  dark gray cloak A dark gray cloak of a thick good wool, well brushed yet still showing faint signs of the wear and tear of the road. Faint brown smudges stain its trailing hem while its deep hood shows some discoloration due to moisture. MO actorNOXMO actorNO9The cloak is thick and stout, a good quality for wool. ,MO actorNO-yMO actorN:O You give !>B's cloak a surrepticious sniff. It smells of rain and road dust.MO actorNOYMO actorNO<  E >  NOHWith your mind you reach out and begin to snatch away the grey cloak. !>_'s eyes widen as she feels the material being pulled away from her. Val strides forward and makes a motion towards the cloak. For a moment it hangs there in midair, rippling as it is pulled in two directions, and then with a final shimmer it disappears.\b And reappears bundled up with your own clothes. But they wouldn't realize that.\b "The fey!" !> exclaims. "It really is stealing clothes! The cloak and you..." her words trail away as she looks at Val. "You were fighting with it over the cloak. And you..."\b Val's eyelashes lower as he waits calmly for the maiden to finish with her words.\b "That makes you a mage, doesn't it?" she finishes quietly. "Thank you for... what you were trying to do, but if it's all the same... I would rather not go along on this 'hunt' with you." she says in a rush. "And I would rather keep my clothes on my body as well," she continues and then gives a curt nod to you both. And with that she quickly strides back into the tavern. "She was more afraid of me than of the fey, it seems," says Val quietly.\b "That makes perfect sense to me," you reply. "I am more afraid of you than of any fey as well." \b "I am not so fearful as all that." says Val. "I don't bite... that badly." And with that he hefts his satchel upon his back and sets off for the northwest. NP>&>>>&!"fNP<  E >  9NP*That would draw too much attention here.N P)! ? ? ? L|  33You pull the shirt over your head and lace it up. 88You unlace the shirt and shrug it off your shoulders.  gray peasant shirt A middling gray shirt with puffy shoulders and long slit sleeves. Tight black lacings run crisscross the front from neck to navel. MO actorNIPMO actorNmPvSurrepticiously you brush your fingers across the shoulders of the shirt. The material is smooth, if a bit starchy. ,MO actorNP-MO actorN,PdIt smells of roses and clean water and intermingled with it the scent that must be the essence of !> herself.MO actorNPKMO actorNP<  E >  N PHWith your mind you reach out and begin to snatch away the grey shirt. !>|'s yelps and clutches the shirt to herself as she feels the material being pulled away from her. Val strides forward and makes a motion towards the shirt. For a moment it hangs there in midair, rippling as it is pulled in two directions, and then with a final shimmer it disappears.\b And reappears bundled up with your own clothes. But they wouldn't realize that.\b "The fey!" !> exclaims. "It really is stealing clothes! The shirt and you..." her words trail away as she looks at Val. "You were fighting with it over the shirt. And you..." Val's eyelashes lower as he waits calmly for the maiden to finish with her words.\b "That makes you a mage, doesn't it?" she finishes quietly. "Thank you for... what you were trying to do, but if it's all the same... I would rather not go along on this 'hunt' with you." she says in a rush and then seems to realize she is standing outside with no shirt."Oh gods!" she yelps and makes a beeline for the tavern door. "She was more afraid of me than of the fey, it seems," says Val quietly.\b "That makes perfect sense to me," you reply. "I am more afraid of you than of any fey as well." \b "I am not so fearful as all that." says Val. "I don't bite... that badly." And with that he hefts his satchel upon his back and sets off for the northwest. N.P>!&>>>&!"fN/P<  E >  9N0P*That would draw too much attention here.N2P)" * * * L|  <<You step into the skirt and pull it up around your waist.  ++You pull down and step out of the skirt.  divided blue skirt A dark blue skirt properly divided for riding or for traveling. It falls in elegant folds nearly down to the ground while several lengths of loose material are meant to be wrapped snugly around the waist.MO actorN@PHMO actorNAP)Soft... a good quality of beaten linen.,MO actorNBP-QMO actorN$DPYou abstain of smelling !> 's skirt.MO actorN{EPMO actorNGP<  E >  NHPMWith your mind you reach out and begin to snatch away the dark blue skirt. !>T looks down in disbelief as the material is pulled away. Val strides forward and makes a motion towards the skirt. For a moment it hangs there in midair, rippling as it is pulled in two directions, and then with a final shimmer it disappears.\b And reappears bundled up with your own clothes. But they wouldn't realize that.\b "The fey!" !> exclaims. "It really is stealing clothes! The skirt and you..." her words trail away as she looks at Val. "You were fighting with it over the skirt. And you..." Val's eyelashes lower as he waits calmly for the maiden to finish with her words.\b "That makes you a mage, doesn't it?" she finishes quietly. "Thank you for... what you were trying to do, but if it's all the same... I would rather not go along on this 'hunt' with you." she says in a rush and then seems to realize she is standing outside with no skirt."Oh gods!" she shrieks and blushes bright red from head to foot. "Don't look at me!" she shouts over her shoulder as she makes a beeline for the tavern door. "She was more afraid of me than of the fey, it seems," says Val quietly.\b "That makes perfect sense to me," you reply. "I am more afraid of you than of any fey as well." \b "I am not so fearful as all that." says Val. "I don't bite... that badly." And with that he hefts his satchel upon his back and sets off for the northwest. NVP>"&>>>&!"fNWP<  E >  9NXP*That would draw too much attention here.NZP)#8 L|   brown boots,  brown boots Dainty little ankle bootlets with black trim. Thoroughly covered in road dust with their heels well worn down, yet you can still identify their quality.MO actorNgP2MO actorNiPSmooth and tough.,MO actorNOjP-XMO actorNslP9You have quite gotten past your shoe sniffing festish. MO actorNmPnPMO actorNoP1Alas, they are too small to fit upon your feet.MO actorNKpPoMO actorNorP<  E >  NosPSWith your mind you reach out and begin to snatch away the brown boots right from !> 's feet. !>Z's eyes widen as she feels the shoes being wrested from her. Val strides forward and makes a motion towards her feet. For a moment they hang there in midair, rippling as they is pulled in two directions, and then with a final shimmer they disappear.\b And reappear bundled up with your own clothes. But they wouldn't realize that.\b "The fey!" !> exclaims. "It really is stealing clothes! The shoes and you..." her words trail away as she looks at Val. "You were fighting with it over them. And you..." Val's eyelashes lower as he waits calmly for the maiden to finish with her words.\b "That makes you a mage, doesn't it?" she finishes quietly. "Thank you for... what you were trying to do, but if it's all the same... I would rather not go along on this 'hunt' with you." she says in a rush. "And I would rather keep my clothes on my body as well," she continues and then gives a curt nod to you both. And with that she quickly strides back into the tavern. "She was more afraid of me than of the fey, it seems," says Val quietly.\b "That makes perfect sense to me," you reply. "I am more afraid of you than of any fey as well." \b "I am not so fearful as all that." says Val. "I don't bite... that badly." And with that he hefts his satchel upon his back and sets off for the northwest. NoP>#&>>>&!"fNoP<  E >  9NoP*That would draw too much attention here.NoP)$  |  stout walking staff A stout walking staff, high as your shoulder in human form, formed from golden wood. Its top is curved and carved to resemble a stalk of wheat in full bloom. MO actorNP ""Smooth in between its carvings. ,MO actorN4P-LMO actorNXP-It smells of wood and faintly of road dust.MO actorNP<  E >  ZNPAWith your mind you reach out and snatch the staff away unseen. >$&fNP<  E >  9NP*That would draw too much attention here.NP)%   L|  silver bracelet UUA silver bracelet, a fingerswidth thick, formed of shimmering interlocking squares.MO actorNPMO actorNPYou brush your !>talons  fingerse across the bracelet to find it rough anf pockmarked with carvings and facets that catch the light.,MO actorNP-7MO actorNPA faint metallic tang.MO actorNP<  E >  ]NPDWith your mind you reach out and snatch the bracelet away unseen. >%&fNP<  E >  9NP*That would draw too much attention here.NP)&l,,,Lr|  11You hoist the traveling pack upon your shoulder 66You allow the traveling pack to slip from your arms. traveling pack __A brown traveling pack made of thickly waxed material, squarish in shape with double straps. MO actorN!PvMO actorNEPWThe material is thick and waxy, all the better to protect its contents from the rain.,MO actorNP-CMO actorNP$It smells of travel dust and rain.MO actorN.P<  E >  cN.PJWith your mind you reach out and snatch the traveling pack away unseen. >&&fN.P<  E >  9N.P*That would draw too much attention here.N.P)'  L| & sapphire haircap AAWith some effort you manage to cram the haircap upon your head. You shake off the haircap. A lady's haircap, velvety and stiffened, formfitting to a maiden's scalp. Rounded in the back with a tightly pointed front that should lie between the eyes. It is a lovely sapphire color but is otherwise unadorned. MO actorNPrMO actorNPSIt surface is soft and velvety yet it seems to have boning within its structure. ,MO actorN#P-CMO actorNGP$It smells strongly of dried roses.(P>=N=N=D{MO actorNRMO actorN=R>" N=RYou flutter atop !>c shoulder, fluff your feathers, and begin cooing up a storm. "The old crow is in love!" exclaims !>F.N=R>" N=RP"Isn't he the cuddliest wuddliest snuggly wuggly little man ever?" you coo at !> as he gapes up at you. N=R>" E >  ON=R2"Did you slip him something in his drink?" asks !>. }MO actorNRMO actorN2R\^!>J bursts into choking laughter as you reach out and tickle him with your !> feathers  fingers.N2R>" \N2R@"Careful there, don't want to give him a heartattack..." says !>F.~MO actorNGR!MO actorNkRYou watch as !>Fl's head bobs and lowers under your influence. As your attention strays the old man wakes up with a snort. (MO actorNR)MO actorN<R>" xN<RiYou flip and swirl about the old man, dancing elegantly through the air as he ineffectual bats at you. DN<R>" E >  N<RYou sashay over to !>N, bow and show a leg, and then offer your hand to him. "A dance?" says the old man. "Don't mind of I do!" He grabs hold of your hands and off you go, whirling across the wooden floorboards. \b "Lords," says the tavern maid as she edges around you two. "When I think of dancing, that's not the couple the couple that comes to mind. "N<R>" E >  N<SYou sashay over to !>., bow and show a leg, and then offer your hand to him. \A dance, before we start off?" says the old man. "Don't mind of I do!" He grabs hold of your hands and off you go, spinning and strutting around the courtyard, barely avoiding crashing into the apple barrel and horse trough, all the while with !> and Val gaping after you. MO actorN#S2MO actorNGS>" NGSYou whistle sharply at !>L. He glances at you for a moment before turning back to his conversation. NGS>" xNGSYou whistle at !>N who grins widely, flourishly his cloak, and spins about for your approval. MO actorN SUMO actorN S>" N S""KAK KAK KAK COA!" you laugh at !>0. \b "Even the daft bird is laughing at you!" !>F exclaims. N S>" N S\^!>Fx looks at you in confusion and then decides to take your laughter as a compliment. "Glad y' liked my story!" he says. oMO actorN SpMO actorN" SaHe is not one of your creations and would probably not appreciate the efforts to 'better' him. MO actorN S5MO actorN SAs a friend perhaps?3MO actorN S2jMO actorN+ SThat is something that !>% will have to achieve for himself.LMO actorN SKMO actorN S>" IN S*"kah kak kak coa coa" you say softly to !>.CN S'"Eh? What's that you say, lad?" says !>.MO actorNv SMO actorN !S You give !>O a good shake. He lifts his head with a snort. "Eh? Did I nod off for a bit?"MO actorN&#SMO actorNJ%S>" 3NJ&S$"KRAWK!" you curse. "KAK KAK COA!"NJ'S>  E >" E >" oNJ)SpYou begin cursing up a blue storm. Several of the tavern patrons glance at you warily.\b "Good gods," mutters !>F8. "What did you do now?" \b "I am innocent!" exclaims !>* "As innocent as a little baby goat!" \^!>F\ raises an eyebrow at his friend. \b "Very well, as innocent as a wizened old goat," says !>. NJ+S/MO actorNL-S.MO actorNp.SYou hear the wheeze of !>e's breath, the intermittent rumblings of his stomach, and the creak of wood as he shifts position. ,MO actorN 1S-MO actorND2S3You lean close and take a surrepticious sniff. \^!>O smells of tilled earth, old perfume, and heavily of the scent of pipe smoke.TMO actorN4SSMO actorN6S>" EN7S6Alas, any apologies in this form would go unnoticed.xN9S7You excuse yourself. "Eh, nothing to apologize for," !>( says and negligently waves his hand. MO actorNS>" N(?SYou flap up to !>'s shoulder, nestle up to his neck, and pepper his head and throat with soft pecks. \b "It's trying to get a good taste of you!" says !>F% with a laugh. \b "Ha ha ha," says !>% without one as he shoos you away. JN(AS>" E >  E<>" bN(BSYou walk up behind !>, lean over him, and tap him on the shoulder. As he looks up at you in question, you catch his lips with yours, to a volley of gasps resounding around the room. A scratchy kiss, with a definate aftertaste of pipe smoke to it. \b \^!> blinks up at you as you draw away, blinks again, and then breaks out into cackles. "If only I were twenty years younger," he tells you.\b "Lords," says !>FQ. "Too much drinking going on in this room," \b "Do you two need a room?" says !>) as she holds a hand before her face. N(DS">N(ES>" E >  E<>" UN(FS"You decide that you have teased !> enough for one day. CN(HS>  -N(JSYou walk over to the old man hunched over the apple barrel and tap him on the shoulder. He turns to you and, without any preliminaries, you proceed to kiss the breath right out of him.\b "Ack!" says !>K as she goggles at the two of you. \b "Now I'm truly jealous!" says Val. MO actorNLSMO actorNMSHe's a bit on the old and scraggly side for your tastes... but if that's what you truly want, you can always come back later. @MO actorN}OSaMO actorNQS>  E >" NRSYou stride up to !>l and begin pulling at his cloak. "Easy there, lad," says the old man. "Your cloak is far finer than mine. \NSS>" NTSYou flutter up to !> and begin pulling at his cloak. "Easy there, birdie," says the old man. "Y' can't have my clothes for your nest, I'm afraid. NVS>  NXSFWith an inwardly wicked cackle you reach out with your mind and snatch all the clothes off of the old man. A high pitched shriek launches through the air, whether from the blushing maiden or from the equally blushing old man you are not quite certain, as everyone gains quite an eyeball of wrinkled sun-burnt skin. \b Then with a yelp the old man dashes inside the tavern once more and a great crashing of cutlery, squealing, and gasping can be heard from within. \b "Well," says Val. "Well..." and he seems quite speechless for once. \b "The fey really does steal clothes!" says !>% as she clutches her own about her.")&>!"")MO actorNZScMO actorN,[SDHow uncouth! You might get far better results in a different form.MO actorN]SMO actorN_S>" lN`S]Alas, bird beaks are not quite capable of making that noise. You croak menacingly instead. YNbSYou growl menacingly at !>& who looks back at you in confusion.MO actorNdSO MO actorNfS>  E >" E >"  NgSJYou take your leave of the tavern patrons. The two old men wave at you, !> tilts her head above her drink, and the drunkard continues to snore away atop his table. \b "Come again any time!" the tavern maid calls out as she bustles past. NiS>  VNjS7"Not backing out of the treasure hunt, are y'?" asks !>.YNkS>" ENlS)"KAK KAK KAW KAW!" you saw farewell to !>.MO actorN!oS&MO actorN"qS>  <N"rS-That is usually reserved for dead mortals. N"sS>  E >" N"SAt your command the earth trembles and shakes all about you. Layna squawks in dismay-- or maybe its the Old Coot-- as pebble skips about the courtyard, the barrel and water trough rattle and vibrate within their bases, and Val stands perfectly steady gazing up at the heavens. \b Finally the earth stills and your companions grab at anything for support. Well, not quite all of them. \b "Good gods," gasps the Old Coot. "What was that?" \b "Is that normal? Are there earthquakes here?" Layna asks. \b "None that I ever remember!" replies the old man as he clutches at the wall of the tavern as if expecting the earth to spin away at any moment. \b "Did you notice," Val muses softly, "that the tavern wasn't shaking? Not at all. And--" \b "That's all I be needin' to hear!" says Old Coot as he beelines for the tavern door. \b "And neither was the stables," finishes Val, a touch of amusement to his voice. "The horses were not disturbed at all. " And indeed, if you listen carefully you can still hear their quiet nickering to each other.\b Layna heaves a sigh. "So, twas the fey after all" she sighs and shivers. And then looks suspiciously about her. >&"gMO actorN.'SQMO actorNR'S>" NR'SYou draw in a deep breath and release it in a sudden gasp. /^Layna tilts her head towards you in curiosity. \b "That old scoundrel didn't pinch your rump, did he?" she asks. "He's been doing the same to everyone all day."wMO actorNj(SMO actorN(S>  E >" N(SYou !> perchsit] in stillness, eyes demurely cast down, not a single twitch of a muscle nor a flutter of a !> feather cloak9 to bring a bit of attention to you. And yet you sense !>" fascinated gaze pinned to you. 3N(S>  N(SYou !> perch stand] in stillness, eyes demurely cast down, not a single twitch of a muscle nor a flutter of a !> feather cloak9 to bring a bit of attention to you. And yet you sense !>" fascinated gaze pinned to you. xMO actorN+SMO actorN;+S>" N;+S""KAK KAK KRAK COA!" you sing to !>*. \b "The bird is trying to deafen us!" !>F complains. \b "Eh?" says !>. N;+SYou !<@ to !>z. He laughs and claps his hands, joining in on a verse or two. "You finally found someone who can sing worse than you!" !>F- says, you are unsure to which one of you. sing a little ditty lilt out a love songcroon a soft lullabye chant an ancient lament !warble out a high pitched tune %sing about a bird in a gilded cage MO actorN-SUaMO actorN-S"I think you're boring him," !>F with half a laugh. MO actorN/.S#sMO actorNS.S>" =NS.S.Alas, bird beaks were nod made for barking. NS.S>" E >  E >" NS.SCYou carefully stand up, brush yourself off, and begin barking at !>V. The other tavern denizens pause to stare at you. \b "He's gone barkin' mad!" says !>' as he slaps his thigh in merriment. MO actorN/SWMO actorN/S>" N/S*"KAK KAK COA COA KRAW!" you complain to !>$. \b "This bird is deafening me." !> complains back. N/S You pour out all your woes to !>^, or the ones safe to tell a human, at least. "You think you have it hard, young lad?" asks !>;. "Try livin' to my age! More things don't work than do!"MO actorN1SbHMO actorN1S)He's quite capable of feeding himself. MO actorN1SMOactordobjN2S" wN2S%"No thanks, not that hungry," says !>6. "Don't reckon I ever been that hungry in my life."AN2S%"No thanks, not that hungry," says !>.MO actorN3SY;MO actorN'3S>" BN'3S3You flutter your wings together in appreciation. N'3S You give !> a rousing round of applause as he takes a small bow. \b "See? My stories are appreciated! " he says with a wink. \b "Oh don't encourage him, " says !>F. N'3SMO actorNh4S CMO actorN4SYou disagree with !>.MO actorN4S[CMO actorN4SYou disagree with !>.MO actorNB5SMO actorNf5S>  %Nf5SYou fully intend to!;Nf5S/You played with him so much that he ran away!yMO actorN5S MO actorN6S>" N6SYou flutter atop !>'s head and fuss about with his hair until he shoos you away. "My apologies, bird," he says, "but you're not allowed to build a nest up there!"hN6S>" TN6SYou lean next to !>(and run your fingers through his hair.N6S>" E >  N6S\b"Careful there," warns !>FX "You may lose a finger or two or even the whole hand if you stick it in that mess!"\bN6S>" N6SVWith a few defts twist you plait a little braid to hang near his cheek. "Heh," says !>. "Look at me, all done up like a rich lord!"N6S>" E >  9N6S\b"Or a pretty girl," says !>F."MO actorN'9SMO actorNK9S>"  NK9S."KRAK KRAK KAW!!!" you screech right within !>]'s ear. \b "Ack! I'm deaf!" he wails as he swats at you. \b "You was deaf before!" replies !>F$. \b "Eh? What did you say?" says !>( loudly as he whacks at his own ears. NK9SYou give a loud squawk. \^!> and !>FZ gaze at you in puzzlement. \b "Did the beans finally make their way through ye? " says !>?. "It always takes me by surprise when they hit the ol' gut."zMO actorNn;S^MO actorN;SYou wave gaily to !>N;S>" =N;S\^!> grins widely and waves back. uMO actorN&<SUMO actorNJ<S>" rNJ<SYou flutter up atop the !> head and begin to enthusiastically peck at his scalp through the wild tufts of iron gray and snowy white hair. \b "The bird's mistaken your head for a block of wood!" says !>F$ as he bursts into laughter. \b \^!>Q favors his friend with a withering stare as he tries to bat you off his head. NJ<S<)d$ $ $L 44You allow the cloak to settle over your shoulder.  **You sweep the cloak off your shoulders.   old cloakMNsTjA voluminous shapeless cloak, the same color as a burlap sack. Maybe it was a sack in its previous life.NtT>)  hNuT\^!>K huddles, or perhaps it would be better to say swims, in the large cloak.MO actorNvT<MO actorNxTExtremely rough and coarse.,MO actorNyT-DMO actorN{T%It smells of must and old potatoes.MO actorNf|TMO actorN}TxIt would draw too much attention to take that here. Besides you can't fathom what you would do with the thing anyway. *XXXL  44You allow the cloak to settle over your shoulder.  **You sweep the cloak off your shoulders.   brown cloak MNSA long brown cloak, well worn and with the stains to prove it. A dust ruffle dangles to below the shoulderblades with a bronze buckle and tie at the neck. NS>*  INS\^!>, wears the cloak tossed over one shoulder.MO actorNSnMO actorNSOThe cloak is thick and a bit coarse. A good traveling cloak for bad weather. ,MO actorNTS-MO actorNxS You give !>`'s cloak a surrepticious sniff. It smells of pipe smoke and stale perfume, of dirt and travel.MO actorNTMO actorN9T<  E >  N9TLWith your mind you reach out and snatch away the brown cloak right off of !>'s shoulders. For a moment !> looks confused, looks down and pats his body, as if the cloak was to be found curled up in one of his pockets. He looks to the ground and all around until !> claps her hands to her mouth with a gasp.\b "The fey!" she exclaims. "It really is stealing clothes! The cloak was on you one moment and the next--" her words cut off as !>s makes a sudden dash for the tavern door. \b "It seems he's had enough adventures for one day," Val says mildly. N9T>*&>fN9T<  E >  9N9 T*That would draw too much attention here.N9 T)+$L  33You pull the tunic over your head and lace it up. 88You unlace the shirt and shrug it off your shoulders.  brown homespun tunic ]]A plain homespun tunic, pale brown in color with a neckline laced up by rough brown string.MO actorN#TMO actorNGTYou brush your !> feathers  fingers against the shoulder of the shirt. Wool of middling or so quality. Probably the same as most people wear, yet far scratchier than anything you would deign to wear yourself. NGT,MO actorN_T-MO actorNTvIt smells heavily of pipe smoke mixed in with stale perfume and with a touch of something that must be the scent of !> himself.MO actorN6TMO actorNZ!T<  E >  NZ"TLWith your mind you reach out and snatch away the brown tunic right off of !>j's back. He looks down in surprise and pats his exposed chest that the tunic once covered.\b "The fey!" !>r exclaims. "It really is stealing clothes! The tunic was on you one moment and the next--" her words cut off as !>s makes a sudden dash for the tavern door. \b "It seems he's had enough adventures for one day," Val says mildly. NZ&T>+&>fNZ(T<  E >  9NZ)T*That would draw too much attention here.NZ+T),l,,,LW  88You step into the breeches and casually pull them up.   You step out of the breeches.  gray breeches, gray breeches A pair of rough breeches on an indeterminable color that may or may not be gray. Their only distinguishable trait is a pair of large baggy pockets.MO actorNX:T1MO actorN|;TRough and thick.,MO actorNTYou abstain from smelling !>'s breeches.MO actorN3?TMO actorNWAT<  E >  :NWBT7With your mind you reach out and snatch the breeches !>'s right off his legs. He looks down and yelps, a sound which is quickly joined by the voice of the young maiden.\b "The fey!" !>o exclaims. "It really is stealing clothes! It--" her words choke off as she claps her hands over her eyes. \^!> makes a dash inside of the tavern accompanied by the sound of breaking dishes and yet another high pitched help.\b "It seems..." Val's words break off as he disguises his laughter as a cough.NWGT>,&>fNWHT<  E >  9NWIT*That would draw too much attention here.NWKT)-t222L   dark shoes,  dark shoes %%You slip your feet into the shoes.  %%You kick the boots off your shoes. Bulky shapeless shoes of some indeterminable dark color. They look as if someone threw together a few slabs of leather... if that is even leather.MO actorNAZT0MO actorNe\THard and tough.,MO actorN]T-XMO actorN_T9You have quite gotten past your shoe sniffing festish. MO actorN`TMO actorNAbT<  E >  VNAcT>With your mind you reach out and snatch the shoes right off !> feet. For a moment !> looks confused, looks down upon his bare feet and then behind him, as if the shoes could have slipped off without his noticing. !> claps her hands to her mouth with a gasp.\b "The fey!" she exclaims. "It really is stealing clothes! Your shoes were on you one moment and the next--" her words cut off as !>s makes a sudden dash for the tavern door. \b "It seems he's had enough adventures for one day," Val says mildly. NAgT>-&>fNAhT<  E >  9NAiT*That would draw too much attention here.NAkT).<  5  plain wooden pipeMNT5A plain wooden pipe, its base stained a dark brown.NT>*  oNT\^!>R holds it within one hand, raising it to his lips every now and then for a puff.MO actorN TcMO actorN.T<  E >" N.T\^!> notices your interest in your pipe and hands it over to you for inspection. The wood has smoothed down to almost silkiness by many passages through many fingers. "Just a plain ol' pipe, but its served me well over the years. /N.T>" E <  N.T Much to !>'s consternation you alight right atop his pipe. The wood has smoothed down to almost silkiness by many passages through many fingers. cN.TWThe wood has smoothed down to almost silkiness by many passages through many fingers.,MO actorNT-EMO actorNT&It smells of ordinary tobacco smoke.MO actorNT<  E >  YNT@With your mind you reach out and snatch the pipe away unseen. >$&fNT<  E >  9NT*That would draw too much attention here.NT)/L   5   plain cane A plain wooden cane, light yellow in color, and little more than a long strip of wood with its top roughly carved into a round handhold.MO actorNTMO actorNTThe wood is a bit splintery closer to the base but is quite smooth at the top. The cane is quite light and soft, more for show than for any true weight bearing. ,MO actorNT-7MO actorNTA faint hint of smoke.MO actorNT<  E >  YNT@With your mind you reach out and snatch the cane away unseen. >$&fNT<  E >  9NT*That would draw too much attention here.NT)0  5  dull dinner knifeMNT<" YNTJSimple a plain, unadorned supper knife. At least it has been sharpened. KNT?Simply a plain, unadorned supper knife, rather dull to boot. MO actorNTMO actorNT<" -NTSharp and cool to the touch.TNTHCool to the touch, but far too dull for a knife, even a supper knife. oMO actorNTpqMO actorNTLYou narrow you gaze upon the knife and it oblidgingly sharpens before you.",MO actorNcT-/MO actorNTMetallic tang.MO actorNT<  E >  ZNTAWith your mind you reach out and snatch the knife away unseen. >$&fNT<  E >  9NT*That would draw too much attention here.NT)2x5 5 5L F A thick dark gray cloak of wool, lined with softer red linen. Scuffed dark buttons upon its shoulders marks where a hood once attached. gray and red cloakMO actorNQVtMO actorNSVUThe outer cloak is thick and a bit coarse with the inner lining softer to the skin.,MO actorNnTV-MO actorNVV You give !>F's cloak a surrepticious sniff. It smells of pipe smoke, of cured meat and roasted potatoes, and faintly of some spicy perfume.MO actorNPWVMO actorNtYV>  NtZVYou stride up to !>Fb and begin tugging on his cloak. "May I help you?" he snaps at you as he slaps your hands away. Nt[V>" Nt\VYou land atop !>Fg and begin pecking and clawing at his clothes. "The bird wants y' to take your clothes off!" cackles !>1. "Then the bird is as balmly as you," replies !>F as he tosses you away.3J J JL F plain white tunic LLA plain white tunic of beaten linen, yellowing slightly around the edges. MO actorNfVMO actorNhV!You surrepticiously brush your !> feathers  fingers against the wrist of !>F;. The linen of the shirt is soft and surprisingly fluffy.,MO actorNiV-MO actorNkV You give !>F's cloak a surrepticious sniff. It smells of pipe smoke, of cured meat and roasted potatoes, and faintly of some spicy perfume.MO actorNelVMO actorNnV>  NoVYou stride up to !>Fb and begin tugging on his shirt. "May I help you?" he snaps at you as he slaps your hands away. NpV>" NqVYou land atop !>Fg and begin pecking and clawing at his clothes. "The bird wants y' to take your clothes off!" cackles !>1. "Then the bird is as balmly as you," replies !>F as he tosses you away.4S S SLW F ordinary brown breeches, ordinary brown breeches nnA pair of ordinary brown breeches of an ordinary brown color. The hems are faintly stained with travel dust.MO actorN}V2MO actorN~VThick but smooth.,MO actorN7V-VMO actorN[VYou abstain from smelling !>'s breeches.MO actorNVuMO actorNV>  HNVYou stride up to !>F and begin tugging on his pants. "May I help you?" he snaps at you as he slaps your hands away. "I bet he don't usually get no fussin' when he usually tries to take people's breeches off." says !>1 with a wicked cackle. "You are incorrigible." !>F retorts. NV>" NVYou land atop !>Fg and begin pecking and clawing at his clothes. "The bird wants y' to take your clothes off!" cackles !>1. "Then the bird is as balmly as you," replies !>F as he tosses you away.5  L F brown leather boots, the brown leather boots Brown leather boots, calf-high, and showing their wear. Their surfaces are scuffed and stained with a bit of fraying around the leather.MO actorNV2MO actorNVSmooth and tough.,MO actorNMV-XMO actorNqV9You have quite gotten past your shoe sniffing festish. MO actorNVMO actorNV>  NVYou stride up to !>Fb and begin tugging on his boots. "May I help you?" he snaps at you as he slaps your hands away. NV>" NVYou land atop !>Fg and begin pecking and clawing at his clothes. "The bird wants y' to take your clothes off!" cackles !>1. "Then the bird is as balmly as you," replies !>F as he tosses you away.6\  L  green vest ppA dark green vest of some thick, scratchy material, threaded through with bright yellow in triangular designs.MO actorNVMO actorNVbThe vest material is thick and scratchy, something never meant for long contact with bare skin. ,MO actorNRV-MO actorNvV You give !>F's cloak a surrepticious sniff. It smells of pipe smoke, of cured meat and roasted potatoes, and faintly of some spicy perfume.MO actorN4VMO actorNXV>  NXVYou stride up to !>Fb and begin tugging on his shirt. "May I help you?" he snaps at you as he slaps your hands away. NXV>" NXVYou land atop !>Fg and begin pecking and clawing at his clothes. "The bird wants y' to take your clothes off!" cackles !>1. "Then the bird is as balmly as you," replies !>F as he tosses you away.7(  5 F carved wooden pipeMNVAn etched wooden pipe with black tinted trim, its bowl has been carved to resemble a pile of various fruits and flowers. A thin stream of smoke rises from its bowl as!>F puffs on it. MO actoriMO actorN2V>" N2V\^!>F allows you to finger the pipe for a few moments. Its stem is smooth to the touch, but the carven bowl is a bit rough around the edges.N2V>" N2VYou flutter up to !>FZ's pipe, but he pulls it away from his mouth and hides it to one side as you draw near. ,MO actorNV-FMO actorNV'It smells of sweetly scented tobacco.MO actorNVMO actorN5V>  N5VYou stride up to !>Fa and begin tugging on his pipe. "May I help you?" he snaps at you as he slaps your hands away. N5V>" N5VYou land atop !>F and begin pecking and clawing at his pipe. "The bird thinks you smoke too much." says the tavern calls out from the other side of the room. "The bird is balmy," !> replies. 8   7 carved wooden bowl of fruit.MNVCarved upon the bowl of !>F's pipe are fruit... you recognize the shape of an apple, a pear, an indistinguishable blob that might be an orange or a plum, several bunches of grapes, and intermingled are several flowers of the generic type, with no true shape nor species. 77-7,7779t t t5 F  carved cane ||A stout cane with rudimentary shapes carved up and down its length. The handle at the top remains smooth for an easy grip.MO actorNVMO actorNVThe handle is flawlessly smooth, carefully rubbed down by its carver and then further by the handling of many years. It's stem is rougher, the circles, triangles, and squares only crudely carved. ,MO actorNV-7MO actorNVA faint hint of smoke.MO actorN&V'MO actorNJV>  NJVYou stride up to !>Fa and begin tugging on his cane. "May I help you?" he snaps at you as he slaps your hands away. pNJV>" \NJVYou land atop !>F3's cane but it is far too heavy for you to life. :|  <M bowl of stew aaA steaming bowl of stew chock full of potatoes, vegetables, and unidentifiable chunks of meat. MO actorNX6MO actorOxNXThe meat is a bit singed, the vegetables a bit charred, but otherwise the stew is pretty good. Hardy and thick that fills your belly with warmth.<&NXCZNX> &,MO actorNX-KMO actorNX,It smells of scorched meat and vegetables.MO actorN X<MO actorNDXThick and hot to the touch.MO actorNX4dMO actorNXEFilled to the brim with a thick stew full of unidentifiable chunks.;d  <M meatpie with a side of beans ppA steaming plate piled high with a crusty meat pie oozing yellow gravy and a side of large brownish red beans.MO actorNX6MO actorOxNXbThe bottom crust is soggy, but the top is flaky and delicious, breaking off into thin slivers as you dig in. The yellow gravy is creamy and thick, and while the unidentifiable slivers of meat tend to be tough and stringy, the vegetables and quite plump and juicy. The beans are a bit of a tough chew, but they're quite hot and spicy, as you like them. <&NXBZNX> &,MO actorNX-lMO actorNXMIt smells of bakery crust and meat, of steamed vegetables and cooked beans.MO actorN/X,MO actorNSX Piping hot.MO actorNX4KMO actorNX,Piled high with a large meatpie and beans.<  M mug of brandywine 77Chilled brandywine, a translucent brown-red in color.MO actorNwXMO actorOxNXMSweetened with honey and heavily spiced, it burns its way down your throat.<&NXAZNX> &,MO actorNFX-LMO actorNjX-Scented with honey and a variety of spices.MO actorNX[MO actorNX<Beads of moisture slide down the outer surface of the mug.MO actorNAX4=MO actorNeXHalf filled with brandywine.=  M mug of red wine iiA deep blood red wine. It looks a bit odd sloshing within its mug instead of a glass or crystal goblet.MO actorNXMO actorOxNX@Very sweet with a deep flavor. A rather old vintage, actually.<&NXAZNX> &,MO actorNiX-;MO actorNXThe tang of good red wine.MO actorNX[MO actorNX<Beads of moisture slide down the outer surface of the mug.MO actorNSX4AMO actorNwX"Filled with glittering red wine.>  M  potato rum YYA clear liquid that only fills the mug a quarterfull. You swirl it around suspiciously.MO actorNXMO actorOxNXYou sputter as you drink the potato rum. It doesn't taste much of potato... or much of anything besides burning, burning your mouth, your throat, all the way down to where it hits your belly with a fiery whoosh. "Not very good," says !>7 "but very strong." and he raises his own mug to you.<&NXAZNX> &,MO actorNDX-5MO actorNhXA sharp acrid scent.MO actorNXWMO actorNX8Beads of moisture congregate at the bottom of the mug.MO actorN$X4UMO actorNHX6A clear liquid sloshes around the bottom of the mug.?H  M  mug of ale ooA bright gold liquid fills your mug to its brim and over it floats a veritable mountain of fluffy white foam.MO actorNiXMO actorOxNjXIt tastes of normal quality ale, perhaps a bit too watered down. The best part of the brew is the foam that fills your mouth. <&NkXAZNlX> &,MO actorNmX-7MO actorNnXThe sharp tang of ale.MO actorN oX[MO actorN/pX<Beads of moisture slide down the outer surface of the mug.MO actorNqX4PMO actorNrX1Filled to the brim with a golden foamy liquid. @H  M mug of apple cider ^^A cloudy golden brown mixture with tiny dark flecks stirring about the bottom of the liquid.MO actorNyXMO actorOxNzXrA good strong body to the cider, it tastes of sweet, fermented apples with a hint of nutmeg and cinnamon spices.<&N{XAZN|X> &,MO actorN}X-VMO actorN~X7A strong apple scent mixed in with the nip of spices.MO actorN X[MO actorN1X<Beads of moisture slide down the outer surface of the mug.MO actorNX4OMO actorNX0Filled to the brim with a golden brown liquid.AL   DM plain earthenware [[One of the tavern's plain earthenware mugs, it is unadorned and a dull tannish non-color.MO actorN YNMO actorN Y/The surface of the mug is cool to the touch. Bl)))DWM  plain plate A plate, larger than your human head, of unadorned reddish earthware. A few chips can be found scattered about its rounded edge.MO actorNYJMO actorNY+Its texture is a bit rough to the touch. C4DWM plain wooden bowl ZZA plain bowl sculpted out of middling grade wood. At the very least, it's not splintery.MO actorNY6MO actorNYSmooth to the touch. DWE  L H A freshly laundered and starched white apron tied neatly over the brown homespun dress of the tavern maid. You idly wonder if she changes aprons every time that something inevitably is spilled upon it.MO actorN'YAMO actorN)Y"Starchy and stiff to the touch. ,MO actorNc*Y-GMO actorN,Y(It smells of starch and not much else.MO actorN-YMO actorN/Y>" N0YYou stride up to the tavern maid and begin tugging at her apron and dress. "Mind your manners" she tells you as she yanks her clothes away from your graspN1Y>" N2YYou land atop the tavern maid's shoulder and begin pecking and clawing at her clothes. "The bird wants y' to take your clothes off!" cackles !>L. "The bird is looking to become part of the blackbird pie." she retorts. F$  L H brown homespun dress A plain brown dress of brown homespun wool. Its skirts are full and slightly lifted in the front to allow for easier movement. MO actorNY!You surrepticiously brush your !> feathers  fingers against the skirt of the dress. A rough quality of wool, worn by many of the people in this region, yet still far scratchier than you would ever deign to wear.,MO actorN?Y-MO actorN"AYYou give thet tavern maid's dress a surrepticious sniff. It smells of roasted meat and cooked potatoes, of vegetables and faintly underneath, the scent of violets. MO actorNBYMO actorNDY>" NEYYou stride up to the tavern maid and begin tugging at her dress. "Mind your manners" she tells you as she yanks her clothes away from your graspNFY>" NGYYou land atop the tavern maid's shoulder and begin pecking and clawing at her clothes. "The bird wants y' to take your clothes off!" cackles !>L. "The bird is looking to become part of the blackbird pie." she retorts. G  LW H plain white cap A plain white cap, heavily starched, perched atop the back of the tavern maid's head with all her hair twisted and tucked underneath it.MO actorNRYMO actorNSYpThe tavern maid gives you an odd lock as you brush against the top of her head. The cap is starched and stiff.,MO actorNTY-+MO actorNUY Starchy...MO actorNVYMO actorNXY>" NYYYou stride up to the tavern maid and begin tugging her cap free. "Mind your manners" she tells you as she yanks her cap away from your graspNZY>" N[YYou land atop the tavern maid's shoulder and begin pecking and clawing at her clothes. "The bird wants y' to take your clothes off!" cackles !>L. "The bird is looking to become part of the blackbird pie." she retorts. H  L H odd wooden shoes, a pair of odd wooden shoes The tavernmaid is wearing a pair of odd carven wooden shoes upon her feet. You wonder how comfortable-- or not-- they are. They don't seem to hindering her walking as she scoots all around the room.MO actorN/gYMO actorNSiY>" NSkYThe tavern maid pauses and looks down at you in confusion as you stoop to touch her shoes. They are smooth and hard to the touch.\b "That reminds me o' a story," !> begins. \b "Oh lords," sighs !>F.\b "About that there prince who thought that his mother embodied female perfection. So he refused to marry any princess since they never lived up to his ol' mammy. And when his mother died he went searching all over the lands for the maiden who could fit into her itty bitty golden slippers..."\b "And they say you should be off your mother's drawstrings by the time she gets her first gray hair!" says !>F.NSoYSmooth and hard.,MO actorN-pY-XMO actorNQrY9You have quite gotten past your shoe sniffing festish. MO actorNsYMO actorNuY>" NvYYou stride up to the tavern maid and begin tugging at her shoes. "Mind your manners" she tells you as she yanks her feet away from your graspNwY>" NxYYou land atop the tavern maid's shoulder and begin pecking and clawing at her clothes. "The bird wants y' to take your clothes off!" cackles !>L. "The bird is looking to become part of the blackbird pie." she retorts. I  L G A wide white apron, freshly starched, yet starting to show the wear and tear of the scullery with a sprinkling of stains here and there. MO actorNZMO actorNZ>v" }NZnYou flutter over to the tavern keeper but are kept at bay by her wild swings with the large frying skillet. NZ>" NZYou stealthily approach the tavern keeper with her back turned to you, stealthily you lurk, stealthily you stalk, stealthily you whistle and walk the other way as the tavern keeper glares at you and shakes her frying skillet back and forth. ,MO actorNZ-MO actorNZIt probably smells of the scullery, of basting meat and roasting potatoes of vegetables cooked and fruits cleanly sliced. You are not about to get close enough to verify this however. MO actorNZPMO actorNZ1Maybe when you are in a more masochistic mood. J   L G smoke gray dress ooA dark gray dress looking as starched as the tavern keeper's apron and as stiff as the tavern keeper herself.MO actorNZMO actorNZ>v" }NZnYou flutter over to the tavern keeper but are kept at bay by her wild swings with the large frying skillet. NZ>" NZYou stealthily approach the tavern keeper with her back turned to you, stealthily you lurk, stealthily you stalk, stealthily you whistle and walk the other way as the tavern keeper glares at you and shakes her frying skillet back and forth. ,MO actorNZ-MO actorNZIt probably smells of the scullery, of basting meat and roasting potatoes of vegetables cooked and fruits cleanly sliced. You are not about to get close enough to verify this however. MO actorNZPMO actorNZ1Maybe when you are in a more masochistic mood. K  L G dark clunky shoes, a pair of dark clunky shoes uuDark clunky shoes with thick soles and wickedly pointed toes. Somehow they seem quite suited to the tavern keeper. MO actorNZMO actorNZ>v" }NZnYou flutter over to the tavern keeper but are kept at bay by her wild swings with the large frying skillet. NZ>" NZYou stealthily approach the tavern keeper with her back turned to you, stealthily you lurk, stealthily you stalk, stealthily you whistle and walk the other way as the tavern keeper glares at you and shakes her frying skillet back and forth. ,MO actorNZ-XMO actorNZ9You have quite gotten past your shoe sniffing festish. MO actorN?ZPMO actorNcZ1Maybe when you are in a more masochistic mood. L   D#  lMNZ>" (NZremains of the fey tree,NZ hulking figure of the fey treeMMNZ, $$the hulking figure of the fey tree5476/MO actorNZ.<MO actorNZThe tree keeps its silence.vMNZ>" NZNothing remains of your fey neighbor but a smoking crater with a scattering of dark twisted limbs clawing their way outside. And even those are fading before your eyes. NZIn the distance looms the massive form of the fey tree, oak-like in appearance, and with a rippled and ridged trunk that spans nine arm lengths. Broad tree boughs, brimming with leaves and nearly as thick as entire trees themselves, dip gently and almost brush against the ground or claw upwards towards the heavens. Deep green moss mottles the grey-brown bark and face sized knotholes pepper its surface. #sMOavipNZ, E - E + 1NZ$The fey tree is beyond your power.*"7MOavdpNTZ<#bMOwordlstNZKNZNZNZNZIn a fit of madness you have the sudden urge to reveal your true name to the fey tree. Such a moment would be your very last."NZNZ7"I sense it as well... something stirs to the north."NZ"NZNZ"The beast is restless today""NZNZNZNZ("You are truly mad to ask that of me!""NZNZNZNZNZZ"Magessssss..." the voice of the tree disappears in the harsh, angry rattle of branches."  yournamexyzzymynamenorthpbeastlovetreefeymage!mages Val! pookiebuttNZ!c "The tree keeps its silence."zMO actorNZ^IMO actorN[*You wave gaily at the distant fey tree. MO actorN[MO actorN[A dangerous propisition mating with another fey, only accomplished by dancing on the edge of adjoining lands. And the fey tree is not particularly mobile. {MO actorN[HMO actorN [)You coo affectionately at the fey tree.MO actorNP [.MO actorNt [Your relationship with your northern neighbor would be considered 'congenial' between fey. You sometimes speak across your borders, although more often than not the Tree holds its silence. He rarely seeks to intrude or expand into your territory, far far less often than the Beast to the west.\b Why the Tree chose that form is beyond you however. When one can, with enough time and power, have any form that once chooses...? You would go insane if you ever took an immobile form such as a tree for any great length of time. M O O D   capricornMMN[ The capricorn drifts through the waters, its back fins and fluke flickering lazily. A sleek white goat head and forelegs are attached to the silvery gray fluke of a fish. Crystalline scales are scattered about its body like tiny jewels embedded within the sand. MO actorNZ[MO actorN~[0You float over to the capricorn and wrap your !> wings armsZ around it lovingly. It bubbles from its nostrils and rubs its horned head against you. MO actorNO[<MO actorNs[It already belongs to you. 5476MO actorN[MO actorN[You !> swimpull yourself up atop the capricorn and for a few strokes you are given a ride around the bottom of the lake. Sands and shells and coral outcroppings passing underneath you in a blur of color.NOMO actorN [0There is no need to attack your own creation. JMO actorNX"[ITMO actorN|#[5You burble and glug emphatically at the capricorn. MO actorN&[ >MO actorN'[You agree with the capricorn.\MO actorN>([[AMO actorNb)["You disagree with the capricorn.MO actorN+[iMO actorN,[JYou give the capricorn a food poke upon its muzzle as it bubbles at you.MO actorN<.[~MO actorN`/[_The capricorn's white fur is short and sleek, its silvery scaled tail is smooth and rippled. MO actorN1[wMO actorN2[XWhile you care about all your living creations, that's not quite what you had in mind./MO actorN4[.MO actorN5[The capricorn is silent as it drifts amongst the sea weed and coral, silvery bubbles rising from its nostrils every now and then.,MO actorNQ7[-QMO actorNu8[2It smells a bit like wet goat, a bit like fish. MO actorN;[MO actorN<[4The capricorn bubbles in dismay as you press your !> beak lips against it. xMO actorNy ?[MO actorN A[>" fN B[WYou blurble to the capricorn, great sprays of bubbles bubbling forth from your beak. QN D[&The capricorn tilts its head as you !<@ to it. sing a little ditty lilt out a love songcroon a soft lullabye chant an ancient lament !warble out a high pitched tune %sing about a bird in a gilded cage {MO actorN1 M[zMO actorNU N[[You blurble affectionately at the capricorn who lovingly butts you with its horned head. uMO actorN P[UbMO actorN R[>" N S[<'N T[>" N U[<+34JKBLCNLN[L\NPLQNLN}L~NRLSNJI6N_ aska8MOactorobjseqnoN, !.aOSSS_ unlockP.!P+2Pggg_ jump(MO actorN% Wheeee!.Q|999_ wear.nRGGG_+MO actorN[  Hmm... it seems that tree we looked at before has gone all strange... perhaps we ought to check it out? (Note, this would be a good time to be saving your game)\b ENTER ISLE. X TREE.\b And welcome to the end game! If you've explored around a lot more than just this walkthrough you might have a better idea of what is going on here. But for now, all we have to do is defend ourselves against Val. It might finally be time to bring out the big guns...\b CHANGE DRAGON. 5. BITE VAL. BREATH FIRE. [Your game may require a few more attacks here)\b And uh oh, looks like we know what was going wrong in the north all this time... yet another mage! And this one seems not as nice as Val...\b 5. 1. SOUTH. \b Alas, it seems his hold on us is too strong to flee! So backed into a corner, we're forced to fight...\b DEFEND MYSELF. BITE MAGE. CREATE LIGHTNING.\b His hold on you has loosened, its time to beat a strategic retreat! And here comes Val to greet us... Hopefully he will be offering you a proposition...\b 4. ASK VAL ABOUT MAGES. 4. ASK VAL ABOUT ME. 2. ASK VAL ABOUT LOREKOSI. 3. \b So accept it and TELL VAL YOUR NAME or reject it and keep silent long enough and he will give up, either way, here comes Lorekosi...\b 3. C LIGHTNING. C STORM. C EARTHQUAKE. C WOLF. \b Wait until the area is awash in a familiar dark liquid. (Smell it if you want to see if it jogs your memory, but don't dawdle, there's only a few moves between Lorekosi taking down Val and killing everyone)... and then it's time to do what dragons do best.\b BREATHE FIRE\b SX_T_ AboutMO actorN&[This is the IF Comp release of Gilded : The Lily and the Cage and thus is slightly stripped down and not the full version. If you are playing this after the conclusion of the competition, please feel free to download the complete version from www.shonenai.org or from the Tads folder on ifarchive.org.\b New Players Please View the General Overview Section for Important Game Info.\bUU^^^^2ppMO quipnoN[K<N[General OverviewN[HintsN\ WalkthroughN\ FeedbackvN\ Main Menu^N\ ShortcutGN\ Middle Path-N\Scenic RouteN \ The TavernN \The CourtyardN \ The MeadowN \ The GroveN \ The ForestN\ The Hills{N\The Fountain`N\ The LakeIN\The Treasure Room)N\ The CavesN\The Trap RoomN\ The IslandN\ The PlainsN\ The EdgeN\!1D X j   (:LZMO quipnoN\K)ZN\NI\ \(GENERAL OVERVIEW\)\b Players entirely new to interactive fiction may with to peruse the beginner's guides at...\n http://brasslantern.org/players/howto/ \n http://www.microheaven.com/IFGuide/ \b Welcome to the world of Gilded : The Lily and the Cage. This game makes use of some nonstandard verbs as described below.\b As the Player Character(PC) of this game has a far better understanding of this world at its beginning than the player, the THINK verb has been implemented so that the PC's thoughts and memories on certain subjects can be accessed. The command is ...\b THINK [SUBJECT] or abbreviated as T [SUBJECT]\b The greatest power at the PC's disposal is its power to create things out of nothing. For best results, limit creations to actual physical things or manifestations (i.e. no creating chaos or mystery or life) that would be appropriate to a faerie tale setting. (i.e. bazookas and cars etc. won't work.) The command for this is...\b CREATE [OBJECT] or abbreviated as C [OBJECT]\b You are also able to summon things directly to you that have already been created within the game world. If you wish to summon a distant object into your location, the command is...\b SUMMON [OBJECT]\b The PC is a shapeshifter with three forms available to it... human, raven, and dragon form. Each form has its advantages and disadvantages. Note that when you switch to raven or dragon form your entire inventory will transform with you and thus will not become available again until you transform back into a human. Also note that when you transform from raven into human form you will not come back naked (unless you were naked when you transformed into the raven) but you may not be wearing the same clothes as before. The command for this is...\b CHANGE RAVEN or CHANGE DRAGON or CHANGE HUMAN. This can also simply be abbreviated to RAVEN or DRAGON or HUMAN \b There are two main ways of communication within this game. If you wish to speak with a character the ask/tell form is implemented. Note that either ask or tell or talk can be used, but they are all set to equal the same thing. The command for this is...\b ASK [CHARACTER NAME] ABOUT [SUBJECT]\b This can also be abbreviated as...\b TT [CHARACTER NAME] AB [SUBJECT]\b If a character initiates a conversation with you, a reply menu with your response choices will be brought up. You can click on the response (for HTML Tads only) or type in the number of your selection. Note that the number 0 will always be the equivalent of not saying anything at all and will exit you from the dialogue.\b There are many other non-standard verbs implemented within the game such as STRIP, KISS, FIX, and JUGGLE. (Because no game is complete without juggling!) So feel free to experiment. The game also employs the use of all five senses and sometimes a sixth as well. \b\n GENERAL TIPS\b Feeling stuck? Look to the heavens for inspiration, delve into a good book, or just hang around the tavern and relax.\b Remember that once the party has set off into your lands, you are not tethered to them by a leash. Feel free to explore your lands at your leisure and stop to smell the roses. \b Once you and Val have reached the lake it is recommended to save the game, as there are several timing puzzles beyond this point, a few of them quite tightly timed. \buMNK\NO\ \(HINTS\)\b There are several solutions set for each puzzle, with one to two dozen solutions for the nine mandatory puzzles within the game. This guide and the walkthroughs will cover only a small subset of the solutions for the mandatory puzzles. If you don't enjoy the solutions covered here, just experiment around and hopefully you'll find one more to your liking.\b To view a hint highlight the areas under each subsection. The hints progress from vague to an outright command from high to low.\b KNQ\NR\ \(WALKTHROUGH\)\b \JNT\NW\L \(FEEDBACK\)\b Any and all feedback including comments, typos, bug reports, and transcripts is welcome on Gilded : The Lily and the Cage. I am particularly interested in anything you tried which you thought should have worked and didn't or any creatables you tried to make but were unavailable.\b Contact : gilded@darkluna.com \bHNY\N\\ This is the IF Comp release of Gilded : The Lily and the Cage and thus is slightly stripped down and not the full version. If you are playing this after the conclusion of the competition, please feel free to download the complete version from www.shonenai.org or from the Tads folder on ifarchive.org.\b New Players Please View the General Overview Section for Important Game Info.\bFN^\Nb\ \(SHORTCUT\)\b Z. Z. Z. Z. Z. Z. 3. Z. Z. Z. Z. Z. 3. N. 3. 3. 3. C LIGHTNING. C TORNADO. NW. C FIRE. N. C WIND. SE. C FIRE. SCREAM. N. 3. 3. C EARTHQUAKE. W. ENTER ISLAND. X TREE. 3. DRAGON. 3. [BITE VAL. BREATHE FIRE. C LIGHTNING. C EARTHQUAKE.] 3. 3. BITE MAGE. C LIGHTNING. C FIRE. S. 3. Z. 3. Z. Z. Z. Z. Z. BREATHE FIRE.\b [Note the number of times you have to fight off Val before the end game triggers may range between 2-6 turns] \bpDNd\N\ \(MIDDLE PATH\)\b As you are currently skulking around the tavern as a shadow, there is not much to be done at this point except to examine things and listen.\b X ME. I. X NOTHING.\b Now that you are in human form, a bit more can be done. At this point you've got a bit of time to kill before the questing party sets off. So let's examine our companions and surroundings... \b X MAIDEN. X OLD MAN. 2. X STRANGER. X MAID. X KEEPER.\b Hmm... apparently the stranger has found something interesting as well.\b X PAINTINGS. X DRAGON. X MAN PAINTING. 1.\b And off we go... to the courtyard at least. And it's time to start having some fun...\b OUT. 1. 3. 3. 2. 2. 2. 1. 4.\b We can fiddle around with a few things here...\b ENTER STABLE. X SIGN. X WELL. THINK FEY. DRINK WATER\b Mmmm... warm horse trough water. Okay, enough fooling around. Its time to get to business. The business of scaring off humans that is. We can start with a few small attempts with your power.\b CREATE RAIN.\b Well, he got scared off pretty fast. How about trying that again?\b CREATE RAIN.\b Nope, the others aren't budging. Perhaps something a bit stronger...\b CREATE STORM\b Well, the girl is gone now and apparently we may have jumped into something more than we bargained for.\b THINK MAGE. \b At this point you can run off after Val to the northwest, but it'd be far more fun to fool around a bit more before then. We haven't even tried shapeshifting yet so...\b CHANGE RAVEN. S. X COUNTER. X CAT. THINK BUTTERBALL. PET CAT. X CAGE. X SONGBIRD. OPEN CAGE. ENTER CAGE. SING.\b They are insulting your fine avian sensibilities! Time to show them who's boss!\b PECK OLD MAN. ATTACK OLD MAN.\b Now that you've been kicked out of the tavern, there's plenty of places to explore. We'll see what's to the northeast before rejoining Val in the west. But first let's go back to human form.\b CHANGE HUMAN. NE. LISTEN WIND. X HORN. X LICHEN. TAKE IT. X LION. X CLEFT. LOOK IN MIRROR.\b It's a mirror, so of course let's break it! Woo hoo! The cave entrance is revealed. If you still have the lichen at this point and you are in human form you should have no problems entering it.\b ENTER CAVE. W. X LAKE. LISTEN. X FLUES. X DRAGON. S.\b Well, there's nothing here but some wind. But being we're a crazy fey, not a logical human, let's play around with it!\b TAKE WIND. LISTEN TO WIND. FREE WIND. LOOK. X ZEPHYR. TAKE IT.\b Well, now you've got a little friend to play with. That's enough exploring of the caves for now, so let's make out way out... But wait, remember that lake we passed?\b N. ENTER LAKE. \b Well, we're out of the caves all right. So let's explore the bottom of this new lake a bit.\b X CAPRICORN. X CORAL. THINK CORAL.\b There's lots of stuff to fool around with here, but since this is the middle path and not the scenic route, we'll leave it at this.\b UP. ENTER ISLAND. X TREE. THINK DARK TREE.\b It's probably about time we met up with Val again, so...\b OUT. SW. \b Val is so happy to see us he's paralyzing us with his horrid music! So what can we do to get rid of this flute?\b BURN FLUTE.\b Alas, it seems the flute is as warded at its owner. Maybe we can do something about the music that is effecting us... And since we've been playing around with wind so far...\b CREATE WIND\b And we are free again, temporarily. So it's time to deal with that flute and if magic won't work on it...\b TAKE FLUTE\b Too bad you're an even worse player than Val. Well, let's stop to smell the roses while we're here, and of course the lilies in the title of the game.\b X FLOWERS. X ROSES. SMELL ROSE. TAKE IT. X LILIES. TAKE IT. \b So we're off to thwart Val again, last seen scurrying off to the north so...\b N. X TREES. X FIREFLIES. X MESSAGE. LOOK NORTH.\b Hmm... something funky is going on up there. So we'll leave Val to play in the sandbox a bit longer while we wander up north.\b N.\b Whoops, looks like we strayed into someone else's territory. Better get out while we can.\b S. NE. N. N. X TREE. THINK FEY TREE. ASK TREE ABOUT NORTH. ASK TREE ABOUT TREE.\b Oh well, it looks like your northern neighbor isn't going to be of much help. So let's head on back to Val who is still playing in the sands. Why don't you join him>\b CREATE SAND CASTLE. \b You could always do something less zany with the sands, but I always liked the castles. Anyways, let's follow our antagonist down to the southeast\b SE. X TREES. X BLOSSOMS. X TREEFLOWERS. GET BLUE TREEFLOWER. X IT. SEARCH IT.\b Well, at least the old guy was right about something! So, let's try to get Val out of the forest, shall we? How can we get the paper off the trees without him knowing its was us? \b CLIMB BIRCH. CREATE BIRD. \b Well, not exactly what we were aiming for, but an added bonus! \b LAUGH AT VAL. G. G.\b Okay, maybe you ought to make up with Val for laughing at him, even if he is using another annoying song...\b E. APOLOGIZE TO VAL. GIVE ROSES TO VAL. GIVE LILIES TO VAL.\b Now to try and get Val to shut up with the song already. Well, since you're already in such a good mood...\b KISS VAL.\b Now he's in a really good mood too! So let's follow him north...\b N. 3. 2. X DITCH. X FOUNTAIN. X RAINBOW. EAT RAINBOW.\b Well, this seems as good a place as any to insert the necessary maze within the game...\b CREATE MAZE.\b Except that Val is a cheat. Well, not that he has left...\b DOWN.\b There are far more elegant ways to get to the treasure room, but the quick and dirty route is nice also. So it looks like Val might have been up to something with all that digging. I wonder if what he was searching for was buried in here with all this jun-- precious, precious treasure.\b THINK TREASURE.\b We'll leave the treasure room alone for this playthrough and just follow Val.\b UP. W. \b For the final part of this walkthrough type 'ENDWALK' while playing the game. =-N\N\/ \(SCENIC ROUTE\)\b Available in full version,N\N]\(THE TAVERN\)\b I can't do anything in here!\n ...Have you examined yourself? \n ...Are you a shadow? \n ...If so, there is nothing much to do at this point but examine things\b I can't leave the tavern! \n ...Has the rest of the group set off for the treasure hunt yet? \n ...If not, then you won't be going anywhere either \n ...Just wait nine turns and follow everyone else out\b What am I supposed to accomplish here? \n ...There are no mandatory puzzles in the tavern \n ...But there are lots of easter eggs, puzzle solutions, and side plot puzzles \n ...Just explore around and talk to the various people if you feel like it \n ...Or you could just hang about and overhear some interesting conversations\b I burned the tavern down! \n ...Oops \n ...Better hope they rebuild fast \n ...This has no effect on the outcome of the game, so just enjoy your pile of ashes. \b(N]N8]THE COURTYARD\b I can't leave the courtyard! \n ...Are the rest of your companions hanging around the courtyard as well? \n ...Yeah, you won't be going anywhere until they go somewhere first \b <\font> What am I supposed to do here? \n ...Well there's a bunch of people who plan to go stomping all over your territory \n ...And they've already left the supposed safety of the tavern \n ...Are you just going to take this lying down? \n ...It's time to mess with a few minds! \b How do I deal with the Old Coot? \n ...He is probably the most cowardly--ahem most sensible of the group \n ...So anything remotely unnatural will unnerve him \n ...There are plenty of things you could try to do \n ...Just remember to attack from afar and not to blow your cover \n ...How about starting with something relatively simple? \n ...CREATE LIGHTNING \b How do I deal with Layna? \n ...She's a bit braver than the old man, so she won't be going anywhere until after he's been scared off \n ...And she won't be scared by something that she has already seen (ie whatever solution you used on Old Coot) \n ...So you can try something a bit different \n ...You are well known for stealing clothes so \n ...STRIP LAYNA \n ...if you don't want to steal someone else's clothes... \n ...STRIP \b How do I deal with Val? \n ...He's a lot more determined than the other members of the group \n ...Have you tried to use your powers on him directly? \n ...It seems that he is warded \n ...You can try the hands on approach \n ...STRIP VAL \n ...Okay, maybe not \n ...Val cannot be dealt with in the courtyard. You'll have to catch him off guard somewhere else. \b!N:]NI]THE MEADOW \b What am I supposed to do here? \n ...Is Val with you? \n ...If so then it should be obvious what you need to do \n ...Stop that infernal music! \n ...Otherwise, you can simply explore the meadow at your leisure\b What's happening? I'm frozen! \n ...Yes, you are \n ...It seems that Val's flute is the source \n ...If only you could do something about it \n ...Yet what can you do without moving? \n ...Perhaps create something to disrupt the sound of the flute \n ...CREATE WIND \n ...But it seems that this respite is only temporary, so quickly... \n ...GET FLUTE\b %NK]NV]THE GROVE\b What am I supposed to do here? \n ...Is Val here? \n ...If not, then all you can do is explore and track down Val \n ...Otherwise, it seems its time to thwart the mage again \n ...Val is drawing patterns in the sand \n ...What can you do to disrupt that? \n ...You can walk over and step on it \n ...But Val doesn't appreciate that much \n ...It may be a bit of an overkill \n ...but nothing like some good old wind to mess with the sand \n ...CREATE TORNADO\b NY]Nb]THE FOREST \b What am I supposed to do here? \n ...If Val isn't here than all you can do is explore\n ...If Val is here then he's set up sutras all over the trees \n ...The sutras are made of paper so they should be easy to remove \n ...GET SUTRA \n ...Or maybe not \n ...How else can paper be dealt with? \n ...CREATE FIRE \n ...Oops, maybe next time you can find a way to get rid of the sutras without burning the entire forest down\b %Nd]Nj]dTHE HILLS \b What am I supposed to do here? \n ...There are a lot of hidden easter eggs to be found in this region\n ...But the most important part is to get Val to stop with his horrible singing\n ...At least this singing isn't paralyzing you like the flute playing\n ...How can you make someone shut up? \n ...KISS VALNm]Nu]THE FOUNTAIN\b What am I supposed to do here? \n ...Thwarting Val is the name of the game \n ...and now apparently he's digging holes in the ground \n ...so something ground related would be good \n ...On the other hand, you could just give him what he's looking for \n ...If you have no idea what he wants \n ...then nothing disrupts the ground like \n ...CREATE EARTHQUAKE\b Nx]N~]THE LAKE What am I supposed to do here? \n ...For once, Val isn't really doing anything for you to thwart\n ...Yet there is something odd about this area\n ...Have you been here before?\n ...Have you been to the island?\n ...ENTER ISLANDN]N]TREASURE ROOM<\b> There is a treasure room here? \n ...Yep, its refered to in several different areas\n ...and there are three different ways to get there\n ...the simplest, most direct, and most boring route...\n ...is to remember you have no true form or body\n ...and that you can phaze through anything you want\n ...like the ground\n ...and what exactly is supposed to be at the rainbow's end?\n ...Go to the fountain and and type DOWN<\b> What am I supposed to do here? ...This room is chock full of red herrings, backplot, easter eggs, and alternative puzzle solutions to all this rampant creating\n ...But that's up to you to figure out which is which <\b>N]N]^THE CAVES<\b>/b What, there are caves in the game? /n ...Yes, but they're hidden /n ...and they're not necessary to finishing the game /n ...If you want to find them /n ...think of the region most likely to have caves /n ...Check the sculpted hills /n ...Which hill looks like it might hide a cave entrance in it? /n ...Have you noticed that you can hear sounds coming from behind the mirror in the clefted hill? /n ...But the mirror is in the way! /n ...BREAK MIRROR. ENTER CAVE. /b I found the cave but I still can't enter it! /n ...It's not wise to wander around caves in the dark /n ...You'll need something to provide light /n ...There are several such items in the game and one that's close by /n ...Have you looked closely at the Unicorn's Horn? /n ...GET LICHEN. /n ...You also can't enter the caves while in raven form. The reason why /n will become more obvious later. /b What am I supposed to do in the wind chamber and underground lake? /n ...This part of the game is purely optional /n ...so you're on your own /b xN]N]THE TRAP ROOM \b There's a trap room here? \n ...Yes \n ...There are two ways to find it \n ...Have you checked out the red arch? \n ...Have you tried climbing it? \n ...What's that embedded in the stone? \n ...Maybe you ought to investigate it! \n ...TOUCH SEASHELL. \n ...The portal now activated in the arch will lead to the trap room. \b I'm stuck in the trap room! \n ...No, you're not \n ...Really, its your own trap room \n ...Just try going in any direction \n ...If Val is with you, however you may not want to leave quite yet \n ...You can just wait until Val figures a way out \n ...or you can spend this alone time with him to further screw with his mind \b How do I lure Val into the trap room? \n ...Val refuses to enter the caves, smart guy \n ...So you'll have to use the entrance referenced above \n ...If you activate the portal when Val is in the hills, he'll just wander on in on his own \b } N]N]dTHE ISLAND \b What am I supposed to do here? \n ...Is Val on the shores of the lake? \n ...If not, come back to this section later \n ...If Val is with you, then you should notice something strange with the island \n ...What is wrong with the dark tree? \n ...X TREE \n ...You have just entered the end game \n ...Looks like the time for games has come to an end, it's time to get serious \n ...Is there a power you've been holding in reserve? \n ...Something that you kept as a last resort? \n ...Well, that time is now \n ...CHANGE DRAGON \b I'm battling Val and he's kicking my posterior! \n ...Well there's many different things you can try here \n ...And you just have to hold off Val for three moves or so \n ...So any previous attacks will work here \n ...BITE VAL. BREATHE FIRE. CREATE LIGHTNING. \bN]N]THE PLAINS \b What am I supposed to do here? \n ...Have you noticed the butterflies? \n ...They become important later in the game \n ...When the time is right it will become quite evident what you need to do in the plains \n ...until then feel free to explore\b I'm battling the white mage and he's kicking my posterior! \n ...Yes, he is and he is a lot more serious than Val \n ...This is not time to mess around, you need to escape ASAP \n ...Yet it seems you can't get away from him! \n ...All you need to do is defend yourself or attack him for three moves \n ...DEFEND ME. BREATHE FIRE. CREATE HURRICANE. \n ...It seems that his hold on you has temporarily faltered \n ...Time to escape quickly! \n ...SOUTH \bN]N^,THE EDGE \b Val wants to know my name! What do I do? \n ...It's up to you whether you want to accept his proposition or not \n ...If you have no idea what I'm talking about, you may want to try and be nicer to Val the next time around \n ...You can outright reject Val or just keep putting him off until he gives up \n ...If you want to accept his proposal, just tell him your name \n ... You do know your name, right? \n ...If you never found your name TELL VAL ABOUT YOUR NAME will also work \b How do I win the final battle? \n ...The timing for this one is a bit tricky \n ...You have only six moves to save the day after Lorekosi has taken down Val \n ...Once the area gets drenched in the black substance \n ...The smell is familiar like something within the tavern \n ...It's oil \n ...Do what comes natural to dragons \n ...BREATHE FIRE \n ...Congratulations, you should have reached one of the optimal endings! \n ...Check out the AMUSING section if you want to see some of the non-optimal endings\bۥ&1ܷ4    0 ;"@_?*Vt333_ smileMO actorN&!^>5" 5N&"^&That would require a physical body. N&#^> > E >" uN&%^fYou gloat smugly to yourself.\b Val eyes you warily."And what has you in such a good mood?" he asks.N&&^>  E >" E >" N&'^)You smile enigmatically to yourself. \^!>? looks over at you in curiosity and then faintly blushes. \^ !>x claps you companionably on the shoulder and launches into yet another story. \b "That reminds me of another story--" !>9 begins. \b "What doesn't remind you of a story?" asks !>F. as he takes a swig from his tankard. \b \^ !> ignores the other old man. "About that there shadow prince who could bewitch a maiden with nary a smile. " \b "I know of him, " says !>W from her corner. "His stories are quite famous from where I hail. "\b "Oh really? " !> scratches at his white hair. "Have y' heard the one about the shadow prince at the grand ball...?" \b "Where he ended up stealing away all the ladies? " says !>. "And the one about the maid who met him walking home from the town well one night..."\b "I heard o' that too! And the one where he ended up joining in on some wild hunt... although there were no ladies in that one..." \b \^ !>F chuckles as the two tavern patrons get so caught up in comparing tales that they forget to actually come to the storytelling part. +N&:^You gloat smugly to yourself..PGJ|W|:::_ pinch.[\PGJ|XP_ preenMO actorN&I^>" wN&J^hYou fluff and clean your plumage, placing each glossy feather just so for the greatest effect. N&K^>" N&L^qYou fluff out your hair, careful to maintain the nonchalant windy look, and brush off imaginary dust and dirt. |N&N^pYou snap open your sweeping wings with a flourish, admiring the way the light plays off your obsidian scales. Y|;;;_ tickle.PGJ|Z _ calmMO actorN%Z^>  E >! N%_^You close your eyes and think of serenity... of fluffy pale clouds passing by, of the soft whisper of the wind through grass, of the feel of a gentle blanket pulled snugly around... and then silence. A calm quiet has overtaken the tavern.\b You open your eyes to see that everyone has dozed off where they lay, the tavern patrons in their seats, the tavern maid sprawled out across the floor, even the scullery has fallen into silence. \b Rather boring, actually. You !>give a loud squawkstomp your feet and the tavern springs into action once more. The tavern maid dazedly climbs to her feet, the sounds of banging pots and pans comes from the scullery once more, and the tavern patrons pick up their conversations where they had dropped them. EN%a^> > ,N%b^ You close your eyes and think of serenity... of fluffy pale clouds passing by, of the soft whisper of the wind through grass, of the feel-- your thoughts are interupted by the loud sounds of Val tromping all about your lands. You open your eyes and glare at the mage in disgruntlement. . !PGJ|[HHH_ skulkMO actorN&n^>  N&o^Silently you skulk about the tavern, lurking in the shadows, creeping about the edges of the room, patiently gathering yourself, observing, waiting for the right moment to pounce. N&p^>" E >  N&r^"Don't be shy! " !> calls out cheerfully to you. "Come join us at the fire! I promise it won't singe y' rear!" \b "Now if he has any sense he'll be running in the opposite direction, " !>F snorts. N&w^>" E> > |N&{^eStealthily you skulk about the shadows, your footsteps making nary a sound, your body leaving no evidence of the passage that no other eyes can behold. You creep upon your prey oh so slowly, so carefully, so skulkfully and then-- \b Val laughs. "What ever are you doing?" he asks. "Although you seem to be quite a bit of fun. Care to let me in on it? "\b rN&}^>" E >  E >  E > b E > c E > d N&^You press your belly to the ground as you stealthily slither through the grass. You lurk in passing shadows, creepily easily through the gloom, bright bird eyes peering all about for danger. ON&^>" E >  D >  D > b D > c D > d N&^You press your belly to the ground as you stealthily slither through the dust. You lurk in passing shadows, creepily easily through the gloom, bright bird eyes peering all about for danger. -N&^>" E> > N&^You press your belly to the ground as you stealthily slither through the dust. You lurk in passing shadows, creepily easily through the gloom, bright bird eyes peering all about for danger. \b Oblivious, Val continues on his way a few short yards away from you. N&^>" N&^Stealthily you skulk about the shadows, your footsteps making nary a sound, your body leaving no evidence of the passage that no other eyes can behold. Now all you need to do is find some proper prey to stalk. .PGJ|\-S-S-S-_  disrobe-MO actorN(^>5" EN(^6That would require a physical body clad in clothes. ,N(^>" N(^As ravens aren't normally known for their attire, you have nothing to take off. You could pluck yourself of feathers, but the thought seems rather painful. +N(^>" =N(^.You're already as naked as the day is long! +N(^>  E >"" dN(^UIn a moment, things have simply become too interesting for distractions right now. +N(^>  E >" VN(^\n With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. \b There comes a great sound of crashing cutlery behind you as the tavern maid walks back into the front room and yelps in surprise. \^!> gives a squawk of dismay and covers her eyes, although you notice she's left enough room between her fingers to peek through. \b \^!>X gives hoot of delight and shouts "Take it all off!"\b "I think he already has," says !>F  as he sips calmly at his drink. "That's a fine figure you have there, son. " \b "What the hell is going on?!" roars the tavern keeper as she comes thundering into the center of the room. "This is no peepshow!" and you are unceremoniously thrown out on your bum. \bN(^">'N(^> > E >  N(^Alas with the shrill song of the flute shivering through every fiber of your being, you find that you lack the power required to remove your clothes. &N(^> > E >  E >" VN(^\n With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. \b Val has been so entranced with watching you that he has tread upon the patterns drawn in the sands. The young seeming mage looks distractedly upon the ground. \b "I was doing... something..." he tilts and then shakes his head with a shrug. Then, continually casting glances over his shoulder at you, Val begins to head towards the forest to the southeast. >##>!>&"">&>$N(^>  E >  E >  E >"  N(^\^!>S gawks openly at you and then claps her hands over her eyes with a deep blush. \^!> grins wickedly at you as !> gives a hoot of delight. \b "You plannin' on actin' as bait to lure out the fey? " cackles the old man. \b "When I said we should divest ourselves of all unnecessary objects this wasn't quite what I had in mind... although I suddenly see the merits of--" says !>3. \b "Oh for god's sake, put on your clothes! " !> chokes out.\b Well, it is quite breezy out here for running about in the buff. As a human anyway, being as they have no hair nor feathers nor scales to protect them. As for the nigh identical glints in the young and old man's eyes--\b "Y' better do as the lady says, lad." says the older man. "Wouldn't want t' give her a case o' apoplexy. " \b "She isturning a rather alarming shade of red," !>U agrees. \b "Be quiet you two, you don't understand with being men and all. " says !>. "What if I decided to strip and prance around stark naked too?!" \b "Bless me, the idea o' this adventure just keeps getting better and better! " and !>q chortles so loudly that he begins to choke. \b "Maybe you are the one we need to worry about, old man, " says !>W. "Can your heart take all of this? " \b "For the love of god, PUT ON YOUR CLOTHES!" !> half squeals. \b You have no particular love of god, but you look from the choking old man, to the squawking woman, to the young man grinning at you even more wickedly then he was a moment ago, and you decide to shrug back into your clothes. \^ !>\ gives a small 'tsk'. \b "There, there," he soothes. "He's all fully clothed again." \b \^!> looks suspiciously at all of you. "I don't know if I should be traipsing off with you people. " \b "What? Don't we seem trustworthy enough?" asks !> innocently. \b \^!> lets out another huge guffaw resulting in an even more violent coughing fit. "Oh gods, it's too much," the old man chokes out as he scrubs at his eyes. "I'm going to go lie down for awhile. " and choking & wheezing, !> waves gaily at you as he goes back into the tavern. \b One down, two to go. \b "I suppose we could start off without him," says !> as he and !>' return to their respective packing. N(^>##>!"mN(^>  E >  E >  E >" ` N(^\n With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. \b \^!>U gawks openly at you and then claps her hands over her eyes with a deep blush as \^!>\ grins wickedly at you. \b "I am suddenly overwhelmed with enthusiasm for this trip,"says !>3. \b "Oh for god's sake, put on your clothes! " !> chokes out. \b Well, it is quite breezy out here for running about in the buff. As a human anyway, as they have no hair nor feathers nor scales to protect them...\b "She's turning a rather alarming shade of red," !> remarks as he gazes idly between you and the young woman. \b "Be quiet, you wouldn't understand with being a man and all. " says !>u. "What if I decided to strip and prance around stark naked too?!" \b "Far be it for me to try and stop you," says !>X as his grin widens. "Just as long as he is prancing around naked too..." \b \^!>& looks suspiciously between you and !>. "I don't know if I should be traipsing off with you people. " she says. \b You begin to agree with the girl as you look suspiciously at !>X who has yet to take his eyes off you. You decide to shrug back into your clothes. \^ !> gives a small 'tsk'. The wind suddenly kicks up, tearing your tunic away from your grasp, and blowing it up over the tavern rooftop. \b Val holds out his hand and the fluttering shirt suddenly curves about, turning back against the wind and obediently leaping into his grasp. He walks over to you and hands the tunic back with a small bow as you stare at him. \b You are not the only one. \b "You're a mage!" Layna says, and her tone is half accusing. Val turns and bows slightly to her as well. \b The maiden swallows hard and visibly pales. Then she turns and, of all people, stares at you suspiciously! Not that her suspicions are unwarranted, but of the many things you could be accused of, being a mage is assuredly not one of them! \b \^!> is still looking between you and the pale haired young man. "Far be it from me to interrupt you two! " she says and marches back into the tavern. \b And then there was one. \b Next to you, Val laughs softly, dryly. "I do believe she's more affrighted of me now, then she was of the fey!"\b "That sounds about right to me," you reply. \b Val arches a pale eyebrow at you. "Will you be frightened off too?" the mage asks and then sets off to the northwest. N(_>>>&!">##!"N(_> > E >  E >" N()_\n With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. \b Val gazes wistfully at you, the sunrays falling in between the trees collecting within pinpricks of light within his eyes. \b \t "And so the lord of the skies \n \t of the stars and the moon \n \t descended to earth \n \t to bathe in the noon. \n \t And in the shadows of the forest \n \t in the dancing of the light \n \t came the hunter to this clearing \n \t to behold such a sight. \n \t Pale as lilies was his skin \n \t with hair as dark as night \n \t the sun in his eyes \n \t lay bare of all samite. \n \t Such a vision that was seen \n \t beyond what mortal eyes may know \n \t Innocence fails as a shield \n \t beneath the power of this blow \n \t The hunter was struck dumb \n \t as in fury the great lord turned \n \t A thousand baying hounds \n \t with hatred in their eyes burned \n \t And so the price was gladly paid \n \t that day the earth met the sky \n \t for such a taste of eternity \n \t only will I surrender and die."\b And suddenly the sutras slip away from the trees, fluttering softly to the ground below. Val watches the slips of paper fall with some surprise and then laughs softly. "I really must work on that," he says. \b Beneath your gaze the papers crisp and fall away to nothing before they touch the ground. Val watches you for a long moment before turning away and walking to the east. >!>##""!>& N(+_> > E >  E >" vN(9_\n With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. \b The chant has come to a sputtering halt as Val's lips are too busy smirking at you to be singing. The young seeming mage manages, with some difficulty, to pull his gaze from you and look distractedly around at the surrounding red hills. \b "I believe I was doing something... although suddenly it has slipped my mind..." he says. \b "You were torturing me with your abominable singing, " you retort. \b "Oh, was I? " asks Val. "And then you decided to strip down? I need to sing more often then! " he exclaims and then laughs. The wind blows just then, kicking up clouds of red dust, and Val begins to choke while you stare down at him. Val catches a look at your expression and begins to laugh-- and choke-- all the harder. \b "Shall we go to someplace more hospitable?" the mage finally asks and, with many backwards glances to see if you are following, he starts off towards the north. >"">9&"9>##>&N(;_> > E >  E >" 7N(?_\b"And are you planning on taking a dip in the fountain...?" the mage's words trail away as he gazes at you. Val drives his shovel deep into the earth and leaves it standing there as he leans against it. "You know, you're quite a sight, standing there like that with the water catching rainbows all around you. " \b "And suddenly the thing I was looking for doesn't seem so important after all," says the magem as he tosses his shovel to the side and wanders off to the west. m>">##">9&!9}N(B_> > N(E_ \n With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. \b Val watches your every movement with a grin blossoming upon his face. He eyes you from head to heel. "Well..." he clears his throat. "Well, you've certainly gained my attention. Dare I hope for some greater meaning to this? " \b ""N(G_>" N(H_\n With an elegant shrug of your shoulders, you begin to take off each stitch of your clothing one by one until you stand in your full human glory. ".PGJ|^sss_ yellKMO actorN%D#%Your% throat is a bit sore now. N%E_D_ howl(MO actorN/_>5" 2N/_#That would reveal your presence. ) N/_>  E >" JN/_;You suddenly let loose with a howl. There is silence within the tavern for a moment and then... \b "Ah, that reminds me o' the story o' that there ol' man who went and turned himself into a wolf. Have y' ever heard that one? " says one of the old men. \b "Oh gods save us, not that one again," replies the other old man. \b "It was one o' them hunters who'd gone and lived up 'n a mountain. He'd been huntin' wolves n stag n whatever for years, but then one fine day he comes o'cross this great big ol' white she-wolf..."\b "And I reckon he hadn't seen hide nor hair of a woman for years so--"\b "Now don't be all dirty minded, y' old fool! Anyways, he finds this big ol' she-wolf who'd just given birth to a litter o' little pups and he ups and kills them all. The she-wolf is all tired from the birth, but she puts up a great fight. Fastens her jaws around the man's neck and nearly crushes 'im, before he manages to whack her good with his knife. Or was it his broken bow? Now I knows tain't a sword..." \b "Twas probably his dinner knife as he dozed before his fire..." \b "Anyways, he manages to kill them all and decides to skedaddle before the wolf's mate come back looken for o' a bit of revenge. So he skins the white wolf and off he goes back to his cabin. Only he hears howling all around for days an' days after that, howling and a yowling getting closer and closer... And then on the night of a full moon--"\b "He turns into a wolf himself, eh?" the old man sounds unimpressed.\b "Aye! He puts on the fur o' the white wolf and off he goes as a wolf himself!"\b "I heard, " the young maiden in the shadows interjects, " that he ended up becoming the mate to the white wolf's widow."\b There is silence for a moment then... "Well, at least the hunter shouldn't croak after giving birth to a litter of wolf pups." says the second old man. N/_> > cN/_TYou suddenly let loose with a howl. Val turns around and howls right back at you! FN/_>  LN/_=The shadow dog growls as it remains clamped unto your leg. N/_>-" D >  5N/_&You suddenly let loose with a howl. N/_>-" ~N/_rYou suddenly let loose with a howl. You hear a keening reply and suddenly the black dog comes loping up to you! N/_> > E >  E >." N/_Val's !>k @ eyes widen slightly as the shadow dog's muzzle swings in between the two of you. The flute music peters to a stop. \b "I have a sudden wondering for what lies over yonder hills," Val says airly to no one in particular. The silver flute disappears into his cloak and he saunters, very carefully, foot by foot and never glancing back at the shadow dog, over a shallow knoll to the north. N/_>>&".>>&!N/_> > E >  N/_A moment before Val was drawing patterns in the sand and then suddenly he has shimmied up into the lower branches of one of the metal trees. You blink up at him, wondering how he managed to move so fast. "/>C0N/_> > E >  N/_Val glimpses the shadow dog on the hunt and with a flurry of his dark cloak, he has pulled himself up into one of the birch trees. >>N/_> > E >  N/_Without a single break in his chant, Val gracefully scrambles up the smooth slope of a nearby hill and out of the shadow dog's reach. >N/_> > E >  N/_{Val curses slightly at the appearance of the shadow dog and then dives into cover in the depths of the hole his has dug. >N/_> > E > m *N/_Val waves his hand absentmindedly at the shadow dog. It pulls up suddenly with a yelp and looks about confusedly. Val's gaze remains on the north and the dog's soon follows suit. Its nostrils quiver and then, suddenly, it wheels about and lopes away as fast as its legs can carry it. N/_> > E >  HN/_)Biding your command, the shadow dog hurls itself at Val, its lips pulled back in a rictus snarl. It is caught in mid-leap, frozen in the air for one hapless moment before, with a shriek, it is flung halfway across the lake. \b It crashes into the water and, motionless, sinks beneath the waves. >.PGJ|`   _ sing MO actorN%_>5"  N%_As amusing as it would be to see the faces of the tavern denizens with a disembodied voice singing in their midst, that would destroy your carefully planned deception, the trick that lead them to believe that the fey hold no influence over the tavern. N%_>" E> > N%_"KRAW!" you sing. "KAK KAK KRAW COA COA COA KAK KAW KAW KRA!"\b "Yes, I hear you, Lord Raven" says Val. "Are you trying to serenade me?"N%_>  E >I  JN%_;You burst into song and the songbird trills back at you. N%_>" E >  E >" CN%_4"CRAK!" you sing. "CRO-OAK! KAK KAK KRA KRA KRAW!"\b For a moment there is silence within the walls of the tavern as the sound of conversation dies away. Several of the tavern patrons turn to stare at you and finally one of the old men speaks.\b "Can't say I'm too impressed with the new songbird" he says.(N%_>" JN%_;"CRAK! KAK KAK COA! KAW KAW KRAW! KAK KAK KRA!" you sing.N%_>  E >" E >" DN%`5You burst into song. To your great surprise the drunken, passed out man suddenly bolts upright. He slings an arm around your shoulder and you both stagger around the room, singing an old tavern song as the other patrons look on in amusement. \b "O'er mountain, o'er valley\n through the forests, through the plains\n lies this land of pomp and splendour\n treasures vary, gilded chains\b See the shadows softly lying\n see the gold in the sun\n Sea of rainbows, sea of jewels\n sparkle, glitter, burn and run\b All is gold, all is silver\n everchanging, all the same\n price of finding, price of catching\n shoulder this and bear the blame\b This love is ephemeral\n this love is set in stone\n My soul for this jewel\n for this heart walks alone\b Coins in the flowers\n gems in the trees\n flesh bound to earth\n and spirit in the breeze.\b King of the phantoms\n wisps through the age\n my soul for this kingdom\n gild the lily, gild the cage!" \b As soon as the last note vanishes into the air, your fellow singer collapses back unto his table and proceeds to snore away.^N%`> > E >" N% `!<@Val shakes his head. \b "What have I done that you would want to torture me so?" he asks with a slight grin. \b You stop and glower at Val as his smile widens. The nerve of him! Your singing isn't bad! Well, that bad.7N%%`>" #N%&`!< @ You burst into song. You sing a little ditty. You croon a soft lullabye. You chant an ancient lament. =You belt out a tune at the top of your very capable lungs. You sing an old lilting melody that is supposed to bring the rain. It fails, which is just as well, since you didn't feel like rain today. 4For some unfathomable reason you decide to yodel. "You hum underneath your breath. &You warble out a high pitched tune. *You sing about a bird in a gilded cage. >You trill like a nightengale. A half-tone deaf nightengale. wYou start to sing a ballad about two mortal enemies becoming lovers until you realize you've forgotten half the wordsa0_ danceMO actorN&<`>5" 5N&=`&That would require a physical body. N&?`>  E >" E >" JN&@`!< @' The tavern denizens clap and cheer. (N&A`> > E >" oN&B`!< @L Val eyes you for a moment and then takes your hands and dances with you! N&C`>" bN&D`?You flap and flutter about. Who says that birds can't dance? !< @#N&F`!< @ You do a little jig3You try to tango. Or you would, if you knew how. 4Gracefully you go through a few paces of a waltz. 1You dance around the falls of light of shadow. You prance and strut about. Wildly you jitterbug. You do the dance of joy! =You dance a few steps, an elegant twirl, a graceful whirl. kSeductively, you begin the bewitching dance of love. After a few steps you shrug, laugh, and wander off. .()PGJ|b   _  whistle MO actorN(X`>5" 2N(Y`#That would reveal your presence. ? N([`>  E >" rN(\`cYou whistle a happy little tune. Unconsciously the tavern maid starts whistling the same melody.  N(]`> > N(^`You whistle a happy little tune. Val eyes you from head to toe and whistles back, his tone a great deal less innocent than a happy little tune. N(_`>-" N(``lYou whistle and there comes a great baying and howling. Suddenly the dark dog comes loping up towards you!N(a`> > E >  E >." N(b`Val's !>k @ eyes widen slightly as the shadow dog's muzzle swings in between the two of you. The flute music peters to a stop. \b "I have a sudden wondering for what lies over yonder hills," Val says airly to no one in particular. The silver flute disappears into his cloak and he saunters, very carefully, foot by foot and never glancing back at the shadow dog, over a shallow knoll to the north. N(d`>>&".>>&!N(f`> > E >  N(h`A moment before Val was drawing patterns in the sand and then suddenly he has shimmied up into the lower branches of one of the metal trees. You blink up at him, wondering how he managed to move so fast. "/>C0N(k`> > E >  N(m`Val glimpses the shadow dog on the hunt and with a flurry of his dark cloak, he has pulled himself up into one of the birch trees. >>N(o`> > E >  N(q`Without a single break in his chant, Val gracefully scrambles up the smooth slope of a nearby hill and out of the shadow dog's reach. >N(s`> > E >  N(t`{Val curses slightly at the appearance of the shadow dog and then dives into cover in the depths of the hole his has dug. >N(v`> > E > m *N(w`Val waves his hand absentmindedly at the shadow dog. It pulls up suddenly with a yelp and looks about confusedly. Val's gaze remains on the north and the dog's soon follows suit. Its nostrils quiver and then, suddenly, it wheels about and lopes away as fast as its legs can carry it. N(y`> > E >  5N(}`)Biding your command, the shadow dog hurls itself at Val, its lips pulled back in a rictus snarl. It is caught in mid-leap, frozen in the air for one hapless moment before, with a shriek, it is flung halfway across the lake. \b It crashes into the water and, motionless, sinks beneath the waves. >/N(`#You whistle a happy little tune. .PGJ|c]]]_ laughnMO actorN0`>5" N0`As amusing as it would be to see everyone's reactions to a disembodied, maniacally laughing voice in their midst that would well and truly destroy your disguise. ;N0`>" E >  D>  E >  D >  D >  D">  E >o" E >p" FN0`n<nKN0`You burst into gales of giggles at the disgruntled look upon the mage's face. Val favors you with a scowl for your efforts as he brushes at the white covering his shoulder. >##_N0`You continue to laugh at the fuming mage. \b "Oh, you're simply enjoying this, are you?" he asks you with a deathly calm to his voice. \b "Indubi--Indu--In--du--doo" you cannot finish your sentence. >##vN0`N0` You laugh so hard that you fall out of the tree and land upon the pebbled ground with a muffled thump. With a final shake, the last bit of white dissolves off of the mage's shoulder. Val stalks forward and stares down at you. His expression makes you laugh all the harder. \b"Stop! Stop!" you call out. "It h-hurts..." and you clutch at your stomach. \b "Oh, you need help all right..." the mage mutters before pulling you to your feet. \b "I have had a bellyful of this forest," Val mutters and stalks off to the east. \bN0`!o>>C)CqN0`>  E >" 3N0`5You laugh quietly to yourself. The tavern maid and !>G glance at you in curiosity. \b "Glad that y' enjoyed m'story!" says !>. "Have y' heard of the one about the ol' hunter and the great she-wolf?" \b "Aye, tis been three times today already!" says !>F. -N0`> > N0`You cackle gleefully as !>3 eyes you suspiciously. You then proceed to give !>` an innocent look of newborn babes and lambs, which makes him eye you even more suspiciously. AN0`5You laugh melodically. Maniacally and melodically. .PGJ|d0f0f0f0_ fly(0MO actorN$`>5" rN$`cYou discard the thought of leaving the tavern just when things are finally becoming interesting. /N$`>" E >  E >" TN$`EWith a flutter of ebony wings you launch yourself into the air and slowly begin to circle round the wooden rafters of the tavern. \b "It's that balmy bird again!" the tavern maid cries out and makes shooing motions at you. \b At those words, the heavyset tavern owner comes lumbering out of the scullerys and begins chasing you about the room with an even heavier skillet in hand. You take this opportunity to begin dive-bombing everyone in the general vicinity.\b The two old men leap up from where they had been sitting near the fire and begin batting at each other, perhaps trying to wave you away, perhaps trying to get an indiscreet slap on the other. There is the screech of wood on wood, an overturning of chairs and tables, someone getting hit in the head with the broom, and a general pandemonium as you whiz about the room. \b Finally the room settles down as the tavern denizens grow winded, panting for breath with reddened faces as they lean against various overturned pieces of furniture. Layna sips calmly from her mug in an indisturbed corner of the tavern while you sit atop the bird cage calmly preening your feathers. \b Mumbling to herself, the tavern keeper returns to her post in the scullery while the maid begins straightening up the room. The two old men return to their place by the fire and all is at it was once again. *N$`>" E >  E >r" N$`cYou circle around the courtyard gazing down upon the mundane things that clutter it. The overflowing apple barrel whose scent must tease the horses held within the dried wood of the nearby stable, the dark hole of a well that has always thwarted all your attempts to use it, a horse trough, a pile of pebbles, and upon the straw thatch of the tavern roof lies a few forlorn shingles, pulled up from their resting place.\b You swoop out of the sky and grab the wooden tiles within your talons. However, as you pull up once again it slips in between your claws and skitters off into the pebbled courtyard below.>&>" !r\'N$`>" E >  E >r" N$`You circle around the courtyard gazing down upon the mundane things that clutter it. The overflowing apple barrel whose scent must tease the horses held within the dried wood of the nearby stable, the dark hole of a well that has always thwarted all your attempts to use it, a horse trough, a pile of pebbles, and the roof of the tavern, half thatched, half shingled. It seems that the tavern keeper did not wish to pay for new shingles when the old ones wore away. O%N$`>" E >  E >I  N$`xYou carefully thread your way through the maze of twining tree boughs within this pale forest. The songbird takes note of your entrance and bursts into a new song as it spreads its wings and leaves its perch. \b The bird trills happily as it flits around, its smaller size allowing it to be far more nimble within these close confines. As it swoops and circles about, you simply try to avoid flying head first into an unseen trunk or tree branch. \b Finally, with a far less melodious croak, you perch upon an overhanging limb of a weeping willow. The songbird lands besides you and begins to smooth down your ruffled feathers. \b>"N$`>" E >  E >  %N$`You fly through the tangled maze of branches, keeping a careful eye on Val as he wantonly trespasses through your forest. Perhaps you should have kept a closer eye on where you were headed, as you soon find yourself lying in an indignant puddle of black feathers upon the ground after having collided with an itinerant oak tree. Val takes notice of you and, with a soft cluck of his tongue, he picks you up and begins stroking you. You freeze for a moment in confusion as he smooths down your dark feathers. The sensation is... rather pleasant, you must admit. But lying defenseless in some mage's hands, no matter how good a masseur he is, is not the wisest of decisions.\b Giving yourself a quick shake to free yourself of any wandering fingers, you flap off into the surrounding trees.AN$`>" E >  N$` Though you try to carefully thread your way through the maze of tree limbs that is this forest, you eventually end up flying head first into a weeping willow tree. A weeping willow tree that will pay for not jumping out of your way in time, oh yes.\b Birds are supposed to like forests, but you have never had much luck while in bird form in this one. While the tangled patterns of branches and leaves is quite pleasant to look at from below or above, flying through the blighted thing is a royal pain in the posterior. N$`>" E >  E >  N$`Val's music seems to penetrate into you, the light trilling of the flute flaring into your brain like so many needles. You plunge out of the sky and to the waiting earth below.N$`>" E >  N$`You soar majestically over the green rolling meadows, the vegetation swaying underneath you like a sea of grass and flowers. pN$`>" E >  E >  N$`The sun's warmth beats down upon your dark wings as you circle round and round the dark grove of trees. Val works assiduous below you, tracing intricate designs within the sands. From this height, you can see the overall pattern created by all the interlocking figures and it is... it is... \b Your pattern-- the same one found within the Sculpted Hills. That is not possible! He has not yet been to the hills, has he? He has never been here before-- before--hN$`>" E >  4N$`%The sun's warmth beats down upon your dark wings as you circle round and round the dark grove of trees. The fireflies hovering within the shadow of the trees are driven into a furor by your presence-- they begin darting quickly, or as quickly as a firefly can manage, all the while blinking urgent messages to each other.\b And maybe to you. You notice many of the fireflies are flitting about in odd patterns, exposing their softer glowing undersides to give you an even better view of their light show. You can almost understand their message...N$`>" E >  E >  N$`You soar above the lands of the lake. A circle within a circle within a cirle... the green grass and little trees encircle the shores of the perfectly clear, perfectly round lake. Within the center of the lake rests the rounded dark isle and at the heart of all this stands the dark tree.\b Something breaks the completeness of this pattern, though. A figure of dark and pale coloring, standing at the very edge of the lake. Val's face is turned up to the sky as he watches you circling above. \b "Are you still going to hide behind that form?" he asks and you feel something pulling at you within. An urge... an urge to tranform. Is this your own feeling or some outside force?2N$`>" E > m  N$`You soar above the lands of the lake. A circle within a circle within a circle... the green grass and little trees encircle the shores of the perfectly clear, perfectly round lake. Within the center of the lake rests the rounded dark isle and at the heart of all this stands the dark tree.\b Even you are forced into a circle as you fly round and round the region. The clouds begin to trail after you, forming a circle of their own and-- you decide its best to land before you unwittingly complete the spell.N$`>" E > m 1N$`"Dark wings extend, sweeping majestically into the sky. The dark tree sways raggedly and circles ripple violently outward across the surface of the lake as you pump your wings. You gracefully leap upward, your wings billowing fully to catch the wind that you have summoned. Drifts of blue petals are left in your wake as you soar to the sky and turn to face your enemy. Val stands on the waters at the edge of the island, eyes narrowed as he watches you. The wind of your passing tosses his pale hair and dark clothes within a storm of blossoms.N$a>" E >   N$aYou glide above the sea of rolling tinted grass and suddenly you find yourself hurtling into a cloud of butterflies. Their wings beat against yours like a storm of tiny fists, like a thousand tiny lashes, like the heavy tears of a cloud burst. A multitude of colorful bodies chokes the air... red, purple, blue, yellow, orange, green, black, white, and brown... everywhere all at once... \b You find yourself falling out of the sky, covered in the dust of beating wings. With an effort you level off before crashing into the waiting ground below, and slowly circle well below the sea of roiling butterflies. What could they all be possibly doing here?  N$a>" E >    N$ aYou drag your body back, snapping your wings open, and with all your will push yourself into the skies. It takes all your concentration, all your strength, to do such a simple thing in the face of the white clad figure standing before you.\b You thrash your wings at the air, summoning forth all the wind you dare, yet it is all you can do to remain this distance from Lorekosi. Its as if every fiber of your being is drawn towards him, inevitably pulled to him, drawn in by him, devoured by him.... N$ a>" E >  E >  )N$a Val watches you with a slight smile as you flit around the many rainbows that bedeck the fountain. As you dive through a rainbow, a cold tingling sensation runs through your body, and for one heartbeat you are caught within midair. \b And then you are bursting through to the other side again, dark feathers having been dyed into a myriad of colors. Val pushes damp hair out of his face and laughs. \b "Well, that's handy. Are you prettying yourself for me?" he says and laughs again when you give a caw of indignation. ""{N$a>" E >  YN$aBYou flit about the fountain, fluttering in and out of the many rainbows. As you dive through a rainbow, a cold tingling sensation runs through your body, and for one heartbeat you are caught within midair. /b And then you are bursting through the other side again, damp feathers having been dyed into a myriad of colors."N$a>" E >  E >  N$!aYou zigzag drunkenly through the air as you fly between the red sculpted hills. Below you Val is singing... no chanting... and he... you are... trouble... concentrating...\b You flop out of the sky and into a puddle of red dust below.N$#a>" E >  E >  =N$'a.You soar high above the sculpted red hills. From this distance the land seems nothing so much as a tumbled sandbox abandoned halfway through play. Perhaps you could work on adding a few more shapes to the hills.\b A glint of silvery metal catches your eye from atop the spiral of the Unicorn's Horn. sN$)a>" E >  N$+aYou soar high above the sculpted red hills. From this distance the land seems nothing so much as a tumbled sandbox abandoned halfway through play. Perhaps you could work on adding a few more shapes to the hills. oN$.a>  E >" N$/aWhile it would be amusing to see the faces of the tavern patrons if you started flitting around the ceiling, that would utterly destroy the disguise that you have worked years upon. N$3a}You tilt your head up towards the heavens and allow your corporeal body to dissolve away. Slowly you drift upwards, slowly, slowly towards the unending blue. The clouds approach you, embracing you, their touch as ethereal as broken spider webs, and then you are bursting free, upwards towards a blue that is darkening to black and-- a tremor. \b Again. Something is tearing apart inside, breaking, into pieces, evaporating... You've wandered too far, too far from your domain. You struggle for a moment, one more moment in the skies, and then you allow yourself to be drawn back. You drop back to earth and regain your physical body..BCPGJ|eD_ plughMO actorN&Oa.You cough and delicately clear your throat. N&Pa>5" WN&Qa\^!>F: looks around in puzzlement for the source of the cough.f_  blurblejMO actorN([a>5" 5N(\a&That would require a physical body. N(]a> > ON(^a@You blurble noisily to yourself. Val gives you a strange look.N(_a>  hN(`aYYou blurble noisily to yourself. The tavern patrons continue to chatter all around you..N(ba"You blurble noisily to yourself..PGJ|g_  abracadabraMO actorN,ia>5" 2N,ja#That would reveal your presence. UN,ma> > E >  E >! N,na"Abra Ca Dabra!" you say.\b "Open Sesame!" Val responds.\b Suddenly the red archway begins to shimmer and the grounds beyond fade away to be replaced by a glimmering curtain of light."VN,oa> > E >  E >" N,pa"Abra Ca Dabra!"you say.\b "Open Sesame!" Val responds.\b Suddenly the light in the archway dies away and the far grounds fade back into view.!N,qa>  N,rau"Abra Ca Dabra!"you say and look around expectantly. For a moment you feel a twisting and then-- no, it fades away.N,sa> > N,taz"Abra Ca Dabra!"you say.\b "Open sesame!" Val responds.\b You both look around expectantly but nothing seems to happen. HN,ua>  E >" N,va"Abra ca dabra!" you suddenly say. For a moment there is silence as the other tavern occupants stare at you as if you've gone quite daft before turning back to their own conversations.`N,xaT"Abra ca dabra!" you say. You look around expectantly but nothing seems to happen.h_  open sesameMO actorN,a>5" 2N,a#That would reveal your presence. GN,a> > E >  N,a"Open Sesame!" you say.\b "Abra Ca Dabra!" Val responds.\b Suddenly the red archway begins to shimmer and the grounds beyond fade away to be replaced by a glimmering curtain of light."SN,a> > E >  E >" N,a"Open Sesame!" you say.\b "Abra Ca Dabra!" Val responds.\b Suddenly the light in the archway dies away and the far grounds fade back into view.!|N,a>  N,at"Open sesame!" you say and look around expectantly. For a moment you feel a twisting and then-- no, it fades away.N,a> > N,a{"Open Sesame!" you say.\b "Abra Ca Dabra!" Val responds.\b You both look around expectantly but nothing seems to happen. DN,a>  E >" N,a"Open Sesame!" you suddenly say. For a moment there is silence as the other tavern occupants stare at you as if you've gone quite daft before turning back to their own conversations.^N,aR"Open Sesame!" you say. You look around expectantly but nothing seems to happen.ip---_ changeMO actorN'aYou feel your body begin to dissolve away to reform into-- into-- for a moment you are confused as your essence shifts around upon itself. Finally your body coalesces back into being the same as before. .  PGJ|j_ change into dragonUMO actorN3a>" E >" N3aYou arch backward as the change ripples through, spine lengthening, muscles contorting and bulking, new bones hardening and growing as your body goes massy, solidifies and expands. \b The flesh at your sides stretches and strains into a taut membrane pulled over light bone, your face pushes outward into a tipped muzzle, toes and fingers lengthen and sharpen into claws. Finally soft skin hardens and darkens into a multitude of black, glossy scales. Your head rears back on a neck that has been pulled, pulled higher, pulled longer and a shadow rears above all as heat burns down your throat.\b You open elongated reptilian eyes as cold as the distant stars and unfurl dark wings. \b You are the Dragon. \b You tower over the lake, curled carefully around the lone tree, the island barely holding your mass. The dark tree sways in the wind from your wings as you pump them and blue blossoms break free and dance through the air. Val watches you carefully from the edge of the isle. \b "That's rather impressive, Snugglebums" he says. \b "!!jN3a>" E >" \N3aMThis is no time to fool around! You are already in your most powerful form.N3a>" N3aThat may be a bit premature. The dragon is your most powerful form but the transformation is quite taxing and would deplete your energy for days, weeks even. Tis something that should be brought out as a final resort, not a mere plaything with which to idly trifle. \b Or rather, you shouldn't play about too much... you only give into the temptation of breathing gouts of fire or the distant shaking of trees when those caravans of merchants or farmers go by. And swooping out of the night skies to scare drunken passersby. \b Only occassionally mind you, and never so much that they could be certain that it was a dragon that did it. Tis healthy to give them something to talk about every now and then. N3a>" E >l" N3a k   _ change into raven MO actorN2a> b D > c D > d N2aIt would not be wise to take that form in here. The errant wind would love nothing more than to snatch up a small bird and send it hurtling through the stone caves. You have a bit of an experience with that. f N2a>5" (N2aTranforming into a raven before everyone's eyes would be quite delicious... for that moment that you would revel in the shocked expressions upon their faces. And after that...? Your trick would be ruined as the humans realize that the tavern is not free of fey influence at all. , N2a>  E >" N2a Oh yes, that would cause quite a delicious stir if you were to transform in front of everyone. It would also utterly ruin the trick that you have labored upon all these years, the deception leading all the humans into believing that the tavern stands on empty lands.N2a>"" N2a Oh yes, that would cause quite a delicious stir if you were to transform in front of everyone. It would also utterly ruin the trick that you have labored upon all these years, the deception leading all the humans into believing that the tavern stands on empty lands.N2a> > N2aWhile it would be quite amusing to see the expression on Val's face if you were to transform in front of him, that would end the game. And you're not quite done playing with him yet. N2a>" gN2aXYou flutter about agitatedly trying to change yourself into something you already are!mN2a>" E >" \N2aMThis is no time to fool around! You are already in your most powerful form.N2a>" .N2aThat form won't help you now!N2a> b DN2a5Considering the strange winds that stalk these caves, you decide that changing into raven form here would not be for the best. Especially considering that the last time you did so, you ended up getting stuck within a flue. A situation that was shortly rectified, but embarassing to your pride in the least. \N2a> c DN2a5Considering the strange winds that stalk these caves, you decide that changing into raven form here would not be for the best. Especially considering that the last time you did so, you ended up getting stuck within a flue. A situation that was shortly rectified, but embarassing to your pride in the least. N2a> d DN2a5Considering the strange winds that stalk these caves, you decide that changing into raven form here would not be for the best. Especially considering that the last time you did so, you ended up getting stuck within a flue. A situation that was shortly rectified, but embarassing to your pride in the least. N2aYour body grows airy, edges blurring, as you fold and contract into yourself. Sleeker... smaller... Your outer skin disappates in a soft shimmer and you collapse into a pile of shadows. \b Toes and feet give way to talons, arms bend back into wings, and hair gives way to feathers. Wings softly flutter and a wicked little beak curves out below eyes too bright to belong to a true raven."!lkkk_ change into human6MO actorN2a>5" (N2aTranforming into a human before everyone's eyes would be quite delicious... for that moment that you would revel in the shocked expressions upon their faces. And after that...? Your trick would be ruined as the humans realize that the tavern is not free of fey influence at all. N2a>" mN2a^Have you held this form for so long that you have forgotten yourself? You are already human!jN2a>  E >" N2a Oh yes, that would cause quite a delicious stir if you were to transform in front of everyone. It would also utterly ruin the trick that you have labored upon all these years, the deception leading all the humans into believing that the tavern stands on empty lands.0N2a> > N2aWhile it would be quite amusing to see the expression on Val's face if you were to transform in front of him, that would end the game. And you're not quite done playing with him yet. QN2a>" E >" \N2aMThis is no time to fool around! You are already in your most powerful form.N2a>" .N2aThat form won't help you now!N2a>" N2auYour body arches upward, straining and splitting. Wings break into arms, into hands, into fingers that can hold, that can clasp close or push away. Legs elongate as talons recede into toes and tiny blunted nails.\b Feathers fall away to reveal naked skin and you are flightless, weaponless, and fragile. Or atleast you have the outer appearance of so.\b You become human."!N2aYour body arches upward, straining and splitting. Wings break into arms, into hands, into fingers that can hold, that can clasp close or push away. Legs elongate as talons recede into toes and tiny blunted nails.\b Feathers fall away to reveal naked skin and you are flightless, weaponless, and fragile. Or at least you have the outer appearance of so. And so you pull shadows over yourself that become clothes to hide behind.\b You become human."!mJJJ_ clean.!P+2n|;;;_ switch.?@oHHH_ fix.!opPGJ|Pp|<<<_  torture.PGJ|qd!!!_ hugMO actorN$,bYou !> wings  armsaround yourself. !> You Your armsb ache to embrace and cuddle the next random thing you see, preferably something soft and snuggle.PGJ|r}}}_ love>MO actorN%4bIf only it were that simple. .PGJ|s|:::_ climb.tRRR_ throw.!    ?+2u_ lift`MO actorN%KbASeeing nothing else at hand, you decide to raise your spirits. .PGJ|v===N.!?_a]^PGJ|?xooo_  inventoryBMO actorN*!N*>N*yooo_  inventoryBMO actorN*"N*>N*zx888_ say.{hhh_  whisperMO actorN(ub>  E >" E >" gN(wb3You mutter underneath your breath. \b "Eh?" says !> "What's that y' say?"rN(xb> > N({bYou mutter unintelligibly under your breath. Val's bright eyes flick momentarily towards you.\b "What's that you say? You're professing your undying love for me?" he says. N(}b>" GN(~b8"Krah... kak... kawk... coa... coa..." you caw softly.EN(b9You mutter underneath your breath about meddling mages..!LKPGJ|?|_ emptyDMO actorN&b%The world around you is quite full..1PGJ|nh}CCC_ attackP.P~_ slapCMO actorN%b$You swat ineffectually at the air..PQ a|_ wakeMO actorN%bvIf this life were a dream, there is only one way to wake up. And if that is so, then you are in no hurry to awaken! . a|` go out-MO actorN'b<,MO actorNZb Y. a|d###` againbbb` wait:MO actorN%Time passes...\nN%|<<<_  look in.4CCC_ dig inP.P<`MO actorNkN\%You% %are% much too anxious worrying about %your% continued survival to fall asleep now. 9N>>%N%You're% not tired. N D  NqI don't know about you, but I can never sleep standing up. %You% should find a nice comfortable bed somewhere. SN0%You% quickly drift%s% off into dreamland...\bNNN sleeph'''x  inventoryXyx888_ laa. ax`-MO actorN&c< enter,MO actorNY*c X.A axhx2nP`b_ drown You couldn't, even if you really wanted to. You have no true need for air and could drink in an entire ocean before drowning. .! axnx2$_  apologize?MO actorN2?c>  E >" E >" N2Ac|You excuse yourself from the conversation as you back out of the room. \b "Well at least someone here has some manners! " !> sniffs. N2Bc> > E >" E >  E >  N2CcVal glances at you after you have properly excused yourself. "And what have you done that needs to be pardoned? " he asks with a slightly conspiratorial grin. "Are you about to confess your sins to me?" N2Dc>" QN2FcB"KRAWK! KRAK KRAK!" You beg the pardon of no one in particular. :N2Hc.You beg the pardon of no one in particular. .TS axP_n swimMO actorN-Sc>  E >" E >" N-Vc|You flail your arms and legs about wildly. The other tavern patrons gawk at you openly.\b "A game o' charades, eh? " says !> . "I love that there game!" \^!>^ stares at you hard. "You a bird? "\b "If he is, that's the oddest bird, I ever seen!" says !>F. \b "A chicken with its head cut off!" suggests the tavern maid, who then blushes and scurries off to do more work when she notices the tavern keeper staring hard at her. "I think he's chopping down a tree!" says !>7. \b "Chopping down a tree with his bare arms?" asks !>F. "To me he looks like he's windmilling. "\b You sigh and wonder whatever possessed you to try and swim inside the tavern in the first place.N-bc> > E >" N-fcYou flail your arms and legs about wildly as Val pauses to watch you. This goes on for several moments until Val finally speaks.\b "I must admit defeat. What, pray tell, are you doing exactly?" he says.N-gc>" N-hcYou flail your arms and legs about wildly, and finally look about surreptitiously, glad to discover that there are no witnesses to your sudden outburst. Perhaps next time you ought to try swimming in a body of water. N-jc>" N-kcFor several moments you flail your wings about wildly. Finally you come to the decision that trying to swim in the air is an exercise in futility. .st axvvv_ dream MMYou may rest, but you can never dream. That alone is reserved for mortals.    _  daydream2MO actorN)wc!<@C C You think about the oceans, about the distant seas, about waters that are filled with salt and tainted with other things. Other things such as poisonous sulphor spewed from the innards of the earth, or crusts of jagged ice larger than entire lakes, or mixed with the washed off sediment of distant, foreign lands. \b You think about the oceans filled with strange creatures... even stranger than the ones that you have imagined. You only know of half of them through whispered tales, stories of stories of stories that have been passed on by travelers who never saw such things for themselves. And the other half you know not of at all, for they live and die far from your sphere of influence.You think about the wars, for there is always one of them happening in some far off place. It seems something that mortals delight in taking part in. You wonder what it must be like-- for surely it must be different from the tiny, eternal struggles of influence fought between the lands of the fey. \b There should be armies of men and horses, so many that their bodies would darken hilltops and lands from horizon to horizon. There should be hails of arrows falling out of the skies like deadly drops of rain and the glint on glint of a sea of metal, of armour and swords and spears and other weaponry than men have made for themselves. \b And the sounds-- the screams and cries of dying mortals, the wails of defeat and shouts of triumph, the delicate clash and breaking of metal which finally leaves the fields dyed in shades of red. You've never really heard such a thing, for fear of frightening away the few humans huddled unknowingly within the safety of your lands.You think about the mages and a shiver goes through you at the thought. Aye, the fey are always interested in the mages. The only humans who pose any sort of risk to us-- perhaps the only creature in all the worlds to do so. It seems almost laughable that something so weak could endanger those so much stronger, and yet, so it is. \b And so the mages are the only way to escape... to well and truly leave behind the lands of the fey. A dangerous bargain to strike for both involved and one that ends in disaster most often than not, or so the stories go. It seems unthinkable for a mage to ever risk it when he could steal the powers of the fey for his own-- or at least a small taste of its powers. And for the fey to have such trust... \b You wonder what they do, such an odd pair when they strike off into the world. Not so much is said when a pairing does not go awry. There is Keilantra and her fey, off topling dynasties to the far east, still together and alive, or so you've last heard. And there was that wind mage on the northernmost continent who dared to bond to three fey-- but no, he was torn apart by them in the end, wasn't he?\b You muse to yourself. Your lands lie far off in regions unspoiled by the touch of the mages. The fey alone have reigned here and others had trespassed only on their sufferance. And so despite your great interest, the tales of the mages are even less known than those of far off battles and fantastic sea creatures. _ runaMO actorN$c>5" 5N$c&That would require a physical body. N$c>" E >  E >" N$cYou rush madly about the room. \bThe tavern maid takes notice of you and says "There's a chamberpot in the back corner over there."IN$c> > E >" N$cYou begin running and to your great consternation Val starts running after you!\b "What are you doing? Why are you chasing me?" you call behind you. \b "Why are you running from me?" Val calls back.PN$c> m 7N$c(You race about the edges of the lake. N$c>  E >" <N$c-Its far too late to run from this destiny! N$c>  ]N$cNYou grab hold of a trailing ribbon and prance about the columns of flowers. 9N$c>  N$cYou rush gaily about the forest until you run face first into an overhanging tree limb. The tree limb is soon disintegrated into ashes in the wind. N$c>  SN$cDWith a laugh you dash in an out of the rainbow bedecked fountain. N$c>" E >   N$cYou lope elegantly through the long colored grass. Behind you the trampled upon vegetation slowly rises and spreads their fronds once again. \N$cPYou rush about hither and yonder and end up running around in little circles. _  run amokMO actorN)c>5" bN)cSIn a moment... the conversation has turned far too interesting to interrupt now. N)cHa ha, yes! With a wicked cackle you begin rampaging across the countryside. Trees tremble within your path, grass and flowers crisp and wither away underneath your gaze, the waters boil and the skies turn a roiling dark gray. You rush wildly, madly about your lands, shattering rock and stone, raising hills where plains used to be, and razing hills into plains. \b In a frenzy you turn blue into yellow, solidify the air into round hard pebbles, and proceed to pull down the sky into your lake. Finally your mad rampage takes you back from whence you started. You stop, carefully dust yourself off, and allow everything to shimmer back into what it was once before, with none the wiser. N)c> > E >  E >! N)c\bVal stands here, looking about him in befuddlement. "I thought... for a moment... I smelled purple?" he says and blinks. And then confusedly stepping atop and smudging his own patterns, the mage wanders off to the southeast. >!>&">&N)c> > E >  D>  E >! N)c\bVal stands here, confusedly looking about him. "I thought... for a moment... I smelled purple?" he says and blinks. The sutras fall unnoticed from the trees as the mage wanders off to the east in befuddlement. >!"!>&N)c> > E >  E >! N)c\bVal stands here, confusedly looking about him. "I thought... for a moment... I smelled purple?" he says, blinks, and wanders off to the north in befuddlement. >">9&"9>&N)c> > E >  E >! N)c\bVal stands here, confusedly looking about him. "I thought... for a moment... I smelled purple?" he says and blinks. And then leaving the hole forgotten behind him, the mage wanders off to the west in befuddlement. m>"N)c> > E >  *N)c Your companions stand within the courtyard, thunderstruck.\b \bVal confusedly looking about him. "I thought... for a moment... I smelled purple?" he says and blinks. \b "Cheese?" Layna replies. \b And mumbling to himself, the Old Coot wander back within the tavern. >"N)c> > E >  E >  (N)cYour companions stand within the courtyard, thunderstruck.\b \bVal confusedly looking about him. "I thought... for a moment... I smelled purple?" he says and blinks. \b Layna mutters about cheese under her breath as she stumbles back within the tavern. >"!"N)c>  E >  [N)cLWith a wicked cackle you begin to gather your powers about you, preparing to rampa-- and suddenly Val lashes out at you, his blow sending you staggering back, wings outspread for balance. The strike seemed to sear into your very being, beyond the decorations of the flesh you wear... and so this is what it means to fight a mage. |N)c>   E >    {N)cQIn desperation you begin rampaging across the countryside. Trees tremble within your path, grass and flowers crisp and wither away underneath your gaze, the waters boil and the skies turn a roiling dark gray. You rush wildly, madly about your lands, shattering rock and stone, raising hills where plains used to be, and razing hills into plains. \b In a frenzy you turn blue into yellow, solidify the air into round hard pebbles, and proceed to pull down the sky into your lake. Staggers back from the onslaught of your power and you feel his hold on you slip. For the moment, you are free! C C) N)c>  N)cIn desperation you begin rampaging across the countryside. Trees tremble within your path, grass and flowers crisp and wither away underneath your gaze, the waters boil and the skies turn a roiling dark gray. You rush wildly, madly about your lands, shattering rock and stone, raising hills where plains used to be, and razing hills into plains. \b In a frenzy you turn blue into yellow, solidify the air into round hard pebbles, and proceed to pull down the sky into your lake. The two mages, one light one dark, for one blessed moment are struck still by your power. And then, as if renewed in their determination, their own powers flare around themselves as they strike out viciously at each other. N)c>  NN)c?That would most certainly irrevocably destroy your disguise. N)c> > N)cvVal stands here, confusedly looking about him. "I thought... for a moment... I smelled purple?" he says and blinks. _ kiss ssDelightful idea! But you'll need to choose what fortunate object shall be the recipient of your amorous advances.. axAAA_ blowh.c axppp_  mate with ,,A naughty thought flits through your mind.. ax]]]_ walkMO actorN%d>  E >" E >" PN%d)You casually saunter about the room. \^!>b takes notice of you and gives a whoop. \b "Whoo! Strut your stuff!" he calls out as his friend !>) shakes his head over his drinks. \b \^!>h slams her mug down upon the table. "He said the same thing to me a little while ago." she says cooly.N% d> > N%!d!You casually saunter about the !< H. Val pauses what he is doing for a moment to eye you appreciatively. N%"d>" ON%#d+Feathers all akimbo, you strut about the !> '. N%$d>" ~N%%d!You casually saunter about the !> '@. Too bad there's no one nearby to appreciate your fine form. .JK axHHH_ buy.! axPx2_  inspectBMOactorobjseqnoN(N(.|;;;_ follow.`l-MO actorN<  go north,MO actorN\ N-MO actorN<  go east,MO actorN[ P-MO actorN<  go south,MO actorN\ O-MO actorN<  go west,MO actorN[ Q-MO actorN< go northeast,MO actorN` T-MO actorN< go northwest,MO actorN` U-MO actorN< go southeast,MO actorN`  V-MO actorN < go southwest,MO actorN` W-MO actorN#<  go down,MO actorN[& S-MO actorN)< go up,MO actorNY, R|999_ push.CCC_ attach?.?SSS_j detach.!j+2MMM_  take off.!oj+2QQQ_ lockP.!P{}+2|:::_ close.yzp000_  inventoryMO actorN0N0<GN0%You% %are% carrying:\nN0 N0BN0%You% %have% . N0 N0N0)N0%You% %are% empty-handed.\nN0_ putn MMOactorprepioN,>M N,.!n_h^+20_ take ^MOactorprepio O9%retremcurrem2cur2totitot2 jNA NAp D o D n D h D j E! NANANANAcNA@NAE<NANANANANA NA NANANANA@NA NAE |D E NANANA NA tNA  @NA!E NA#NA$NA%  NA&NA'NA(3NA)NA+NA,NA.NA/wNA0NA1.aop+2jnhu|_ give? =MOactorprepioN-N-.?de|999_ read.5YYY_ turn.1?>P+2=|999_ flip.???_  look under.1@@@_  look behind.2AAA_ typeh.hKKK_ unplug.!j+2|;;;_ center.|;;;_ search.+3|:::_ knock.OOO quitMO actorO %yesnoN5GN5H.\bDo you really want to quit? (YES or NO) > N5IN5J\bN5K *N5MN5NN5ON5ROkay. N5SN5T9MO actorNW<NX+NY  verbosenMO actorN(`Okay, now in VERBOSE mode.\nN(a"CN(b"C N(c9MO actorNf<Ng+Nh terseUMO actorN&oOkay, now in TERSE mode.\nN&p!CN&q9MO actorNt<Nu+Nvd$$$ saveMO actorO%savefileN5File to save game inN5@KN5N5@_N5:An error occurred saving the game position to the file. N5!N5+N5 Saved. N5"N5N5N5 Canceled. N5!N5N5N5 Failed. N5!N5N59MO actorN<N+N.  restore%MO actorO(savefileN8File to restore game fromN8@KN8N8@&N8N8 Canceled. N8!N8N8N8 Failed. N8!N8uN89MO actorNS<NS+NS. debugoMO actorN&0$CN&17You can't think this game has any bugs left in it... N&29MO actorN5<N6+N7  restart=MO actorO (yesnoN8"N85Are you sure you want to start over? (YES or NO) > N8 N8  WN8 \nN8  N8>##N8YN8AN8 ,N8 \nOkay.\nN8N8N8N89MO actorNk<Nk+Nk  unscriptIMO actorN)!N)Script closed.\nN)9MO actorNx<Nx+NxX scriptMO actorO' scriptfileN7File to write transcript toN7@KN7N7@N7dAll text will now be saved to the script file. Type UNSCRIPT at any time to discontinue scripting.N7{N7N7 Canceled. N7PN7N7 Failed. N7'N7N79MO actorN<N+N.p/// undoMO actorN%@%E%bN%B(Undoing one command)\bN%C"C N%D>> N%E5N%G)No more undo information is available. N%H9MO actorNK<NL+NM|:::_ touch.|999_ poke._` drop =MOactorprepioN'N'.!h^+2\\\_ look4MO actorN%j" N%k|;;;_ sit on.|;;;_ lie on.AAA_ look through.x888_ eat.6|:::_ drink.|999_ pull. |p---_ standMO actorN0 ! D  ! ,N0 %You're% already standing! N0"(N0 N0<(&N0 N0#N0 N0N0N0 ttt_ helloKMO actorN&'#Nice weather we've been having.\nN&(_ show? =MOactorprepioN-1N-2.?_ belchuMO actorN&e>5" 5N&e&That would require a physical body. N&eHow uncouth! . axh(((_ sighMO actorN% f>5" 2N% f#That would reveal your presence. "N% fDolefully you sigh. N% f> > E >  E >  ?N%f3"\bExasperating, isn't it?" Val says with a wink..NM axd###_  breathfireMO actorN+f>" D >" 5N+f&You are in the wrong form for that. yN+f>  E >  E >" N+fYou breath a plume of fire at Val. The mage reaches out and your breath freezes into chunks of white ice that clatter and break against the dark ground. >N+f>   E >    E >" N+fYou breath a gout of flames towards the white mage. Your fiery breath hisses away into vapor within a handspan of its target. N+ f>  E >" E >" E >" N+!fCN+#f>  E >" E >" E >" N+$fC /N+'f#You breath forth gouts of flame. . ax$_  farewellMO actorN);f>5" 5N)f>  E >" E >"  N)?fJYou take your leave of the tavern patrons. The two old men wave at you, !> tilts her head above her drink, and the drunkard continues to snore away atop his table. \b "Come again any time!" the tavern maid calls out as she bustles past. N)Cf>  E >" E >" bN)Ffx"KAW! KAK KRAWK KAK COA!" you announce to the room. \b "Could someone please throw a boot at that crow or something?" !>_ asks as she rubs at her head. \b You huff your feathers in indignation and stalk outside. \^!>FP gives a great guffaw. \b "We've offended his fine sensibilities!" he says.\b N)Jf>N)Kf> > E >" E >  mN)Of^"KAK KAK KRAW!" you say to Val before flying off. \b "Farewell, Lord Raven," Val calls out. N)Qf> > E >" E >  E >  tN)UfeYou call out a farewell to Val. \b "Leaving me so soon, Snugglebums?" says the young seeming mage. 8N)Wf,You say farewell to no one in particular. .PO axIII_ bury.! axn>?x2EEE_  serenade?. ax|<<<_  Squeeze.}~ ax_ yawnMO actorN%f>5" 5N%f&That would require a physical body. :N%f>" E >  E >" N%fXHalf covering your mouth, you yawn widely and stretch. \b "I think we're boring him!" !>F says and then yawns loudly himself. "We're wearying myself as well! " \b "Rooms are available at the top of the stairs," the tavern maid announces as she bustles past. N%f>" E> > E >  E >  N%fsYou half muffle your mouth as you yawn widely. \b "Sleepy?" Val asks casually. "Perhaps we can bed down later."\b+N%fYou stretch and yawn widely. .VU ax O O O _ bark MO actorN%f>5" 2N%f#That would reveal your presence. N%f>" E >  E >" N%fYou carefully stand up, brush yourself off, and begin barking at the roof of the tavern. The other tavern denizens pause to stare at you. \b "He's gone barkin' mad!" says !>' as he slaps his thigh in merriment. N%f>" E> > N%fYou shift about the area, scuffing at the grounds, and then begin yowling and barking like mad. Val momentarily stops what he is doing in order to stare at you. \b "You may be in the wrong form for that," he says.  N%f>-" N%flYou whistle and there comes a great baying and howling. Suddenly the dark dog comes loping up towards you!N%f> > E >  E >." N%fVal's !>k @ eyes widen slightly as the shadow dog's muzzle swings in between the two of you. The flute music peters to a stop. \b "I have a sudden wondering for what lies over yonder hills," Val says airly to no one in particular. The silver flute disappears into his cloak and he saunters, very carefully, foot by foot and never glancing back at the shadow dog, over a shallow knoll to the north. N%f>>&".>>&!N%f> > E >  N%fA moment before Val was drawing patterns in the sand and then suddenly he has shimmied up into the lower branches of one of the metal trees. You blink up at him, wondering how he managed to move so fast. "/>C0N%f> > E >  N%fVal glimpses the shadow dog on the hunt and with a flurry of his dark cloak, he has pulled himself up into one of the birch trees. >>N%f> > E >  N%fWithout a single break in his chant, Val gracefully scrambles up the smooth slope of a nearby hill and out of the shadow dog's reach. >N%f> > E >  N%f{Val curses slightly at the appearance of the shadow dog and then dives into cover in the depths of the hole his has dug. >N%f> > E > m *N%fVal waves his hand absentmindedly at the shadow dog. It pulls up suddenly with a yelp and looks about confusedly. Val's gaze remains on the north and the dog's soon follows suit. Its nostrils quiver and then, suddenly, it wheels about and lopes away as fast as its legs can carry it. N%f> > E >  5N%f)Biding your command, the shadow dog hurls itself at Val, its lips pulled back in a rictus snarl. It is caught in mid-leap, frozen in the air for one hapless moment before, with a shriek, it is flung halfway across the lake. \b It crashes into the water and, motionless, sinks beneath the waves. >N%f>" qN%fbYou launch into a fit of barking, howling, and yowling at the quiet scenery that surrounds you. ON%f>" ;N%f/Alas, raven beaks were not made for barking. ."# axIII_ feed.!ab ax?x2|:::_ spank. ax_ clapMO actorN%;g>5" 2N%g>" E >  E >" N%?g*You clap your hands enthusiastically. \^!>y grins toothily at you. \b "See? My stories are appreciated! " he says with a wink. \b "Oh don't encourage him, " says !>F. N%Eg>" E >  E >" UN%FgFYou clap your hands enthusiastically. Val arches an eyebrow at you. N%Hg>" 5N%Ig&You clap your hands enthusiasticallynN%Jg>" ZN%KgNYou flutter your wings. Alas, clapping seems a bit beyond you in this form. .ZY ax4_ cryMO actorN$SgA simple emotion shared by human mortals, the showing of sorrow by the release of tears. Its something you haven't quite gotten the knack of yet. . axAAA_ whipP.RS ax_ acceptMO actorN'g>" E> > "N'gINSERT STUFF HERE?N'g3You give your acquiescence to you know not what. .  ax(_ rejectMO actorN'g>" E> > "N'gINSERT STUFF HEREPN'gDYou renounce you know not what, yet you renounce it all the same. .\[ ax_ crawlpMO actorN&g>5" 5N&g&That would require a physical body. N&g>" E> > E >  E >  1N&g"You drop to your hands and knees and scuttle about the grounds. Val eyes you for a moment and then begins to crawl after you. \b You sit up on your knees. "What in the nine hells are you doing? " you ask the young seeming mage. \b "Following you, what are you doing? " he replies. N&g>" E >  E >" ~N&gYou drop to your hands and knees and begin to crawl about the tavern floorboards, going under tables, and poking your way through chairs and benches. The tavern maid yelps as you brush past her legs, !>- draws back her own legs with a glare, and !>_ tilts halfway out of his seat to look at you. \b "Drop something important there?" he asks. N&g>" E> > E >  E >  N&gYou drop your feathered belly to the ground as you scuttle cautiously about the area. Val looks down at you in some surprise. \b "And they say you'd never see a bird crawling about like a snake!" he laughs. N&g>" gN&gXYou drop your feathered belly to the ground as you scuttle cautiously about the area. lN&g>" XN&gLYou crouch down low to the ground as you gaze surrepticiously around you. X_ playMO actorN%gOh, but you have been playing, having ever so much fun with the humans who are waltzing about your lands! Although, perhaps there was a game in particular that you were thinking of? . ax|:::_ braid. axx(((_  ScratchMO actorN(g>5" 5N(h&That would require a physical body. N(h>  E >" E >" EN(hYou anxiously scratch at an itchy spot where your cloak is chafing your delicate skin. \b "Got t' be careful o' those mites. They'll get at y' and eat y' up! Especially if you're sleepin' at an inn o' wayhouse..." says !>L. \b "Our beds have no mites in them!" the tavern maid sniffs in affront. N( h>  E >" E >" N( hYou absentmindedly scratch and fluff at your dark plummage. The tavern keeper notices this and huffs at the tavern maid, "Shoo that bird out of here, its got bugs on it!". \b You squawk in indignation at the thought. Insects? On you? The very accusation of it riles you up so much that you give the tavern maid quite a pecking and buffeting of wings when she obediently comes to shoo you outside. NN(h> > E >" E >  E >  N(hYou twist about and scratch at an annoying niggly spot in the center of your back. You assume that Val is paying you no heed until he suddenly says, "Need some help there? "TN(h> > E >" E >  E >  N(hxYou fluff and preen your feathers and are so caught up in scratching at a particularly itchy spot atop your plumed head that you do not notice the approach of Val until he is nearly atop you. The young seeming mage gives your head a good scratch and the itchiness verily vanishes away. \b You give a great "CAW!" at Val's presumptiousness and flap away to a safer distance. N(h>" 1N(h"You idly scratch at your waist. NN(h>" :N(h.You idly scratch and preen at your plumage. .VW axX_ waveMO actorN%'h>5" 5N%(h&That would require a physical body. }N%*h>" 1N%+h"You wave to no one in particular:N%,h>" &N%-hYou flutter your wings. .]^ ax|<<<_  unbraid. axX_ cooMO actorN$:h>5" 2N$;h#That would reveal your presence. N$=h>" 1N$>h"You coo at nothing in particular?N$?h>" +N$@hYou coo happily to yourself. . ax_ hideoMO actorN%h>5" 5N%h&You can't be more hidden than this. N%h>  E >" AN%h2You fade unseen into the shadows of the tavern. ^N%h>  hN%hYYou look stealthily about the courtyard before crouching down behind the apple barrel. N%h>  YN%hJYou quickly slip behind a tree and beyond the sight of any prying eyes. uN%h>  N%hYou slip in amongst the twinery of metal and glass, careful of the faintest of brushings, lest you accidentally skin yourself. N%h> m N%hYou look about the shores for a suitable place to hide, yet outside of diving into the lake itself, there are no secret places to be found. You finally settle upon skulking behind the tiny bonsai trees that forest the lakeshores. N%h>   N%hYou stalk out into the sea of wavering grass and flop over amongst the blades. The stalks rise high above your resting head, sealing you completely out of sight. N%h> > ~N%ho\b Val watches your actions with a soft chuckle. "Should I start counting to give you a head start?" he asks.N%h>  ZN%hKYou press your back against a flowered column and peer cautiously about. VN%h>  IN%h:You duck behind the rolling curve of a smooth red hill. N%h> b D > d D > c VN%hGYou fade unseen into the shadows of that fill the caverns and caves. uN%h>  D>   E >" GN%h;There is no place to hide. It is time to turn and fight. .!de axn@Ax2   _ juggle( MO actorN1h>5" 5N1h&That would require a physical body. - N1h>>N1h/You're not carrying enough things to juggle!  N1h>  E >" E >" N1h&Surreptitiously you begin to juggle !. As more and more eyes begin to turn towards you, your juggling becomes more elaborate and flamboyant. Figure eights, double circles, and reverses pass through your hands, faster and faster, in ever widening arches until it seems that its inevitable that you would hit the roof, the walls, or someone's head. And then with one last flourish you catch all your items and tuck them safely back under your cloak once again. N1h(<(KN1hN1hYou take a bow as the entire room bursts into cheers and clapping. \b "Would you come back every night and do that for us if we paid you? Say, a copper or three every day? Free food and board too, of course. " asks the tavern keeper. \b The offer is tempting. The tavern is your favorite place in all your domains. But if you appear too often, it is only inevitable that your disguise will eventually fall through. Some clever pair of eyes will take note of you, will notice the inconsistencies and flaws, will perhaps even remember how you have never aged since first appearing. And so this game, perhaps your best one of all, will end and you will never walk again as one with the mortals.\b "My apologies, milady," you say. "But I am merely passing through." \b "Ah well," sighs the tavern keeper. "You've quite a talent for that. Are you a wandering minstrel or gleeman, perhaps?" \b "Something like that." you say. N1hN1hG\bYou take a bow as the entire room bursts into cheers and clapping. N1hN1hN1hG\bYou take a bow as the entire room bursts into cheers and clapping. N1h1N1h(ixN1h> > E >" E >  E >  TN1h7You drop a few paces back from the pale haired mage and casually pull out a random assortment of items that you have been carrying. You begin tossing them up into the air, performing greater and more elaborate juggling tricks as you carry on. From the corner of your eye you see that Val has stopped what he was doing to watch you with some interest. \b Suddenly you turn towards the mage and begin lobbing all your things straight at him. Without missing a beat, Val catches each item and tosses them right back at you. You almost drop your things in surprise but continue doggedly onward, ratcheting up the complexity of each loop, higher and higher, far more complicated passes than one juggler could ever hope to do alone. \b You are not sure which one of you lost control of the circle or if perhaps you both failed at the same time; but eventually you find all your things scattered across the ground with both you and Val breathing a tad hard. \b "Too bad there was no one here to impress." you say. \b "Well, I'll say that at least I'm impressed with us!" returns Val. > iN1h>" E >  D >  sN1hdYou lack the proper concentration for that with the noise continuous shrieking through your mind. N1h>" `N1hQIt seems juggling is one of those things that requires the use of hands, alas. XN1h>" DN1h8In boredom you begin juggling through your inventory. . axX2 #MO actorNgiMO actorN=hilYour relationship with your western neighbor has been less than cordial. While every now and then you may rouse the Tree into conversation, the Beast only presses ever inward, ferociously attacking if he ever senses you drawing too near to his lands. You doubt that he is any more welcoming to others... one treads upon the lands of the Beast at one's own risk. eee#MO actorNli%MO actorN=miAnimals not of your own creation tend to be wary of your presence. Many of the mortal animals resident of the tavern have grown used to your company and even welcome it, yet the horses seem to be the most sensitive of all. A pity since you rather like horses. #MO actorNsiSMO actorN=ti4The fully developed fruit of this tree is priceless beyond compare. It can return life from death, give undying youth to the old, and all sicknesses give way to the power of this fruit, if you can pluck it that moment it fully blooms/ The moment before it falls from the tree, fated to disappear before it even touches the ground. Yet unaware of this, people always seek the unripened fruit for its wealth, and thereby lose the true treasure.\b Ambrosia, the food of the gods it has been called in legend, although its presence bodes for something darker still. `#MO actorNyiMO actorN=ziStanding upon them always filled you with a strange kind of loneliness. As if a part of you were bleeding away, as of a memory forgotten, as of the flutter of wings beating within a cage. X#MO actorN~iMO actorN=i{You idly wonder what in the world possessed you to create so many worts? Could you simply not make up your mind that day?$#MO actorNiMO actorN=iYour hidden room filled with your treasures. Things you could have created better yourself, but then they wouldn't be as special. #MO actorNiAMO actorN=i"You have been pilfering pots and pans from the scullery for as long as you can remember. There's not much to be done with iron or lead pots, yet tis worth it simply to hear the tavern keper swearing up and down about robbers and thieves and mice the size of rabbits carrying things away.  #MO actorNiMO actorN=imYou wonder who was the clever fey that managed to trick humans into believing that iron actually hurts us. (#MO actorNiMO actorN=iNot many toys pass this way, and stealing from innocent children is no sport at all. Spry, mischevious children, on the other hand...#MO actorNiTMO actorN=i5 You snatched this pedestal from a procession of people parading down the road on their way to some great wedding or funeral or orgy or something in the next village over. Why they were rushing about with a pea in a pedestal you were never able to find out before they left the tavern and went on their way.rrr#MO actorNi2MO actorN=i You've been pilfering pans from the tavern keeper for as long as you can remember. There's not much to be done with lead and iron pots, but tis worth it just to hear the cook swearing up and down about robbers and thieves and mice the size of rabbits carrying things away.#MO actorNiyMO actorN=iZNothing but a wide trail of dirt, yet it stands as testament to man's power of the fey. #bMO actorNiMO actorN?iSuch an odd, confusing emotion full of the depths of joy and despair. Or so you have heard. Tis simply not something you have had the opportunity to indulge in nor is it something that would be particularly beneficial to a fey. What is there to love within a fey's territory? \b You suppose a fey must love itself, but you hardly think that is the true emotion written about to such great lengths in books and stories. MO actorN iTMO actorN-i5That is not something within your power to create. T#bMO actorNiMO actorN?iYou must admit to being a bit jealous of the mortal's ability to dream. You wonder what it is like... where anything is possible and yet nothing makes sense. It is within their dreams that it seems that humans are closest to fey in their dreams. MO actorN\iTMO actorNi5That is not something within your power to create. qqq#bMO actorNi/MO actorN?iBesides other rival fey, they are the one true enemy of your kindred. Humans possess very little power... or 'magic' as they are wont to call it... on their own. Yet a precious fey individuals do have a talent, a small talent. The power to absorb another powers... or more specifically to consume a fey.\b The details of the process you are not privy to for any fey in close contact does not live the tell the tale. Yet even though a fey's whole essence is consumed, only a small portion of their power remains within the mage. And thus much is lost for so little gained. Yet a mage could indeed become very powerful after consuming many fey and so their hunger is never sated. Or so you have heard for in all your years you have never known of a mage to come anywhere near this backwoods territory, preferring instead to congregate in their powerful cities in kingdoms far away.\b For those mages not content with controlling merely a portion of a fey's power there is one other choice, although a far more dangerous one for them. A bonding whereby a mage links its essence with a fey and through it has access to nearly its entire powers. Yet these things tend to end badly for both parties it seems, with the fey eventually turning against the mage and destroying them both in the process. FFF#bMO actorNiMO actorN?iThey are you and your kindred, the ones of a thousand names, the unchallenged rulers of the wild lands. Nameless, bodiless, ageless with no true physical form or shape, they control all within their dominion. The very fabric of reality bends to your will, to give shape and form, change and creation and destruction to everything that steps within your lands. And so to the lands you are bounded, never journeying beyond what you claim as your own, lest your very essence slip away.  #bMO actorNi$MO actorN?iYou cannot die, at least as mortals do. You have no true form, no body to leave rotting upon the earth. You are nothing but a soul, one that can take the shape of flesh and blood at will, yet only an essence, a will, at your core. \b And so you cannot die, you simply cease to be. If you wander too far from your lands you will merely evaporate fade away into nothingness. Or worst, if you are consumed by a mage, then you will be cast into nothingness with only a portion of your powers lingering within the mage. MO actorNiiMMO actorNi.You will have to be more specific than that!p000#MO actorNiMO actorN=iYou have a bond with your land... you give shape to the land and in return the land grounds your essence, holding it together, giving you life. You wonder if the bond with a mage would be similiar... only linked to a human and not the earth, and so able to travel at your leisure... or well travel as the human wills it. The mage controls the bond, it seems, controls what the fey can or cannot do... or do they? It is a strange and unknown thing in these lands. yyy#bMO actorNiMO actorN?iThis is your life, this land which obeys your every whim and will. And so as long as it exists so do you... or is that the other way around? This is eternity. MO actorNiMMO actorN)i.You will have to be more specific than that!SSS#MO actorNiMO actorN=iNames have power and this is especially true for the fey. To know the name of the fey is to have access to the fey's own core, to the source of our will and power. And so our true names are jealously guarded unknown by all but the fey itself.kkk#bMO actorNi"MO actorN?iHumans are odd creatures. Mostly weak, defenceless, and easily bendable to our will, yet the few of them with power present the greatest danger to the fey. You have always found them rather interesting and so you carefully cultivated the tavern, laying down the deception for years upon years, generations upon generations, that the tavern was built on empty lands free of fey influence.\b And so the humans came and stayed with their stories and their laughter about the kindgoms and countries and lands, oh so far away. And so you guarded them, all unknowing, from the attacks of the other fey, from other encroaching creatures, until the little Red Dragon Wayhouse had the reputation of being one of the safest stopovers in all this land. \b The human was your first chosen form and one you have perfected over the years. And while you walk amongst them so infrequently lest anyone with a long memory should recognize you for your ageless self, the short time you spend in their company is your greatest form of amusement.MO actorNgiMO actorNiWhile not particularly magical, humans present their own problems in creation. Most of your attempts have resembled shadow zombies more than any type of man or woman you have ever beheld. p---#MO actorNiMO actorN=iYou have always loved rainbows. And pretty, sparkly, shiny things. Anything of beauty or anything that could hold your attention. And yet oddly, all of your chosen forms are dark, nearly undiluted black. #MO actorNipMO actorN=iQA raven is an excellent form for a stealthy fey. It naturally blends in with the surrounding countryside, possesses the wings to fly about unhindered, and yet does not bring about the flashy attention that hawk or eagle or other suck hunting bird would bring. And it is a rather handsome bird to boot, as aesthetics is also important. ttt5#bMO actorNjXMO actorNAj9It has taken you many years to master the form of a dragon. It was especially hard having never seen one with your own eyes... they are rare enough as it is, nevermind finding one foolish enough to wander through fey territory. The dragon is the most powerful of the magical creatures, save perhaps for the unicorn, but the unicorn presents quite a bit of difficulty to transmogrify and transform. \b And so through the many, many years you pieced it together, from drawings and pictures and traveler's tales... and then even more years before the power of flight and fire was mastered. Yet nothing can quite match the thrill of seeing some poor sod's face when a full fledged dragon comes swooping down upon them. And you daresay you did a better job than the the artist of the potbellied thing on the tavern's signpost. MO actorNjMO actorN jIt took you many years upon years to be able to form your essence into the shape of a dragon, nevermind having to form one from nothingness. P#bMO actorNjMO actorN?jLike the largest of lakes, yet with the taste of salty tears upon it, with the rolling movements of waves as the waters breathe... yes, you would love to beyond the seas. MO actorNjMO actorN5jYes, you shall bring forth the salty seas to drown your enemies and sweep them all away! Destroying everything in its wake... perhaps you haven't quite thought this through enough. #bMO actorNjMO actorN?jAs a fey your life is bound to the earth, yet your soul yearns for the skies, with two of your forms possessing wings that can never soar as high as you desire. MO actorNjXMO actorN+j9The one above your head is quite satisfactory for now. X++++.bM flame Great gouts of flame leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. MO actorN-j*MO actorN/j>  E >" VN3jAmongst a chorus of gasps you summon forth great gouts of flame in midair. The flames lick greedily at the newly waxed floor and catches within the dry wood of the tavern walls and timbers. \b Behind you some woman, either !>3 or the tavern maid, lets loose with a piercing high pitched scream. The drunkard awakens with a snort and nearly bowls you over in his sudden rush to leave the building. Tables, chairs, and benches are overturned in the chaos as the tavern denizens scramble to get out of the way. \b "FIRE!" some helpful person shouts and the stout tavern keeper is pushing past you with a basin full of washwater, as if such a thing could ever hope to stop the inferno now raging within the front room. \b You have to give credit to the old men, with more courage than sense, trying to beat at the edges of the flame with their ratty cloaks. And then one such cloak catches aflame within the hands of its owner setting the middle of the ceiling into fire. Everyone retreats in the face of the wall to wall blaze. \b All save for you. You stand in the midst of the inferno, watching the flames dance about in colors of blue, gold, and red. Observing the plumes of smoke drifting in thick pools across the room, first pale and then darker and darker as the building is consumed. Fire licks at the upper stairs, at the floor below, and the ceiling above, burning and burning and burning until there is nothing left to kindle. \b You stand amidst the ashen dark wreckage of what was once the tavern, your favorite place in all your domains. Oops. N;j">&"N=j> > E >  E >" E >" NBj]In desperation you summon forth great gouts of flame that leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. Val leaps back from the sudden blaze, the flute held loosely in his hands.\b You are free. With a great fluttering of dark wings you are airborne once again, circling once, twice, thrice, and then you swoop out of the sky and steal the silver flute from Val's grasp. The mage's head whips around towards you, his hand raising, and then he hesitates and you are gone, soaring away to the northeast.\b Val pursues you on foot but he is quickly left behind in the sands of the grove. You fly over your lake, pausing only to drop the silver flute into its clear waters, before circling back. With a "PUFF" the fire is easily put out before it spreads and damages the rest of the meadows. >&>>&!'NDj> > E >  E >" E >" NMjeIn desperation you summon forth great gouts of flame that leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. Val leaps back from the sudden blaze, the flute held loosely in his hands.\b You race forward and snatch the heinous thing from his grasp. Val turns quickly towards you, his eyes narrowing. \b "Your music is wretched," you say. "I can play far better," and you put your lips to the mouthpiece of the flute and blow such a screeching shrill note that it sends both you and Val staggering as you clutch at your heads. \b Val pries the flute away from you while you are distractedly wondering if you should try to tear your ears off or not. "I think that's quite enough flute playing from the both of us today. " he says. Or you think he says. He could have been speaking about drink fat white earfluff from bootslaying growth at a buffet. \b Val tucks the flute back underneath his cloak and, still shaking his head a bit, wanders off to the north. With the mage's back turned to you, you carefully put out the fire before it can spread any further. >>&>&!SNOj>  E> > E >"  NUjWith a wicked cackle you summon forth great gouts of flame to consume the intruding ofuda. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. You bask in the glow, in the warmth, as the fire eats away at its meal. \b And then in a shower of multicolored sparks the nearby tree catches aflame and then the next and the next. The albino trees that you labored so hard to create with their strange sweet smelling sap ignite like so much dried kindling. From branch to branch to fire leaps, until all around the trees are brimming with blossoms of flame. \b With a curse Val covers his face with his cloak and rushes out of the forest. >!">&!>&NWj>  E> > E >" NbjWith a wicked cackle you summon forth great gouts of flame to consume the intruding ofuda. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. You bask in the glow, in the warmth, as the fire eats away at its meal. \b And then in a shower of multicolored sparks the nearby tree catches aflame and then the next and the next. The albino trees that you labored so hard to create with their strange sweet smelling sap ignite like so much dried kindling. From branch to branch to branch the fire leaps, until all around the trees are brimming with blossoms of flame. \b "Oh gods, my trees!" you yowl in pain as wreathes of smoke hang thickly in the air and petals of sparks rain down from the trees. "Do something!" you yell at Val. \b "Me? Do something?" says the mage as he looks all about him, at the forest all aflame from tips of blazing leaves down to the stony ground. "It's too late!" he coughs. "We have to get out of here!"he says as you steadfastly ignore him. \b "Hark! Snugglebums!" and Val finally grasps your shoulders and drags you bodily out of the forest towards the barren earth of the hills. \b">>!>&!>&Ndj>  E >  E >" NrjWith an inwardly wicked cackle you summon forth great gouts of flame amidst shrieks of surprise from your companions. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. And then the plumes of fire reach out arms towards the humans scattered about the courtyard. And towards you as well, lest you feel left out.\b "Great gods!" yells Old Coot. "Tis like the story where some fool caught the phoenix and it built up a nest and set everyone on--" the old man's story is cut off as he dashes inside the tavern. \b "I don't know if it's so wise to be running into a wooden building" Layna says as she backs away carefully from the flames. And with that the fire flares up once more and then collapses upon itself, embers dying away into ashes that flit away in the wind. \b "I don't suppose either of you dropped your pipe in the straw?" Layna says dryly as she wanders over to the horse trough and washes her arms, all the while still eyeing the remnants of the blaze. \b "A welcoming gift from the fey, I should think," says Val. \b "Its power extends all the way here?" says Layna as she purses her mouth. \b "To the edges of the courtyard, most probably," you assure her. >"!<& Nuj>  E >  E >" E >  NjWith an inwardly wicked cackle you summon forth great gouts of flame amidst shrieks of surprise from Layna. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. And then the plumes of fire reach out arms towards the humans scattered about the courtyard. And towards you as well, lest you feel left out... burning higher, brighter...\b "It's going to set the tavern on fire!" Layna yells out. \b She's wrong, you would never let something so foolish happen to your tavern. But she would have no way of knowing this, nor Val either, who seems to have taken her warning seriously. The young man edges over to the horse trough, dips his fingers into the water, and flings the droplets towards the blaze. \b Only they are droplets no longer, but a slender stream of water that rains down upon the fire, quenching it with a bubbling hiss. Both you and Layna stare at the pale haired stranger. \b "A mage," Layna says. "You are a--" and color drains from her face. \b "I do know a bit of magic," Val says simply as he gazes at the girl. And all your attention has turned upon him. \b "A bit too much for my comfort." says Layna. "I have no wish to be involved in such a fey hunt. Good day to both of you. " The maiden hitches her divided skirts close to herself and half runs to the tavern. \b "More afraid of me than of the fey," Val muses, his tone dry. \b "I can't say I blame her," you reply and Val turns to you with a half smile. \b "And yet you won't run away?" he says, not truly asking. "Shall we be off then?" and Val pulls his satchel across his shoulders and sets off for the northwest. >>"!">&Nj>  E >  (NjYou summon forth great gouts of flame to burn and consume the mage. With a roar the arms of the blaze reach out towards Val, yet they slow and stop a mere handspan from him, dark smoke hanging thickly, glowing tendrils licking forward, yet unable to touch him.>vNj>  E >" E >" NjC.Nj>  E >" E >" NjC Nj>   E >    Nj]You summon forth a great gout of fire to consume the white mage. From deep with the flames !> ! Lorekosi  the mageB laughs and the fires sputter out with trailing wisps of smoke. >  Nj>  E >   E >" NjYou rain fire down from the heavens. Lorekosi raises one hand upwards and summons forth a barrier as his eyes never leave the figure of Val. Nj>  E >   E >" NjYou rain fire down from the heavens and upon the figures of the two mage. Only rhe faintest bit of smoke wisps up from the dark coat of Val and Lorekosi remains as ever untouched.  NjWith a wicked cackle you summon forth great gouts of flame. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. You bask in the glow, in the warmth, before it dies away into nothingness once again. Nj>  Njz\b Val, who has silently watched all of this with nary a comment nor a movement, turns away from the last dying embers. bM  spiders swarm of insects Swarm of insectsMO actorNZj$MO actorN~j>  (N~jYou summon forth a swarm of insects and the tavern maid gives a squeal as suddenly black spiders come pouring out from beneath the tables and chairs. Butterball arches his back and hisses as the tavern patrons leap up from their seats and start standing upon them. \b "What is all this racket?" says the tavern keeper as she comes storming into the room. She takes one look at the swarm of spiders and procedes to douse them with her pot of boiling water. "That's the one bad thing about spring..." she saws. "All the creepy crawlies."$N~j>  E >  WN~jYou summon forth a swarm and suddenly a cloud of darkness descends from the sky. Thousands upon thousands of locusts fall upon you and your companions. \b "Great gods, tis the plague o'--" and the old man's words are cut off as he rushes back inside. Val and !> take shelter within the stable as you wander around the horde, who are somewhat annoyed to find no plants to feast upon.\b "Within a few moments they are gone once again. \^!>_ peeks around the door of the stable as Val flicks off a few lone stragglers from his cloak. N~j>"N~j>  E >  E >  E >" YN~jYou summon forth a swarm and from beneath the pebbled stones of the courtyard scorpions come crawling forth, their stinging tails held at the ready, venom dripping from their tips. As one the skitter across the ground and charge towards your two companions. \b Val steps calmly forward and raises his hands. There is a pop and sizzle and the sudden smell of burning. The scorpions are dancing madly, twitching and writing as smoke curls up from their chitinous bodies. They lash at wildly at the air at each and finally sink into the shadows of the earth once more and disappear. \b Layna is gawking up at Val now, and all your own attention has been pulled to him as well. "You--" she says and falters. "You are..."\b "A mage?" Val asks lightly and you draw back slightly. \b Layna's indrawn breath in quite audible. For a moment there is silence and then... "I see," she says. "I think it would be best if I returned to the tavern. " and she rises to her feet and, with many a backward glance, makes her way back inside. \b "More afraid of me than of the fey," Val says with a soft, dry laugh. \b "That makes perfect sense to me," you reply and Val turns to gaze at you. \b "You're not running off as well, are you?" he asks and yes, the damn mage is smirking. \b "The others have far too much common sense to go on a fey hunt with a mage, " you say. "All except for me, who has no sense at all. "\b Val laughs at that. "Then let's be off, shall we?" he says, and hiking his satchel up upon his shoulders, the mage strides off to the northwest. >>!""">&N~j>  E >  E >" 4N~jYou summon forth a swarm and from the tree leaves descends a multitude of beetles, gold scarabs and ladybugs and brown wood beetles flitting and crawling down the pale tree trunks. They fall upon the sutras, their mandibles working ferverishly until only the smallest scraps blow away in the whispering wind. Their mission finished they disappear into the trees once again. \b "Beetles..." says Val. "I must admit, I was not expecting that." And with a cheery whistle to himself, the mage starts off to the east. !>&!">N~j>  E >  N~jYou summon forth a swarm and a cloud of stinging wasps descends upon the mage. They disintegrate into trails of black sand as soon as they land upon Val's skin.>" N~j>   E >    N~jYou summon forth a swarm and at your call the butterflies rise once again, their wings turned into the sharpest of sliver of glass as they lash out towards the white mage. > "  N~j>  N~jYou summon forth a swarm and the sky darkens as insects of every variety, locusts and flies and mosquitoes and beetles and moths and butterflies come rushing to your air, their bodies fragile yet their numbers strong. N~j>  E >  E >" N~jYou summon forth a swarm and as the day darkens around you the sound of buzzing fills the air. An evil, menacing sound... and so they descend upon you both, their stingers held at the read. Ninety nine times ninety nine bees, buzzing with their rage. Has you really summoned so many? \b They chase you and Val out of the hills and around back towards the tavern. Yet the mage refuses to bring the destruction down upon the patrons, and you are in agreement, and so you flee through the forest, up to the edges of the lake, and round again to the lip of the red hills before, with great glee, within the shadows of the fountain you manage to destroy the last bee into so much flying ash. \bN~j>  E >  E >" E >" 0N~j"And now I remember why I despise bees so much," you say as Val lies panting on the ground. And then with great curiosity you watch the mage roll over, gaze at the fountain, and then beginning digging into the loose soil with great alacrity. >>>&>9&"9N~j>  E >  E >" E >" 6N~jAnd now you remember why you despise bees so much. Val lies panting on the ground next to you. And then with great curiosity you watch the mage roll over, gaze at the fountain, and then beginning digging into the loose soil with great alacrity. >>>&>9&"9N~jYou summon forth a swarm and a cloud of fluttering pale moths flits past you, their wings like beating cobwebs before they disappear into the sky once again. Pretty, if not precisely what you were aiming for.   5bMIMO actorNj*That would draw a bit too much attention maze A great green maze of perfectly pedicured hedges, tall as two men standing on shoulders, and stretching outwards as far as the eye can see. MO actorN jMO actorN0j>  D >  =N0k.Alas, there is not enough room for that hereN0k>  E >  N0kGreen rises all around you, higher and higher, above your head, pushing towards the sky. And so you stand in the midst of a great green maze of hedges.> >&N0k> > E >" E >  E >  E<" N0k\bVal tilts his head back, wanders a few paces down an arm of the maze, and then skillfully clambers up the side of the hedges. He carefully balances across the top as he follows the edge of the maze wall to its end. N0k> > E >" E >  E >  E >" E<" N0k\b"That is grand style cheating!" you tell the mage as you follow him on the ground. Val laughs and tosses his head. "I say tis being clever," he replies. N0k> > E >  N0 kJAnd so saying, Val jumps down off the maze and wanders off to the north >"!!>&>&N0 k> > E >  N0 kNAnd so saying, Val jumps down off the maze and wanders off to the southeast >"!>&>&N0 k> > E >  hN0 kIAnd so saying, Val jumps down off the maze and wanders off to the east >"{N0k> > E >  UN0kIAnd so saying, Val jumps down off the maze and wanders off to the west m>"!>&MO actorNk[MO actorN,k<You abstain from wandering befuddled around your own maze.bMO actorNkHMO actorN=k)That is just a tad beyond your powers. """"bM( lightning strike <<Streaks of lightning flicker through the bright blue sky. MO actorN,k!MO actorN.k>  E> > E >" E >" N9kFrom the clear blue sky a lightning bolt strikes, arching straight towards the mage. Val nimbly leaps aside, but his hold on the flute loosens and it flies from his grasp. The lightning forks, a little branch reaching out towards the flute, sending it flipping end over end over your head and beyond. \b You turn about to gaze at the remains of the flute lying in a hissing, rapidly congealing puddle of silver goo. \b "It seems your music was not being appreciated," you say and Val walks up to stand by your side. \b "Now whatever would give you that idea?" he asks innocently as he gazes up at a deep blue sky free of all storm clouds. \b You lean forward and poke the silver puddle with one toe. Yes, it was cooling quite nicely. "Do you want it back?" \b "I think I can live without it." Val says dryly and he smooths down his cloak. The mage turns from you and begins walking to the northwest. &>>&">&!N;k>  Nk>  E> > E >" E >" NAk^From the clear blue sky a lightning bolt strikes, arching straight towards the mage. Val nimbly leaps aside, but his hold on the flute loosens and it flies from his grasp. The lightning forks, a little branch reaching out towards the flute, sending it flipping end over end over your head and beyond. \b You turn about to gaze at the remains of the flute lying in a hissing, rapidly congealing puddle of silver goo. Val shakes his head and clucks softly. "No appreciation for fine music," he says to no one in particular as he smooths down his cloak. The mage turns away and begins walking to the north. >&>>&">&!ANDk>  E> > PNJkAWith a a monumental 'CRACK' of thunder, several lightning bolts descend out of the puffy blue sky. Val ducks close to the ground as the bolts whiz high over him, drawn like moths to a flame to the black metal trees.\b "Uncommonly strange weather we're having," Val says wryly as he gazes up at the beautiful blue sky. NLk>  NNkLightning descends from the heavens and darts about the forest. You watch it carefully, lest a stray bolt go awry and strike down one of your precious trees. NPk>   E >    NQkA bolt of lighting leaps straight from you to the white clad mage. He staggers back a bit, surprised yet ever unsinged, and you sense some of his contro slip from you.>  NSk>  E >   E >" NTkA chain of lighting rears down from the skies, striking a circle all around the white mage, yet still unable to touch him. In counterpoint, Val summons forth the earth, to rise and strike beneath Lorekosi's feet. And yet the white mage still repels you both. NVk>  E >   E >" NXkYou summon forth a chain of lighting, arching arc of the clear blue skies and striking down without all without discrimination. You feel only the faintest flicker of warmth as a bolt passes through you. N[k>  E> > N]kLightning flashes above you, waves upon waves of strikes flicker down from the heaven, each bolt aimed with unerring intent at the mage. Without dropping a single syllable of his chant, Val edges underneath the safetly of an overhanging stone outcropping. N_k>  E> > E >" ~N`k(<(KMNakNfkeVal ducks into the hole he has been digging as a flare of lightning comes crashing into the ground. Little sparks dance around the waters of the fountain, through the mist heavy air and the moisture saturated earth, and a shock travels up your body. It can't truly hurt you, but still... perhaps lobbing around lightning bolts here is not the wisest isea.\b Val pops up again, brushing flecks of dirt out of his hair. "Are... are you hale and fine?" he asks with some hesitation and gestures towards your head. \b You hurriedly smooth down the locks of hair that are trying to stand at attention on your scalp. NgkNhkNikEYou decide you've had enough hair raising experiences for one day. Njk~NkkNlkCYou decide you've had enough hair raising experiences for one day(4Nok>  E> > E >" Nqk(<(KNrkNukVal ducks into the hole he has been digging as a flare of lightning comes crashing into the ground. Little sparks dance around the waters of the fountain, through the mist heavy air and the moisture saturated earth, and a shock travels up your body. It can't truly hurt you, but still... perhaps lobbing around lightning bolts here is not the wisest idea.\b Val pops up again, brushing flecks of dirt out of his hair as you try to smooth down the puffball of feathers that is your plumage.NvkNwkNxkEYou decide you've had enough hair raising experiences for one day. Nyk~NzkN{kCYou decide you've had enough hair raising experiences for one day(14 N}k>  E> > Nk~A great blaze of lightning flashes out of the bright blue sky, crashing into the middle of the pebble strewn courtyard with a sizzle. Your companions stand in shocked stillness, staring at the large scorchmark now in their midsts. \b "No thunder..." Layna muses half to herself. \b "What in bloody--" begins Old Coot. \b The lighting this time is smaller, still striking in eerie silence, a series of slender bolts that reach out towards the mortals scattered about the courtyard. And you as well, lest you be excluded. \b "GRAK!" the Old Coot shouts eloquently and he jams his hat upon his head and bolts to the tavern door, all the while muttering about dragons shooting lightning from their eyes. \b Layna stares after the departing old man. "Fey?" she asks. \b "Most assuredly," replies Val. \b "Is its aim really so poor or..." she says. \b "Was it missing us on purpose?" Val finishes. >""Nk>  E> > E >  E >" Nk]A great blaze of lightning flashes out of the bright blue sky, crashing into the middle of the pebble strewn courtyard with a sizzle. Your companions stand in shocked stillness, staring at the large scorchmark now in their midsts. \b "No thunder--" Layna begins and cuts off in a squeak as another volley of bolts descends from the skies. \b The lighting this time is smaller, still striking in eerie silence, a series of slender bolts that reach out towards the mortals scattered about the courtyard. And you as well, lest you feel excluded. \b Val strides forward, towards the cowering Layna, and the lightning veers and arches like a live thing, reaching towards the pale haired stranger. And it slams against something, little balls of sparks crackling through the air, reaching but unable to touch Val, pressed up against an invisible barrier. The lightning falls away and disappears as if it never was. \b Layna is gawking up at Val now, and all your own attention has been pulled to him as well. "You--" she says and falters. "You are..."\b "A mage?" Val asks lightly and you draw back slightly. \b Layna's indrawn breath in quite audible. For a moment there is silence and then... "I see," she says. "I think it would be best if I returned to the tavern. " and she rises to her feet and, with many a backward glance, makes her way back inside. \b "More afraid of me than of the fey," Val says with a soft, dry laugh. \b "That makes perfect sense to me," you reply and Val turns to gaze at you. \b "You're not running off as well, are you?" he asks and yes, the damn mage is smirking. \b "The others have far too much common sense to go on a fey hunt with a mage, " you say. "All except for me, who has no sense at all. "\b Val laughs at that. "Then let's be off, shall we?" he says, and hiking his satchel up upon his shoulders, the mage strides off to the northwest. >>!""">&Nk>  E >  NkYou summon forth great bolts of lightning that you hurl at the mage. He does not even blink at the lightning splinters into sparks all around him. >ANk5Lightning flitters across the sky at your command. CCCM congealed silver puddle OOAll that remains of the flute is a misshapen congealed puddle of silver goo. MO actorNoMO actorNonThe metal itself is smooth in between the pocks, but it has congealed in the shape of many waves and bumps.  h-%-%-%-bM( strong winds ##A strong breeze blows around you.MO actorNbk,MO actorNk>  E> > E >" E >" NkYou summon forth winds that ripple through the greenery, wildly snapping colored ribbons and blowing forth a storm of petals through the air. The flowered columns tremble and quake in the fury of the gale, and Val staggers back, yet continues to play all the while. \b The piping of the flute rises and falls and is snatched away by the winds, and your mind clears. For the moment you are free. !C)H"*Nk>  NkqA gentle wind blows through the tavern carrying with it the scent of newly budded flowers and rich dark earth. )Nk>  E> > E >" E >" NkYou summon forth winds that ripple through the greenery, wildly snapping colored ribbons and blowing forth a storm of petals through the air. The flowered columns tremble and quake in the fury of the gale, and Val staggers back, yet continues to play all the while. \b The piping of the flute rises and falls and is snatched away by the winds, and your mind clears. The breezes catch within your dark wings and you are lifted far and away. For the moment you are free. !C)H"'Nk>  E> > E >" E >" NkYou summon forth the winds once again, but this time a pocket of still air surrounds you and Val. And so it seems the mage is summoning things as well. &Nk>   E >    TNkYou summon forth the winds, the gales, and a cyclone from the heavens. The skies spin above you, whirling into a single point, and stretching out towards the white clad mage. And then the breezes are dispelled, surging away from !> ! Lorekosi  the mage" in a barely perceived glimmer. >  W%Nk>  E >   E >" NkYou summon forth the rage of the winds, which whirls screaming down upon the white clad mage. He steps back, and again, and thrice and then the winds are dispelled with a whisper. f$Nk>  E >   E >" wNkhYou summon forth the winds which lash and whip at the figures of the two men, clad in dark and light. #Nk>  E> > E >" NkYou summon forth the winds and from the heavens a cyclone descends. White puffy clouds whirl about in the skies above as the tornado touches down upon the ground. Sand fills the air amongst the crinkle and crash of breaking glass as you stand in the eye of this storm your !> hairclothes and hair` whipping about in the wind. \b Finally the air stills once more, the finest particles of sand still wafting through the faintest breeze. Much of the glass within the metal trees lies broken with drifts of sand dunes where there were none before. And of Val's patterns there is no trace. \b Val stands up from beneath a nearby pile of sand and gives !> himself his clothes! a good shake. "Well, that was amusing" he says. \b "Speak for yourself!" you retort. And perhaps you did get carried away a bit. Somehow you think you'll be finding bits of sands all over your body until you finally change out of this form. \b "Never had a good sand shower?" Val laughs!> .$! as he brushes off his satchel.k "Shall we be off then?" he says and begins stalking through the sand, wending his way to the southeast. Nk"9> >E&">!>&>&Nk>  E> > E >" NkYou summon forth the winds and from the heavens a cyclone descends. White puffy clouds whirl about in the skies above as the tornado touches down upon the ground. Sand fills the air amongst the crinkle and crash of breaking glass as you stand in the eye of this storm your !> hairclothes and hair` whipping about in the wind. \b Finally the air stills once more, the finest particles of sand still wafting through the faintest breeze. Much of the glass within the metal trees lies broken with drifts of sand dunes where there were none before. And of Val's patterns there is no trace. \b Val stands up from beneath a nearby pile of sand and gives !> himself his clothes a good shake. "Nothing like a good sand bath?" he laughs and begins stalking through the sand, wending his way to the southeast. Nk"9> >E&">!>&>&Nk>  E> > E >" E >" Nk(<(K{NkNkcYou summon forth the wind to blow the sutras away. It shakes through the trees, tossing the hair !> and clothes of you and Val hither and thither, and sending the offending slices of paper trembling against the bark of their trees. Yet it still cannot pluck them away. NkNNkNk!You call forth more winds and the petals are shivered from the trees, sending a multicolored rain swirling amongst the branches. Val has raised his hand against his eyes to peer into the breeze as you brace yourself against the trunk of a nearby tree. And yet the sutras still cling on. Nk>M&NkNlNlYou extend your power and wind goes wild, tearing petals and leaves from their stems, snapping twigs and branches, and hurling itself between the trees until they groaned in agony. And finally, one by one, the sutras are ripped away.\b "We should leave before..." Val calls out to you and the rest of his words are snatched away. The mage turns into the face of the wind and forces his way to the east. C)>!"!>&>&Nl>  E> > E >" E >" ANl(<(KN lN l`You summon forth the wind to blow the sutras away. It shakes through the trees, tossing Val's !> and clothes hither and thither, and sending the offending slices of paper trembling against the bark of their trees. Yet it still cannot pluck them away. N lN lN l&You call forth more winds and the petals are shivered from the trees, sending a multicolored rain swirling amongst the branches. Val has raised his hand against his eyes to peer into the breeze as you cling tenaciously to the thick branch of a nearby tree. And yet the sutras still cling on. Nl>M&NlNlNl7You extend your power and wind goes wild, tearing petals and leaves from their stems, snapping twigs and branches, and hurling itself between the trees until they groaned in agony. And finally, one by one, the sutras are ripped away.\b The mage turns into the face of the wind and forces his way to the east. C)>!"!>&>&!rNl>  E> > KNlYou call forth the winds which descend out of the calm blue skies above you. Drifts of red dust are kicked up amongst the hills and even though Val tries to cover his face with his !> hands cloak+ he begins to cough and choke. \b Billows of red clouds surround the young seeming mage as he tries to hack up a lung. Val pauses and seems to try to speak, which causes him to choke all the harder. And in a staggering rush, Val goes under the red arch and away to the greener lands of the north. Nl>">9&"9>&Nl>  E> > E >" 0NlYou summon forth the wind, which whirls down and snatches away at the fountain, turning the sprinkles of water so that they blast Val straight on in the face. You burst into !>raucous caws  laughterD over the look on Val's face. \b The mage reaches over, dips his arm into the fountain, and causes a stream of water to divert straight at you. Bedraggled and soaked, you glare over at the pale haired man while he smirks and returns to his digging. You shake yourself off and all traces of moisture vanish from your skin.  N!l>  E> > N-lYou summon forth the wind which pours into the courtyard, rudely pushing at your new companions and sending them staggering. Val looks up and peers directly into its face. \b "Mighty windy today," says the Old Coot amiably. As if in response the wind howls and tears about the courtyard, pulling shingle and thatch off the roofs, dragging the apple barrel and horse trough behind it, and finally picking the old man up and twirling him about. \b Val begins to raise his hand but then the Old Coot is unceremoniously dumped atop Layna. They both go tumbling to the ground. "Ack! Don't touch that!" the maiden yells from beneath the old man and begins whalloping him upside the head. \b "Mighty windy indeed," says Old Coot with a cheeky grin as he pulls himself to his feet. And then the old man gets chased inside by a red faced Layna. \b "I doubt he'll be coming out again any time soon," Layna sniffs.>&"N0l>  E> > E >  NDlYou summon forth the breezes which pour into the courtyard, rudely pushing at your new companions and sending them staggering. Val looks up and peers directly into its face as Layna looks suspiciously about her. And then the maiden gives a yelp as the wind catches at her back and sends her windmilling towards the mouth of the well. \b Val intercedes, leaping in front of the well and raising one gloved hand. And for a moment the wind can be seen, its milky pale outline bending and then breaking around the figure of the pale haired young man. Only, that shouldn't be possible... \b Layna looks up as the gusts die away, the wind having fled the courtyard once again. She stares pale faced at Val. "I saw what you did," she says. "You stopped it. I saw it. You stopped the wind. " The maiden swallows. "You are a mage aren't you?"\b "I... do know a bit of magic," Val replies. \b "And so you have come for the fey... nay, you needn't reply, I know the answer already. " Layna straightens and dusts her clothes assiduously, not looking at either you or Val. "I have no wish to become mixed up in this," she says and turning her back on you both, she strides into the tavern once more. \b "She was more frightened of me than of the fey," Val says softly, perhaps to himself, perhaps to you. \b "That seems about right to me," you reply and Val turns to you. \b "Will you run away too?" the mage asks you, and he does not seem young at all anymore. \b "That would be wise... but I was never particularly known for being wise," you say with a shrug. \b Val gives a short laugh and hitches his satchel higher upon his shoulder. And with that he turns and begins walking to the northwest. >>">&!"NGl>  E >  NIl-You summon forth a gale which whips at the !> pale  darkened figure of the mage. Val lifts his hands and the wind is heaved away, driven into the green shores of the lake where it tears at the grass and tiny trees. >NMlYou summon forth the wind, which blows all about you with the scent of crushed flowers and salty tears. You idly wonder where this wind had been so smell as that.  T#"""bM strong winds ##A strong breeze blows around you.MO actorNXWlc"MO actorN|Yl>  E> > E >g" .N|\l"You summon forth a quake and the earth obeys your command, trembling and heaving itself beneath your feet. The music of the flute cuts off abruptly as Val staggers sideways. The land groans as it is torn asunder, cracks forming into pits into rifts, as other sections are thrust high into the air, raining down bits of dirt and greenery and flower petals. \b Val leaps away from another sinkhole and takes shelter behind you. And then the earth finally stills to the sound of silence. No more groans nor quakes nor piping of annoying flutes. \bN|^l>  N|`lAs amusing as it would be to see everyone reactions if you shook the earth right out from under them, that might frighten them away for good. N|bl>   E >    N|clThe white mage stumbles back a bit as the earth heaves and twists beneath him. He brings down one slippered foot in a stomp and the ground ripples back out towards you once again. >  N|el>  N|flYou call upon your land to quake and rise up, to join in this desperate fray you find yourself mired within. And so it responds, cracks and clefts and upheavals, springing in amongst the two battling mages. N|il>  E> > E >" E >g" N|kl"What a mess," you say as you behold the remains of the meadow before you, flowers and pillars and greenery all askew at different angles. Perhaps you ought to abstain from earthquakes for awhile. \bN|ml>  E> > E >g" =N|ol "I suddenly have the urge to visit another region," Val says as he pokes a toe at a wide pit near his feet. He tucks the silver flute pack underneath his cloak and begins to, carefully dodging around rifts and clefts, wend his way to the north. >&>>&"g"g!N|ql>  E> > E >g" N|wlSands ripple and topple across the patterns as the earth shudders beneath your feet. Val staggers backward just in time to escape the upheaval of a new sand tune where he once stood. The metal trees sing and chime to each other as they tremble within their grove and then suddenly there comes the sound of crashing, splintering glass. \b As if subdued by that sound the land stills once more. Drifts of sands slide into each other, smoothing the landscape out once more. Val stands before you, peering up into the puffy clouded sky. \b "I believe that's a sign we should be moving on," he says, and thus saying so, he pulls the satchel higher upon his back and begins plowing through the new sand drifts, towards the southeast. >!>&>E&"9"g>&N|yl>  E> > jN|{l[You, Val, and even the bloody ofudas cling to the trees as the earth shakes beneath you. N|l>  E> > E >g" E >" 6N|lThe red hills shiver and shake all around you. Clouds of dust and red pebbles clatter to the ground and suddenly there comes a dull roaring, different from the groaning of the earth beneath you. Val curses and then runs full tilt into you, pushing you back and away, all the way to the other side of the red arch. A waterfall of red stone and dust follows you as one of the hills collapses in upon itself, sealing off the red arch and the entrance to the rest of the hills. Val wipes at the coating of red now covering him and says, "That fountain up north is looking better and better." And so both of you set off for it, you with many backward glances at the collapsed red hills. The damage doesn't appear to be too difficult to repair. >>"g"vg>9&"9>&N|l>  E> > E >g" E >" N|lThe red hills shiver and shake all around you. Clouds of dust and red pebbles clatter to the ground and suddenly there comes a dull roaring, different from the groaning of the earth beneath you. Val curses rushes to the other side of the red arch, a waterfall of red stone and dust following him as one of the hills collapses in upon itself, sealing off the red arch and the entrance to the rest of the hills. Val wipes at the coating of red now covering him and says, "That fountain up north is looking better and better." You flutter over and catch a ride upon his shoulder, as he wends his way to the north.At least the damage doesn't appear to be too difficult to repair. >>"g"vg>9&"9>&_N|l>  E> > E >g" $N|lYou awaken the land beneath you and Val comes bounding out of his hole, a surge of dark earth following behind him. The pit the mage had been digging puckers and collapses in upon itself, a carpet of grassy moss and heath spreading across its mouth in front of your eyes. Val gazes at the ground he had once labored over, now indistinguishable from all the other flatland surrounding. And then he turns and looks at you, eyes expressionless, and without a single word he walks towards the west. !>&m>>9&"g N|l>  E> > +N|l The earth leaps to obey your call, heaves and falls away from beneath the young seeming mage. Val staggers and teeters for a moment, and then a small perfect circle solidifies underneath his feet. He raises his hands and the earth shudders and quails before you. > N|l>  E> > N|lAt your command the earth trembles and shakes all about you. Layna squawks in dismay-- or maybe its the Old Coot-- as pebble skips about the courtyard, the barrel and water trough rattle and vibrate within their bases, and Val stands perfectly steady gazing up at the heavens. \b Finally the earth stills and your companions grab at anything for support. Well, not quite all of them. \b "Good gods," gasps the Old Coot. "What was that?" \b "Is that normal? Are there earthquakes here?" Layna asks. \b "None that I ever remember!" replies the old man as he clutches at the wall of the tavern as if expecting the earth to spin away at any moment. \b "Did you notice," Val muses softly, "that the tavern wasn't shaking? Not at all. And--" \b "That's all I be needin' to hear!" says Old Coot as he beelines for the tavern door. \b "And neither was the stables," finishes Val, a touch of amusement to his voice. "The horses were not disturbed at all. " And indeed, if you listen carefully you can still hear their quiet nickering to each other.\b Layna heaves a sigh. "So, twas the fey after all" she sighs and shivers. And then looks suspiciously about her. >&"gN|l>  E> > E >  E >g" E >r" gN|lAt your command the earth trembles and shakes all about you. Layna gives a little shriek as pebbles skip about the courtyard, the barrel and water trough rattle and vibrate within their bases, and Val stands perfectly steady gazing up at the heavens. The maiden stumbles, regains her feet, and staggers wildly towards the tavern door. The earth follows her, rolling beneath her feet and hitting the tavern wall, causing a rattling tremor that knocks free the loose roof tiles above her head. \b The shingles rush down towards Layna and stop, poised daintily in midair, and you stare. For you had been about to do just that, yet it seems someone has beaten you to it. \b "Move!" Val commands and the maiden jumps away to obey. The tiles come alive once more and come crashing to the ground where Layna had been standing. \b The earth has stilled and for a moment all is silence. You turn to stare at Val and discover that Layna has done the same. \b "You," she says, "You did it. You stopped it-- stopped--" she swallows hard as she stares at Val. "You are a mage.". \b "I do know a bit of magic," Val replies quietly. \b Layna laughs dryly. "Oh I dare say, a bit more than 'a little'". She clears her throat and looks away. "I should thank you, but... I have no wish to be part of this. Of a fey hunt. I wish... both of you, luck. " she says and smiles wryly to herself before walking back into the tavern. \b "More afraid of me than of the fey," Val says, as softly as before. \b "That makes perfect sense to me," you reply. \b "And you," says Val "Will you turn away now as well?" \b "The others have far too much sense to accompany a mage," you reply. "All save me, who has no sense at all. " \b Val laughs. "Then what a pair we make!" and saying so, he pulls his cloak about him and sets off to the northwest. >>&>!">&"!rFN|l:At your command the earth trembles underneath your feet. p---bM rain 77Droplets of water pour down from the clear blue sky. MO actorNdlMO actorNl>  \NlMIt may raise a few suspicions if rain started falling inside the building. Nl>  E >  NlqRain pours down from heavens above, thoroughly soaking both you and Val as you stand motionlessly within the flowered meadow. Although the droplets beat upon the mage, surrounding his figure in a fine mist, his fingers do not hesitant for a moment as they flicker over the flute holes of his instrument.\b Finally the rain fades away, leaving the meadows a vibrant green for the few moments before the flowers unfurl their many-colored petals once again. You give yourself a good shake and the moisture evaporates from your skin and you catch the mage doing the same as well. Alas, no bouts of pneumonia for either of you. nNl>   E >    NlSThe rain weeps bitter tears above you as you struggle vainly against the hold of !> ! Lorekosithe white mageD>. And yet the figure of your enemy before you remains untouched. >  eNl>  E >   E >" WNlHA storm of warm rain descends upon the battle scene upon your command.Nl>  E >  E >" E >" NlWith a crack of thunder rain pours down from the gentle blue skies above. A deluge, a torrent... the droplets fall like a thousand tiny fists upon the ground and upon anything that separates it from the ground. \b Within the first few moments the patterns on the sand have been washed away without a trace, kernals of white and black mixing together as they float away. Val takes shelter beneath the sweeping glass sheets within the trees romp and play amongst the rain and sand. As quickly as it comes, the rain passes away once again. Val pokes his head out from beneath the trees. "Having fun?" he asks as he finds you plopped amongst the dunes, happily building away at a intricate sand castle.\b "Oodles," you reply. \b The mage shakes his head and laughs. "I believe I'll be heading for better shelter," he tells you and begins to wend his way through the wet sand towards the southeast. ">!>& &>&>&Nl>  E >  E >" E >" =Nl With a crack of thunder rain pours down from the gentle blue skies above. A deluge, a torrent... the droplets fall like a thousand tiny fists upon the ground and upon anything that separates it from the ground. \b Within the first few moments the patterns on the sand have been washed away without a trace, kernals of white and black mixing together as they float away. Val takes shelter beneath the sweeping glass sheets within the trees romp and play amongst the rain and sand. As quickly as it comes, the rain passes away once again. Val pokes his head out from beneath the trees and laughs at finding you gaily batheing away in a quickly drying rain puddle. The mage straightens, brushes himself off, and begins to wend his way through the wet sand towards the southeast. ">!>&>&oNl>  NlRain falls with a soft pitter patter within the forest. Moisture drips from pale leaves and down white wood, yet the thick tangle of branches and foliage above keeps most of the wetness at bay. Nl> > E >  NmA storm of raindrops suddenly falls from the puffy white clouds drifting above. For a moment the waters of the fountain are overrun, its surrounding guardian rainbows fading away, as it intermingles with the stream of rain. And although the droplets beat upon the mage, surrounding his figure in a fine mist, he continues to work away, his shovel squelching into the water saturated ground. \b The rainstorm passes as quickly as it came, leaving behind an even greater aura of rainbows about the glittering fountain. You shake the moisture from your body as wists of mist rise from the ground, leaving the land as dry-- or rather wet-- as it was before.  Nm> > E >  NmYou summon forth a storm of rain, hurling the gleaming droplets straight at the mage. The waters split around Val, creating a halo of wispy mist and moisture, yet leaving the mage untouched.  N m>  E >  SNmRain pours down from the cloudless skies above; a torrent, a deluge, a curtain of moisture that blankets everything and cuts off vision of anything further than a footspan away. Layna and the Old Coot take shelter within the doorway of the stables while you and Val stand about, meandering around in the rain. \b "Neither of them have the sense to come out of the rain," muses Layna with a laugh. \b "Aye, that makes quite a bit of sense," says Old Coot as he looks, somewhat grumpily or as grumpy as the amiable fellow ever looks, around at the cloudburst surrounding him. "Oh nuts and figs to this!" he exclaims and skedaddles back inside the tavern. \b As soon as the door shuts behind him the rain stops as if it never was. Tendrils of moisture rise from the ground as the land about you dries itself off. Val shakes himself off as Layna comes out from the stable. \b "Well, he got scared off rather quickly," says Layna as she gazes back at the tavern. \b "The old are supposed to have much more sense than the young," Val replies mildly. >!"">&>]Nm>  E >  E >" {N,mHRain pours down from the cloudless skies above; a torrent, a deluge, a curtain of moisture that blankets everything and cuts off vision of anything further than a footspan away. Layna takes shelter within the doorway of the stables while you and Val stand about, meandering around in the rain. \b "Neither of them have the sense to come out of the rain," muses Layna with a laugh. \b The rain passes as quickly as it came. Tendrils of moisture rise from the ground as the land about you dries itself off. Layna comes out from the stable as Val shakes himself off. Both you and the maiden stare at Val as wisps of moisture evaporate from him, forming a halo is shimmering mist. Val blinks back at both of you. \b "Oops" he says. \b "MAGE!" Layna suddenly yelps as you stagger back a bit and clutch at your ears. Before you have even recovered, the tavern door is slamming shut with the maiden safely inside. \b "Well..." says Val and you turn to stare at him. This game may turn out to be more interesting than you bargained for. "It seems she was more frightened of me than of the fey," he says. \b "That seems about right to me," you reply. \b Val laughs softly. "And to that, I shall be off. Join me if you dare," says the mage, and he hefts his satchel upon his back, and starts off for the north. \b And how can you refuse a challenge like that? >!"">N.m> > N1myYou summon forth a sudden shower, crystalline raindrops falling from the clear skies above to quench the earth all around. \b Val stands before, gazing straight up into the heavens, hands outstretched to catch the tumbling drops. \b The rain disappears as quickly as it arrives, leaving wisps of mist in its wake with the colors of the ground looking more vibrant that ever. N4m You summon forth a sudden shower, crystalline raindrops falling from the clear skies above to quench the earth all around. The rain disappears as quickly as it arrives, leaving wisps of mist in its wake with the colors of the ground looking more vibrant that ever.  II5  sandcastle A pretty little castle created from the pale sands with intricate turrets and swooping ramparts, a moat with a drawbridge, and even little flags flying from its tower tops. It's a perfect little replica of your own castle.  sandcastlesMO actorN%odMO actorNIoEIts pretty but very delicate, it wouldn't take much to destroy it. LMO actorNoNMO actorNo[With a single swipe you crush the sandcastle back into the kernals of sand it came from. !<&1MO actorN]o0LMO actorNo-You deepen the moat around the sandcastle. MO actorNo4&MO actorNoYou peer inside the sandcastle to see little thrones and dais with little banquet tables filled with little goblets and a little pedestal with a little skull atop it. To be sure, the skull should have been golden, but you're still rather proud of the likeness. MO actorN#o^MO actorNGo?You might have better luck doing that with your real castle. oMO actorNopEMO actorNo&Your sandcastle is perfect as it is!MO actorNojMO actorN>oTraipsing about with < . might bring a wee bit too much attention...,MO actorNo-AMO actorNo"Its smells of salt and hot sand! o p[\LN LNLNyLzNLNLNLNLNLNLNPLQNLNLNcLNYLZNJLKNLN}L~NLNRLSNTLUNVLWNfD&&&&bWM large gaping pit __A large gaping pit within the ground, greatly spoiling the ambiance of the surrounding area. MO actorN>m1%MO actorN@m>  NAmuThat would quite thoroughly disabuse the humans of the idea that their tavern is outside the influence of the fey. $NBm>  E >  qOxNDmYou command the earth to part at your whim and it obeys, the pebbled ground collapsing in upon itself. The hole widens into a ditch, into a pit that eats away at the courtyard leaving on the edges steadfast and unharmed. Your companions wildly scramble out of the way, !>' taking shelter within the stable as !> scampers back inside. Val remains leisurely leaning against the stone well, watching the pit lick at his feet yet remaining motionless and seemingly undisturbed. \b "Good gods," exclaims !> as she pokes her head out of the stable. "Is it the fey, you think?" \b "Unquestionably," says Val who then glances back at the tavern. "I suppose !>N he isn't coming out again, is he?"\b "If he has any sense, he won't," says !>. NGm>"NHmZNIm& NLm>  E >  E >  E >" 4OxN3NmnYou command the earth to part at your whim and it obeys, the pebbled ground collapsing in upon itself. The hole widens into a ditch, into a pit that eats away at the courtyard leaving on the edges steadfast and unharmed. Val remains leisurely leaning against the stone well, watching the pit lick at his feet yet remaining motionless and seemingly undisturbed yet !> wildly scrambles about and makes a lunge for the doorway of the stable.\b "Nay! Not that way!" Val calls out a warning too late. The pit widens edgewise beyond !>'s foot and for a moment she hangs there, dancing along the crumbling edge before she plunges downwards. Yu are about to fill the bottom of the pit with soft moss when !> come floating upwards once again, gently wafting into the outstretched arms of Val. \b She stares at the cloaked stranger with bulging eyes. You wonder if your expression is any better.\b "You did... that... float..." she stutters and wrenches herself out of Val's arms. "You are... a mage!" she finally says and her tone is full of accusation. \b "I do know a bit of magic," Val says. \b "A bit...a bit..." !>< repeats and laughs, more than a bit of hysteria creeping in. "A bit... And so you have come after the fey, have you? But not for his treasure, oh no. Nay, physical treasure, anyway." The maiden straightens herself and dusts off her clothes. "Thank you for that... but... I believe this is as far as I go." she says and strides quickly back inside. \b "More afraid of me than of the fey," Val says as he gazes after her.\b "That makes sense to me," you reply. \b "And you," Val turns towards you. "Will you run away too?"\b "The others have far too much sense to accompany a mage, all except me who has no sense at all," you reply. \b "Well then, what a pair we shall make, for I haven't much of my own," says Val as he gives you half a bow. The mage pulls his satchel higher upon his shoulder and sets out for the northwest. N3Ym>>!""N3ZmZN3[m&N]m>  OxN{ _mYou command the earth to part at your whim and it obeys, the pebbled ground collapsing in upon itself. The hole widens into a ditch, into a pit that eats away at the courtyard leaving on the edges steadfast and unharmed.N{ `mZN{ am&XNcm>  E >  E >"  OxNfmYou command the earth to part at your whim and it obeys, the flowered ground collapsing in upon itself. Val dances away as the hole widens into a ditch, into a pit that edges sideways following the movements of the mage. You scramble back yourself as more and more of the meadow disappears into the darkened maw of the rift. \b "Fine, fine I'll stop," says Val as he finally allows the flute to drop away from his lips. "Before the entire meadow goes down into the hole and takes everything else with it.". The mage glances at you for a moment and smirks before tucking his flute away and carefully wending his way to the north, across all the cracks and crevasses now littering the ground. >>&>&!"NgmZNhm& Njm>  OxNlmjYou command the earth to part at your whim and it obeys, the flowered ground collapsing in upon itself. NmmZNnm&QNpm>  E >  E >" _OxNtmSYou command the earth to part at your whim and it obeys, the sands and glass collapsing in upon itself with a murmuring rush and the clitter clatter of breaking. Val jumps back as his patterns are consumed, pouring into the deep gaping maw of the pit opening up beneath his feet.\b "Well," he says and peers into the darkness. "It seems !> Iwe* need to find more steadfast ground. \b !>>8You raucously caw and croak at the figure of the mage.GD"You know what they say about building things on sand," you reply.\b "So you agree then? Shall we find more hospitable trees?" and so saying, the mage carefully edges around the sand still pouring into the belly of the pit and begins to make his way to the southeast. Nxm>!>&>&"NymZNzm&N|m>  OxN<~mYou command the earth to part at your whim and it obeys, the sands and glass collapsing in upon itself with a murmuring rush and the clitter clatter of breaking. N<mZN<m&Nm>  E >  OxN>mYou command the earth to part at your whim and it obeys, the stony ground collapsing in upon itself, exposing pale twisted tree roots that claw helplessly in the air. Val carefully dances out of the way of the growing hole. N>mZN>m& Nm>  OxNqmYou command the earth to part at your whim and it obeys, the stony ground collapsing in upon itself, exposing pale twisted tree roots that claw helplessly in the air.NqmZNqm& Nm>  E >  jOxNwm-You command the earth to part at your whim and it obeys, the red stone stony groaning and clattering as it collapses in upon itself within a great cloud of dust. Val edges over to the other side of the hills with a hand held over his mouth. At least the chanting is muffled, if not entirely halted. NwmZNwm& Nm>  OxNmYou command the earth to part at your whim and it obeys, the red stone stony groaning and clattering as it collapses in upon itself within a great cloud of dust. NmZNm& Nm>  E >  Nm"NmMWith a shrug, you jump into the ditch alongside Val and begin digging away. Sensing your intent the earth oblidgingly opens up beneath you. Unfortunately, of all possible places, Val has chosen to dig atop your treasure room, and so there is nothing underneath the oblidging earth. \b With a great yelp, from either you or Val or perhaps both of you, you plunge into the treasure room amidst an avalanche of loose dirt. Val tumbles to his feet, absentmindedly brushing himself off, as he looks about with great interest. You remain in a bemused tumble atop the largest pile of debris. \b>>"|>&>&!>&> &> &C) .Nm>  NmyThat would not be wise as the ground here is hollow with the empty space of your treasure room lurking directly below. Nm> m E > m OxN}mYou command the earth to part at your whim and it obeys, the green lakeshores collapsing in upon itself. Without even glancing down, the mage edges away. N}mZN}mm&Nm> m OxNj mYou command the earth to part at your whim and it obeys, the green lakeshores collapsing in upon itself. Without even glancing down, the mage edges away. Nj mZNj mm&Nm>  E >  OxNd!mYou command the earth to part and open up a pit beneath the mage's feet. Val leaps elegantly to the side, landing on a stable circle of ground as the dark soil all around crumbles away. Nd!m>Nd!mZNd!m&uNm>  OxN"mJYou command the earth to part and open up a pit beneath the mage's feet.N"mZN"m&Nm>   E >    OxN5#mYou command the earth to part and open up a pit beneath the mage's feet. Lorekosi does not deign to even budge, yet hangs there hovering within the air. N5#m>  N5#mZN5#m &Nm>   OxN=$mYou command the earth to part at your whim and it obeys, the rainbow hued grass ripples as the ground beneath it collapses away. N=$mZN=$m &Nm>  OxN%m|You command the earth to part at your whim and it obeys, the ground collapses in upon itself as you lash out at the enemy !> mage mages.N%mZN%m&d$$$W large gaping pit __A large gaping pit within the ground, greatly spoiling the ambiance of the surrounding area. MO actorNmyMO actorNmYour !> talon hand1 passes through the emptiness that is the hole MO actorN9mMO actorN]mYou drop down into the belly of the pit. Its dark and earthy and not particularly entertaining. Within a few moment you grow bored and easily climb up once again. DbM  groundhog Cute little fuzzy animal. MO actorNNm|MO actorNrm> > D > m NrmYou summon forth a groundhog which pops its head from the surrounding ground, looks at you, looks around itself, and then dives back under for cover.  Nrm>  E >  DNrm5You summon forth a groundhog. The flowers around Val's feet tremble and shiver and then a brown furry head pops up amongst the greenery. Its head rotates in clockwise until it finds the mage's leg within easy reach. With great relish it sinks its teeth into the aforementioned leg.\b The music of the flute grows ever shriller and jagged as Val hops around trying to kick the furry animal off his leg. Eventually the groundhog looses its grip and goes sailing off into the nearby greenery. Meanwhile, Val continues to play as he carefully examines his bitten leg.l Nrm>  E >  BNrmYou summon forth a groundhog. Or supposedly you did, as nothing seems to happen. And yet-- wait, was that a bit of movement underneath the sands? And suddenly the ground beneath Val's patterns twitches and caves in and a groundhog pops its head out of its hole, loudly chittering. \b "Oh? Am I bothering you little one?" Val leans over the groundhog as he speaks. \b The animal chitters all the louder, waving about a tiny fisted paw, and then bops the surprised mage right on the nose.\b "I take it that's a 'Yes', says Val as the groundhog humphs and kicks more sand atop the remnants of the pattern before it disappears back down its hole.\b "I suppose !> Iwea should be moving on then," says the mage with a slight laugh as he proceeds to the southeast. !>&>>&">m Nrm>  E >  Nrm[You summon forth the squirrels. With rapid little feet they come circling down from the trees, snatching the sutras away in their small paws before they withdraw into the shadows once again. Val blinks up at them for a moment in surprise. \b "Squirrels," he says with a laugh and shakes his head. And so with that the mage sets off to the east. >!!>&dNrn>  E >  NrnyYou summon forth a groundhog. For a long moment there is nothing but the wind blowing red dust through the air and Val singing his annoying chant. Then a fat furry little animal waddles through the red arch and sits upon its haunches. It looks about itself, scratches at the hard stony ground with its front paws and, loudly grumbling turns about and leaves the way it came. Nrn>  E >  NrntYou summon forth a groundhog which pokes its head out of the side of the ditch and loudly and angrily chitters at the encroaching mage. "My apologies, Sir Groundhog, if I am disturbing you, but I am searching for something important," Val exclaims. The groundhog merely chitters all the louder and shakes its clenched paw at the mage before diving back into its burrow. Nr n>  E >  Nr nYou summon forth a groundhog and your companions look down in surprise as a pile of pebbles tumbles away to show a chubby little furred face watching them. The groundhog mutters to itself before ducking into its burrow once more. Nr n>  HNr n&"That was adorable... what was it?" !> asks. Nr n>  =Nrn!"Mole maybe? Badger?" suggests !>.Nrn>  4Nrn%"A groundhog, I believe," says Val.Nrn>  E >  NrnYou summon forth a groundhog which bares its large teeth and lunges for Val's leg. It gets in a bite or two before its sent sailing off into the lake, to disappear beneath the disturbed waves. >Nrn>   E >    NrnYou summon forth a groundhog which throws itself upon the mage, its large teethed bares in a rictus snarl. Its gets within a handspan before it dissolves away into smoke with a frightened yelp. >  Nrn>  E >   NrnYou summon forth a groundhog which pops its head out of the ground, takes one look at the two battling mages, and dives for cover once again with a squeak. #b castle OOAll that remains of the flute is a misshapen congealed puddle of silver goo. MO actorN~n MO actorNnAlas, your castle was destroyed in one of your recent skirmishes with the Beast. It really was your own fault, for floating it so close to the borders and you have not yet had the proper time and concentration to bring it back to its former splendour. \b It was clever too, acting as a trap for unwary trespassers, locking them inside with all the jewels and fine silks and furs, an no food of course, unless someone was clever enough to switch the golden skull key with an ordinary rock... DbMO actorN oMO actorO=xNMoBWith a mere thought, a gold coin pops into existence before you.NMoZNMo> &hhh5M fat gold coin NNA thick gold coin, pure and glittering, but lacking any kingdom's embossing.MO actorN/oMMO actorN0o.Cool and smooth, if a bit soft for a metal. MO actorN1o@MO actorN%2o!You summon forth the gold coin.HHHbMO actorNoMO actorN=oA dark brown moose briefly appears before your eyes before it unfurls the tiny wings upon its hooves and shoots of into the sky. N=o> > ON=oCWhat in the nine hells?" says Val as he gapes up at the heavens. bMO actorN oEMO actorN="oA flood of water pours into the surrounding lands drenching everything in its path. And just as quickly it evaporates, shimmering into drops of moisture, as if nothing had ever come to pass.N=#o> > ON=$oCWhat in the nine hells?" says Val as he gapes up at the heavens. bMO actorN8oMO actorO=xNM;oDWith a mere thought, a silver coin pops into existence before you.NM &???5M slender silver coin ++A silver coin sparkling within the light.MO actorNmMo?MO actorNNo Cool and smooth to the touch. MO actorNOoBMO actorNPo#You summon forth the silver coin.bMO actorNUoMO actorO=xNMXoDWith a mere thought, a copper coin pops into existence before you.NMYoZNMZo> &t3335M  copper coin ''A copper coin, looking newly pressed.MO actorNaco?MO actorNdo Cool and smooth to the touch. MO actorNeoBMO actorNfo#You summon forth the copper coin.(bMO actorNloMO actorN=noO=xNVooiBefore your eyes it sprouts from seedling into a many hundred foot adult tree within a few heartbeats. NVpoZNVqo> &N=ro>  E >  N=so&\b"That was... interesting..." says !>F as she backs away, carefully tilting her head up towards the tree. +N=to>  E >  qN=woHThe tree comes exploding through the heart of the patterns, spraying sand through the air and sending the mage scrambling back for cover. \b "Well," says Val as he looks at the newly grown tree where once his designs stood. "I do believe that is a hint that tis time to move on. " And so the mage sets off for the southeast. !>&>&"N=xo>  E >  E >" N=yoDVal comes flying out of his hole a few seconds before the tree explodes up beneath him, nearly knocking his head off. For a moment the mage lays panting on the ground, staring up at the crown of the newly grown tree. He then rolls over and gives you an unreadable look before brushing himself off and heading to the west. >##!>&!>9&m>N=zo>  E >  QN={o/Val leaps out of the way of the clawing tree.>{N=|o>   E >    XN=}oLThe white mage barely flinches as the branches of the tree whip past him. >  5MIMO actorNo*That would draw a bit too much attention tree ttIt looks some strange combination of a pine tree with a weeping willow with a few mimosa blooms mixed in as well. MO actorNo?MO actorNo Cool and smooth to the touch. MO actorNYoBMO actorN}o#You summon forth the copper coin.<bMMO actorNoMO actorO?xNOo0From out of the sands rises a tower and then another, and another. A rampart connected to steeple, the flaring outline of a drawbridge, bits of sand flake and fall away as details come into view, a flag here, a parapet there, a row of arched windows. The sandcastle rises out of the surrounding sands. NOo ZNOo> &NOo>  E >  NOoAnd so the pattern is destroyed. \b Val stares down at the little sand castle perched atop his hard-worked designs... stares hard and laughs. "Well, isn't that the prettiest little thing?" he says and crouches down next to it. "For the king of the fiddler crabs, perhaps?". \b The mage backs away, careful not to disturb the sandcastle. "I suppose that's a sign to be off," he says and, with a toss of his pale hair out of his eyes, he begins to make his way to the southeast. !>&>&>&uuubMO actorN) p%MO actorNM!pFoo!X5X5 X5!X5"\3\3\3\3 onMO objNCFMO objNeG,$MNJa <NK=MNN<NO<:NPsNQ &MNTthe <NUBMN\<:N]theyN_itN`BMNg<:NhthemNjitNkGMNo<:Np they'reNrit'sNsBMNw<:NxdoNzdoesN{}AMN<:NareNisNGMN<:Naren'tNisn'tNLMN<:N themselvesNitselfNEMN<:NthoseNthatN-MN<MN<:IN\^!< look like ordinary !< to %me%.JN\^!< looks like an ordinary !< to %me%.N/MN%You% can't read <,. [MOvdpiN}!%You% %have% lost %your% mind. N}*N}MN"MN"MO objO mylocN"< N"TN" N""N"N"N"N"!N"&MO objO locN< N4NN NN< N< < N NNNMO actorN[Please specify the name of the game to save in double quotes, for example, SAVE "GAME1". NMO actorN.aPlease specify the name of the game to restore in double quotes, for example, RESTORE "GAME1". N.MO actorNgYou should type the name of a file to write the transcript to in quotes, for example, SCRIPT "LOG1". NxMO actorNRPYou should put what you want said in double quotes; for example, SAY "HELLO". NRUMO actorN Pushing !<  doesn't do anything. NJMOactoriobjN+ $There's no obvious way to do that.CMO actorN{ $There's no obvious way to do that.CMO actorN $There's no obvious way to do that.JMOactoriobjN $There's no obvious way to do that.CMO actorN] $There's no obvious way to do that.EMO actorN %You% can't wear < . N zMO actorN <  9N %You% already %have% < ! N N <N MO actorO q locN < N GN  N  N   N  N  MOvantageO  locN < N ! N !N   E<N "N  N "N $E N %"N - ! E  E  <N /"N 2!N 3MO actorN& FRN& H\^!  ! not respond.N& IN& JN& K4"SN& M!There's no point in talking to !.N& NN& ON& Q< ! N& S  KN& T%You% can't reach !< from !  . .N& W%You% can't reach !<.N& XN& YN& Z< D < |N& [< =N& ]%You%'ll have to open !<   first. N& ^PMO otherRoomN<j$%You% can't reach that from here. N<kMO actorO locNr ! D ! Ns!Nv  ! Nw"N}< N~! N!N D  N"NNN!N\MO actorOtotbulk totweightN <N N~ N<< N +N%Your% load is too heavy. }N 9N*%You've% already got %your% hands full. /N<&N Taken. NN|MO actorN~:N%You're% not carrying < ! NN<N4MO actorN NIMO actorN%You're% not wearing < ! NRMO actorN %You% can't put anything into < . NMO ioOvcontprepN  oninN%You% can't put !<  ! !  , because !  !} !   already ! !  N  N , which !} !   already ! !  N }N. NMOactorioN)! N)N)<  @N) <  is already in  ! N)N) EN)%You% can't put <  in !<! N);N)N)<N)<N)FMOactorioNN<&NNDone. NNOMO actorNThere's no good surface on < . NMOactorioN! NN<  @N <  is already on  ! NN EN%You% can't put <  on !<! N;NN<N<NFMOactorioN<&NDone. NMO actorN`:MOactordobjNNMOactorioN! E <GN <  <N in  . NN<N4MOactorioN_<N_MO actorN:MOactordobjN N MOactorioN ! E <DN <  <N on  ! NN<N4MOactorioN<NSMO actorN!%You% can't plug anything into < . NXMOactorioN(%You% can't plug <  into anything. N(JMO actorN"It's not plugged into < . N#nMOactorioN&! <N'\^!< not plugged into  . N(GMO actorNJ+There's nothing in < . NJ,AMN-%You% can't see much through !< .\nUMO actorN0#%You% can't see anything through < . N1JMO actorN94There's nothing under < . N95MO actorN6,MO actorN9<N:MMO actorN=I don't know how to read < . N>KMO actorN2AThere's nothing behind < . N2BYMO actorNE Turning !<  doesn't have any effect. NF^MOactorioNI Turning !<  doesn't have any effect. NJ^MOactorioNFM Turning !<  doesn't have any effect. NFNGMO actorNQI don't know how to do that. NRPMO actorNUI don't know how to turn <  on. NVQMO actorNM YI don't know how to turn <  off. NM Z@MO actorN \!%You% see%s% no way to do that.GMOactoriobjN ]!%You% see%s% no way to do that.IMO actorN7!^%You% can't use !<  like that.@MO actorN!`!%You% see%s% no way to do that.GMOactoriobjN!a!%You% see%s% no way to do that.IMO actorN"c%You% can't use !<  like that.MO actorNh"e:MOactordobjN"hN"itMOactorioN"lSurely, %you% can't think < N"m knows anything about it! N"nMO actorNF#o:MOactordobjNj#rNj#sfMOactorioN#vIt doesn't look as though !<  is interested. N#wMO actorN$z  CN$|%You're% not !< !< ! N$}JN$~< ! 8N$%You% can't leave !< ! N$N$MO actorN$<TN$%You%'ll have to unfasten !   first. N$rN$Okay, %you're% no longer !< !< . N$<N$< &N$N$bMOactorioN% Attacking !<  doesn't appear productive. N%`MO actorN6&)It's not very effective to attack with !< . N6&]MO actorN&\^!<  !<n't appear appetizing. N&]MO actorN&\^!<  !<n't appear appetizing. N&MOactorioNb'~:Nb'%You're% not carrying < . Nb'Nb'<Nb'FMOactorioN'<&N'Done. N' TMO actorN5( Pulling <  doesn't have any effect. N5( MOactorioN(~:N(%You're% not carrying < . N(N(<N( TMOactorioN)%You% miss%es%. N) <&N) qMO actorNp)~ANp)%You% could at least drop <  first. Np)Np) :MOactordobjN) N)MOactorioN'*~:N'*%You're% not carrying < . N'*N'*<N'*TMOactorioN*%You% miss%es%. N* <&N*|MO actorN+~:N+%You're% not carrying < . N+N+<N+GMO actorN+ Thrown. N+ <&N+#MOactorioN+nMOactorioN,! <N,    impressed. N,N,IMO actorNt, <  < impressed. Nt,NMO actorN, <  looks a bit cleaner now. N,#MOactorioN-SMOactorioN@- <  looks a bit cleaner now. N@-SMO actorN- Moving <  doesn't reveal anything. N- XMOactorioN-  Moving <  doesn't reveal anything. N- HMO actorNP.  That doesn't get us anywhere. NP. XMOactorioN.  Moving <  doesn't reveal anything. N. TMO actorN.  <  !<n't seem to help. N. MOactorioNV/ ^You should put what you want typed in double quotes, for example, TYPE "HELLO" ON KEYBOARD. NV/ ]MO actorN/  Touching < $ doesn't seem to have any effect. N/ [MO actorNJ0  Poking < $ doesn't seem to have any effect. NJ0  MO actorN0 !PMO actorN0! (You'll have to tell me how to do that.N0" "1MN# %You% can't seem to do that. ##MO actorN\1$ <"$#MO actorN1% <"%#MO actorN1& <"&#MO actorN1' <"'#MO actorN2( <"(#MO actorN)2) <")#MO actorNR2* <"*#MO actorN{2+ <"+MMO actorN2. %%You% find%s% nothing of interest. N2/ '#MN4 < <&N5 ( MN: !<&N; )MNC C<#))V)V)"MO actorNEp< " NFp)NHpYour power washes over you, tumbling, surging, crescendoing... and then finally fading away as you fail to give it shape or form. VMO actorNIp>5" /NJp#That would reveal your presence. MO actorN?LpMO actorNcMp>5" 2NcNp#That would reveal your presence. fNcPpDThe edges of space fray at your touch as you reach forth, calling !<  to you. > <XMO actorN1Sp>5" 2N1Tp#That would reveal your presence. hN1Up< " N1Vp)GN1Xp;Your thoughts wander through the labyrinth of your mind. MO actorN]p>" ICYou shouldn't overburden yourself with items while in this form. ZN^p>5" 5N_p&That would require a physical body. N`p<&You abscond with !< . fMOactorioNbp~1Ncp%You're% not carrying < .  <4MOactorioNSep<&Done. MO actorNgpMO actorNipYou let your !>talons  fingers flit across !< , but alas, !<  isn't very ticklish.  MO actorNTkp!KMO actorNxmp\^!<  is so calm its inanimate!  YMO actorNpp>5" 2Nqp&That would require a physical body.  hMO actorN(sp>5" 5N(tp&That would require a physical body. N(up) @MNwpNothing can be seen through !< .\nGMO actorNxpNothing can be seen through < . MO actorN)zpAMO actorNM|p>5" 5NM}p&That would require a physical body. NMp>  E >" NMpIt would draw far too much attention if you started pulling up floorboards in the middle of the tavern. Perhaps you ought to go outside in order to bury !< ?NMp>  E >" NMp_People are bound to come poking around here sooner or later. Perhaps it would be best to bury!<  somewhere else?NMp>  yNMp2You dig a little hole amongst the pebbles, drop !< ( into it, and quickly smooth it over. <&NMp>  bNMp5You dig a hole between the stones & roots and bury !<  within it. <&NMp>  YNMp You bury !< / amongst the mattes of flowers and greenery. <&NMp>  NMpIts quite a battle to bury !< h amongst the shifting sands with two handfuls of grains falling in for every one that is scooped out. ?<&NMp> m vNMp1You dig a hole amongst the tiny trees and bury !< & underneath their little tree limbs.r<&NMp>  {NMp:You dig a hole amongst the dark soil and carefully bury !< " in between the tangle of roots.<&NMp>  NMpYou try to bury !< ~ underneath the waves, but the sand continues billowing upwards, exposing it again and again. Finally you give up, allowing !<  to lay where it has fallen. > <&NMp>   BNMp You bury !<  in the sea of grass. <&NMp>  NNMp You bury !< $ amongst the loose soil and heath. <&NMp>  <NMp0Everything here is already quite well buried. NMp>  zNMp*With a bit of effort you manage to bury !< 1 in a shallow hole amongst the stone and dust. <&NMp> b D > d D > c vNMpjThe stone here is too hard to dig in. Besides that would ruin the pattern you worked so hard to create. oMOactorioNp~1Np%You're% not carrying < . Np<oMOactorioN p~1N p%You're% not carrying < . N p<&MO actorN~p<+1&MO actorNp<3&MO actorNp<+2&MO actorNp<3oMO actorN.ppMO actorNRp>5" 2NRp#That would reveal your presence. oNRpYou tinker about with !< @ but in the end it seems the same as it was in the beginning. hMO actorNp>5" 5Np&That would require a physical body. Np)MO actorNp>5" 5Np&That would require a physical body.  NpYou brush against <  but feel nothing unusual. ,MO actorN/p-[MO actorNSp3You inhale deeply but smell nothing unusual from <  /MO actorNp.aMO actorNp9You strain your ears but hear nothing interesting from <  MO actorN?p6MO actorNcp>5" 5Ncp&That would require a physical body. ENcp9\^Maybe later, when you're in a more masochistic mood. $MO actorNp%dMO actorN,pEThe thought is laughable. You are the closest thing to a god here. MO actorNpMO actorNp>5" 5Np&That would require a physical body. 3NpYou fiddle about with !< . MO actorNMpMO actorNqp>5" 5Nqp&That would require a physical body. INqp\^!< . is not particularly condusive to braiding. MO actorNpMO actorN>pA simple emotion shared by human mortals, the showing of sorrow by the release of tears. Its something you haven't quite gotten the knack of yet. ZMO actorNpYMO actorNp>5" 2Np#That would reveal your presence. CNp You give !< ! a rousing round of applause. RMO actorNpSMO actorNp>5" 2Np#That would reveal your presence. .NpYou lash out at !< . MO actorNjpMO actorNp>5" 2Np#That would reveal your presence. DNp)You squawk noisily at the unresponsive !<. MO actorN/p5KMO actorNSpThere's nothing to read on !< . MO actorNpMO actorNp>5" 5Np&That would require a physical body. /NpYou jump all over !< . MO actorNWqdMO actorN{qEThe thought of surrendering to one of your creations is laughable. MO actorNqMO actorN q>5" 2N q#That would reveal your presence. NN  q You give !< , a little push. Nothing untoward happens. ]hMO actorN q>5" 5N q&That would require a physical body. N q)^^BMO actorN"qYou wave gaily at !< . MOactoriobjNjq>5" 5Njq&That would require a physical body. 0Njq$There's no obvious way to do that.MO actorNq>5" 5Nq&That would require a physical body. 0Nq$There's no obvious way to do that.nMO actorNq>5" 5Nq&That would require a physical body. N!q")nnMO actorN#q>5" 5N$q&That would require a physical body. =N&q1That would look a little strange, wouldn't it? yhMO actorN(q>5" 5N)q&That would require a physical body. N*q)zzhMO actorN ,q1Try hard as you might, you can find nothing on !<  to close. }MO actorN~ .q>5" 5N~ /q&That would require a physical body. #N~ 1qIt doesn't quite fit.hMO actorN!3q>5" 5N!4q&That would require a physical body. N!5q)==IMO actorNo!7q You turn !<  around, just so. hMO actorN!9q>5" 5N!:q&That would require a physical body. N!;q)EMO actorN,"=q You give !<  a good flip. hMO actorNw"?q>5" 5Nw"@q&That would require a physical body. Nw"Aq)FMO actorN"DqYou plop yourself down upon !< 8 and decide that there are much better places to sit. hMO actorNk#Fq>5" 5Nk#Gq&That would require a physical body. Nk#Hq)cMO actorN#JqFor a moment you rest upon !<  before popping up again. MO actorNB$Lq>5" aNB$MqRYou discard the thought of leaving when things have finally become interesting. NB$Nq)^MO actorN$Pq0You cannot fathom how you'd go about entering !< . MO actorN@%Rq>5" aN@%SqRYou discard the thought of leaving when things have finally become interesting. N@%Tq)5MO actorN%VqThere is no escape. eMO actorN&Xq>5" 2N&Yq#That would reveal your presence. N&Zq)VMO actorN&]q7You're not really in a sadistic mood... maybe later. LMO actorN&`qNMO actorN'bq>5" 2N'cq#That would reveal your presence. <N'eq You give !<  a good practice whack. #MOactorioN'gqMOactorioN'iq>5" 2N'jq#That would reveal your presence. QN'lq You give !<  a good practice whack with ! . MO actorNu(oq'MOactordobjN(qq>5" 2N(rq#That would reveal your presence. N(sq gN(uq&You lash out at the shadow dog with !< ' and it gives a great barking laugh. QN(wq You give !  a good practice whack with !< . $#hMO actorNq>5" 5Nq&That would require a physical body. Nq)_MO actorNqThere really isn't enough of !<  to suitably climb. hMO actorNq>5" 5Nq&That would require a physical body. Nq)uMO actorNZq5For a moment the daft thought of actually drinking !<  crosses your mind. MOactorioNq>5" NqWhile it would be amusing to see the reactions of the tavern denizens if objects started floating about the room, that would destroy the deception you worked so hard to create-- that the tavern is free of all fey influence. {MOactorioNq\^!E does not appear particularly interested in what you are offering. d[MO actorNvq You don't really want to give !<  away, do you?  hMO actorNq>5" 5Nq&That would require a physical body. Nq)PMO actorNEq You give !<  a good tug to no avail.  MOactorioNq>5" NqWhile it would be amusing to see the reactions of the tavern denizens if objects started floating about the room, that would destroy the deception you worked so hard to create-- that the tavern is free of all fey influence. Nq< > E ~FNq> <& You toss !<  at ! .\Nq~6Nq%You're% not carrying !< . Nq< aMOactorioNq>5" NqWhile it would be amusing to see the reactions of the tavern denizens if objects started floating about the room, that would destroy the deception you worked so hard to create-- that the tavern is free of all fey influence. :Nq You toss !<  at ! .  <& 5MO actorNq~Nq) 1MOactordobjN!q MOactorioNXq>5" NXqWhile it would be amusing to see the reactions of the tavern denizens if objects started floating about the room, that would destroy the deception you worked so hard to create-- that the tavern is free of all fey influence. NXq< > E ~FNXq> <& You toss !<  to ! .\NXq~6NXq%You're% not carrying !< . NXq<]MOactorioN< q You toss !<  to ! .  <&5MO actorN q~N q)1MOactordobjN q MO actorN q>5" 2N q#That would reveal your presence. ?N q You give !<  a good poke to no effect. MO actorN q>5" 5N q&That would require a physical body. gN qYou fuss about with !< : for a bit, but simply don't end up accomplishing much. MO actorNt q>5" Nt qWhile it would be amusing to see the reactions of the tavern denizens if objects started floating about the room, that would destroy the deception you worked so hard to create-- that the tavern is free of all fey influence. Nt q< > E ~FNt q> <&You pick up and fling away !< . \Nt q~6Nt q%You're% not carrying !< . Nt q<MMO actorNSq>5" NSqWhile it would be amusing to see the reactions of the tavern denizens if objects started floating about the room, that would destroy the deception you worked so hard to create-- that the tavern is free of all fey influence. +NSqYou fling away !<   <&hMO actorNq>5" 5Nq&That would require a physical body. Nq)JMO actorNqGracefully you stand atop !< . {hMO actorNdq>5" 5Ndq&That would require a physical body. Ndq)}}HMO actorNq)You can see no obvious way to do that. hMO actorN q>5" 5N q&That would require a physical body. N q)HMO actorNq)You can see no obvious way to do that. zMOactorioNq>5" NqWhile it would be amusing to see the reactions of the tavern denizens if objects started floating about the room, that would destroy the deception you worked so hard to create-- that the tavern is free of all fey influence. _Nq! NNqAs expected, ! % is unmoved by the demonstration. aMO actorN\q>5" N\qWhile it would be amusing to see the reactions of the tavern denizens if objects started floating about the room, that would destroy the deception you worked so hard to create-- that the tavern is free of all fey influence. KN\qAs expected, !< % is unmoved by the demonstration. %77$VMO actorNq>5" ,&That would require a physical body. )FMO actorNuqAssiduously you clean !< . VMOactorioNr"!<" you say to ! . VMOactorioNr"!<" you say to ! . NMO actorNyr"!<" you say to !< . XMOactordobjNr"!<" you say to ! . ZMOactorioN+ r"!<" you whisper to ! . ZMOactorioN r"!<" you whisper to ! . RMO actorN r"!<" you whisper to !< . \MOactordobjNCr"!<" you whisper to ! . MOactorioNr"\^!<" you yell at ! ,, which remains silent at your onslaught. VMOactorioN,r"!<" you say to ! . NMO actorNr"!<" you say to !< . XMOactordobjNr"!<" you say to ! . MOactorioN:r>5" 5N:r&That would require a physical body. 5N:!r)You can see no obvious way to do that. MMOactorioN#r)You can see no obvious way to do that. HMO actorN'$r)You can see no obvious way to do that. OMOactordobjNu&r)You can see no obvious way to do that. MOactorioN)r>5" 5N*r&That would require a physical body. 5N,r)You can see no obvious way to do that. MMOactorioNd.r)You can see no obvious way to do that. HMO actorN/r)You can see no obvious way to do that. OMOactordobjN1r)You can see no obvious way to do that. MO actorNZ4r>5" 5NZ5r&That would require a physical body. =NZ8r"You smile enigmatically over at !< . PMO actorN:r"You smile enigmatically over at !< . [MO actorNM =r>5" 5NM >r&That would require a physical body. @NM @r%Furtively you reach over and pinch !< . \SMO actorN Br%Furtively you reach over and pinch !< . MO actorNF DrnStealthily you stalk your prey, lurking unseen, baiting, waiting for just the perfect moment to pounce upon !< . MO actorN FrnStealthily you stalk your prey, lurking unseen, baiting, waiting for just the perfect moment to pounce upon !< . qMO actorN Jr<  D< ! AN Kr5Such a thing does not yet exist within your lands. vMO actorN MrYou summon forth !<,. which immediately appears at your command. > <&eMO actorN} Sr>5" 2N} Tr#That would reveal your presence. N} Vr)UMO actorN Xr'You howl mournfully at the oblivious !<. VhMO actorNC [r>5" 5NC \r&That would require a physical body. NC ^r)WWMO actorN `r>" /N arYou scratch at !<. LN crYou scratch and claw at !< with your sharp talons. eMO actorNWfr>5" 2NWgr#That would reveal your presence. NWir)JMO actorNkrYou coo affectionately at !<. MO actorNnrPMO actorN6pr1You shouldn't fling your name about like that. eMO actorNsr>5" 2Ntr#That would reveal your presence. Nvr)TMO actorNxr%You blurble at the uncomprehending !<. eMO actorNQ|r>5" 2NQ}r#That would reveal your presence. NQr)PMO actorNr"You whistle to the unresponsive !<. `MO actorNrlGMO actorN6r\^!<  isn't going anywhere. TeMO actorNr>5" 2Nr#That would reveal your presence. Nr)SSeMO actorNr7For some odd reason, you decide to beg the pardon of !< .  MO actorNYr MO actorN}rEh... !< _ is suitable as it now. If you want something different you can just create it from scratch. MO actorNr>5" fNrWNot only would that would require a physical body but it would reveal your presence. Nr)MO actorNrYou wrap your !> wings  arms around !<  and embrace it tight. Alas, !< $ does not return your affection. MO actorNlr>5" NlrWhile it would be amusing to see the reactions of the tavern denizons if disembodied laughter suddenly filled the room, that would well and truly destroy your disguise. Nlr)tMO actorN_rYou merrily laugh at !< . \^ !< " does not share your merriment. MO actorNrMO actorNrqFar, far too dangerous an undertaking, especially considering what happened the last time you foo'd something. &//%sMO actorNrtKMO actorN=r,That would require the presence of water. eMO actorNr>5" 2Nr#That would reveal your presence. Nr)HMO actorNrYou growl menacingly at !< . hMO actorNGr>5" 5NGr&That would require a physical body. NGr)MO actorNryIt would be a greater challenge to bewitch something that wasn't already under your power. And something more animate. }hMO actorNSr>5" 5NSr&That would require a physical body. NSr)~~nMO actorNr"You gently, yet firmly, squeeze !< ". It feels as one would expect. hMO actorN5r>5" 5N5r&That would require a physical body. N5r)zMO actorNr%You lather your affection all over !< . Your perfect, flawless !<! dkMO actorN#r>5" 8N#r)You can be no better hidden than this. N#r)eeMO actorNr>" r You hide !< . within the voluminous folds of your cloak. <&SNrYou decide that burying !<  will hide it the best. <ThMO actorNmr>5" 5Nmr&That would require a physical body. Nmr)UUMO actorNr>" XNrYou poke at !< 0. This might be more amusing in another form. ANr&Desultorily you peck and scratch at !< . NeMO actorNr>5" 2Nr#That would reveal your presence. Nr)MMFMO actorN rYou sigh wistfully at !< . VhMO actorNVr>5" 5NVr&That would require a physical body. NVr)UU\MO actorNr.You signal your great boredom by yawning at !< . "eMO actorN&r>5" 2N&r#That would reveal your presence. N&r)##UMO actorNr'On a whim you begin barking madly at !< . MO actorNrsMO actorN r$You try to breathe life into your !<%, but alas it is dead, dead, dead. eMO actorN s>5" 2N s#That would reveal your presence. N s)  JMO actorN s You accept !<  for what it is. \eMO actorND s>5" 2ND s#That would reveal your presence. ND s)[[;MO actorN s You reject !< . ReMO actorN s>5" 2N s#That would reveal your presence. N s)QQHMO actorN[ sYou gasp in surprise at !< . XeMO actorN s>5" 2N s#That would reveal your presence. N s)WWvMO actorN s You pour out all your woes to !< ,. A good listener, if not a good advisor. ahMO actorN s>5" 5N !s&That would require a physical body. N #s)bbpMO actorN $sQYou may wish to try and feed something with a mouth. Not to mention a stomach. MO actorNt 's>5" uNt (sfNot only would that would require a physical body but it would well and truly reveal your presence. Nt *s)XMO actorN"+s You spank !<  for being a bad !<. PeMO actorN1s>5" 2N2s#That would reveal your presence. N4s)OO]MO actorN5s/A sudden impulse has you bidding farewell to !< . hMO actorNN:s>5" 5NN;s&That would require a physical body. NN=s)MO actorN?s>" 5N@s You give !<  a good peck. NCs"You gently press your lips upon !< , engage your tongue with a flourish, and enthusiastically kiss the unresponsive thing. As amusing as this is, perhaps you ought to find a more lively object for your affection. NEs>  E >" NGs#\b"Well, he certainly loves that !< ..." says !>F dryly. \b You raise your eyes to discover that half that tavern is watching you with expressions that range from amusement to disgust. NIs> > NKsd\b As if reading your mind, Val suddenly says. "It seems such a sin to waste those lips on a mere !<. "\b~3eMO actorNPs>5" 2NQs#That would reveal your presence. NSs)22hMO actorNUsIIt is nigh impossible to free something that does not wish to be free. MO actorN~WsMO actorNYsVYou draw forth your power and the world around you ripples into shields around the !<0. Hmmm... perhaps that was a bit of overkill. ceMO actorNX\s>5" 2NX]s#That would reveal your presence. NX_s)dMO actorNas%You blow a thin stream of air upon !<  to little effect. hMO actorN-ds>5" 5N-es&That would require a physical body. N-gs)XMO actorNis9Perish the thought! You do have some standards! '|,|,|,|,&YeMO actorNps>5" 2Nqs#That would reveal your presence. Nss)ZZ+MO actorNvs>  E >" NxsHWith a wicked cackle you summon forth great gouts of flame to consume !<  . The flames lick greedily at !<  but not content with such a paltry meal, the fire stretches outwards to the newly waxed floor and catches within the dry wood of the tavern walls and timbers. \b Behind you some woman, either !>3 or the tavern maid, lets loose with a piercing high pitched scream. The drunkard awakens with a snort and nearly bowls you over in his sudden rush to leave the building. Tables, chairs, and benches are overturned in the chaos as the tavern denizens scramble to get out of the way. \b "FIRE!" some helpful person shouts and the stout tavern keeper is pushing past you with a basin full of washwater, as if such a thing could ever hope to stop the inferno now raging within the front room. \b You have to give credit to the old men, with more courage than sense, trying to beat at the edges of the flame with their ratty cloaks. And then one such cloak catches aflame within the hands of its owner setting the middle of the ceiling into fire. Everyone retreats in the face of the wall to wall blaze. \b All save for you. You stand in the midst of the inferno, watching the flames dance about in colors of blue, gold, and red. Observing the plumes of smoke drifting in thick pools across the room, first pale and then darker and darker as the building is consumed. Fire licks at the upper stairs, at the floor below, and the ceiling above, burning and burning and burning until there is nothing left to kindle. \b You stand amidst the ashen dark wreckage of what was once the tavern, your favorite place in all your domains. Oops. Ns">&u$Ns>  E >" E >" NsC-$Ns>  E >" E >" NsC #Ns>   E >    Ns]You summon forth a great gout of fire to consume the white mage. From deep with the flames !> ! Lorekosi  the mageB laughs and the fires sputter out with trailing wisps of smoke. >  "Ns>  E >   E >" NsYou rain fire down from the heavens. Lorekosi raises one hand upwards and summons forth a barrier as his eyes never leave the figure of Val. "Ns>  E >   E >" NsYou rain fire down from the heavens and upon the figures of the two mage. Only rhe faintest bit of smoke wisps up from the dark coat of Val and Lorekosi remains as ever untouched. !Ns> > E >  E >" E >" NsBIn desperation you summon forth great gouts of flame to consume !< 0. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. Val leaps back from the sudden blaze, the flute held loosely in his hands.\b You are free. With a great fluttering of dark wings you are airborne once again, circling once, twice, thrice, and then you swoop out of the sky and steal the silver flute from Val's grasp. The mage's head whips around towards you, his hand raising, and then he hesitates and you are gone, soaring away to the northeast.\b Val pursues you on foot but he is quickly left behind in the sands of the grove. You fly over your lake, pausing only to drop the silver flute into its clear waters, before circling back. With a "PUFF" the fire is easily put out before it spreads and damages the rest of the meadows. Ns>&>>&!*Ns> > E >  E >" E >" NsBIn desperation you summon forth great gouts of flame to consume !< 8. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. Val leaps back from the sudden blaze, the flute held loosely in his hands.\b You race forward and snatch the heinous thing from his grasp. Val turns quickly towards you, his eyes narrowing. \b "Your music is wretched," you say. "I can play far better," and you put your lips to the mouthpiece of the flute and blow such a screeching shrill note that it sends both you and Val staggering as you clutch at your heads. \b Val pries the flute away from you while you are distractedly wondering if you should try to tear your ears off or not. "I think that's quite enough flute playing from the both of us today. " he says. Or you think he says. He could have been speaking about drink fat white earfluff from bootslaying growth at a buffet. \b Val tucks the flute back underneath his cloak and, still shaking his head a bit, wanders off to the north. With the mage's back turned to you, you carefully put out the fire before it can spread any further. Ns>>&!7Ns>  E> > E >" 2NsHWith a wicked cackle you summon forth great gouts of flame to consume !<  and burn away the intruding ofuda. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. You bask in the glow, in the warmth, as the fire eats away at its meal. \b And then in a shower of multicolored sparks the nearby tree catches aflame and then the next and the next. The albino trees that you labored so hard to create with their strange sweet smelling sap ignite like so much dried kindling. From branch to branch to fire leaps, until all around the trees are brimming with blossoms of flame. \b With a curse Val covers his face with his cloak and rushes out of the forest. Ns>!">&!>&Ns>  E> > E >" !NsHWith a wicked cackle you summon forth great gouts of flame to consume !< u and burn away the intruding ofuda. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. You bask in the glow, in the warmth, as the fire eats away at its meal. \b And then in a shower of multicolored sparks the nearby tree catches aflame and then the next and the next. The albino trees that you labored so hard to create with their strange sweet smelling sap ignite like so much dried kindling. From branch to branch to branch the fire leaps, until all around the trees are brimming with blossoms of flame. \b "Oh gods, my trees!" you yowl in pain as wreathes of smoke hang thickly in the air and petals of sparks rain down from the trees. "Do something!" you yell at Val. \b "Me? Do something?" says the mage as he looks all about him, at the forest all aflame from tips of blazing leaves down to the stony ground. "It's too late!" he coughs. "We have to get out of here!" he says as you steadfastly ignore him. \b "Hark! Snugglebums!" and Val finally grasps your shoulders and drags you bodily out of the forest towards the barren earth of the hills. \bNs">!>>&!>&Ns>  E >  E >" %NsRWith an inwardly wicked cackle you summon forth great gouts of flame to consume !<  amidst shrieks of surprise from your companions. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. And then the plumes of fire reach out arms towards the humans scattered about the courtyard. And towards you as well, lest you feel left out. "Great gods!" yells Old Coot. "Tis like the story where some fool caught the phoenix and it built up a nest and set everyone on--" the old man's story is cut off as he dashes inside the tavern. \b "I don't know if it's so wise to be running into a wooden building" Layna says as she backs away carefully from the flames. And with that the fire flares up once more and then collapses upon itself, embers dying away into ashes that flit away in the wind. \b "I don't suppose either of you dropped your pipe in the straw?" Layna says dryly as she wanders over to the horse trough and washes her arms, all the while still eyeing the remnants of the blaze. \b "A welcoming gift from the fey, I would think," says Val. "Its power extends all the way here?" says Layna as she purses her mouth. \b "To the edges of the courtyard, most probably," you assure her. Ns>"!<&5 Ns>  E >  E >" E >  NsRWith an inwardly wicked cackle you summon forth great gouts of flame to consume !< < amidst shrieks of surprise from Layna. The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. And then the plumes of fire reach out arms towards the humans scattered about the courtyard. And towards you as well, lest you feel left out, burning higher, brighter... "It's going to set the tavern on fire!" Layna yells out. \b She's wrong, you would never let something so foolish happen to your tavern. But she would have no way of knowing this, nor Val either, who seems to have taken her warning seriously. The young man edges over to the horse trough, dips his fingers into the water, and flings the droplets towards the blaze. \b Only they are droplets no longer, but a slender stream of water that rains down upon the fire, quenching it with a bubbling hiss. Both you and Layna stare at the pale haired stranger. \b "A mage," Layna says. "You are a--" and color drains from her face. \b "I do know a bit of magic," Val says simply as he gazes at the girl. And all your attention has turned upon him. \b "A bit too much for my comfort." says Layna. "I have no wish to be involved in such a few hunt. Good day to both of you. " The maiden hitches her divided skirts close to herself and half runs to the tavern. \b "More afraid of me than of the fey," Val muses, his tone dry. \b "I can't say I blame her," you reply and Val turns to you with a half smile. \b "And yet you won't run away?" he says, not truly asking. "Shall we be off then?" and Val pulls his satchel across his shoulders and sets off for the northwest. Ns>>"!<&!">&Ns>  E >  (NsYou summon forth great gouts of flame to burn and consume the mage. With a roar the arms of the blaze reach out towards Val, yet they slow and stop a mere handspan from him, dark smoke hanging thickly, glowing tendrils licking forward, yet unable to touch him.>NsHWith a wicked cackle you summon forth great gouts of flame to consume !< . The flames leap and dance, higher and higher and higher yet, burning so prettily, with wavering colors of blue, gold, and red. You bask in the glow, in the warmth, as the fire eats away at its meal. \b Eventually, with the remnants of !< d burned away into nothing, the fire dies away into embers, into ashes that blow away in the wind. Ns<&Ns>  Nsz\b Val, who has silently watched all of this with nary a comment nor a movement, turns away from the last dying embers. ) X %X %X E  2QMOvNU% < NU& < NU( "NU) oMOvdpiN, \^!<  !<n't appear interested. N- *N. ~'MO objN!/ M6MN2 \^!<, is here. N3 MO itemN6 \^!<  !<} carrying !  and won't let %youm% have !. N8 `KMO actorN; But !<  is right here! N< &NMO objNk? <aNk@ < <a&NkA )&NkB p6MND < he< sheitq8MNE < his< heritsr<MNF < he's< she's it'ss7MNG < him< heritt<MNH < he's< she's it'su sv esw hasx doesy iszMNN < b'MOwordlstNJO !%MOactoriobjNwP PMOactoriobjOlstitotNU /NV NW  E,@ itthemhimher ! D  @NZ "Could you be more specific?"N[ N\ N_ 8Na @<bNb Nc Nf <cNg c !!"I don't know much about that."dMO actorNk !If you want something given to !< , just say so.Nl d]MO actorNo  0Np $That wouldn't accomplish anything!Nq eSMOactordobjNt \^!<  rejects the offer.Nu `MO roomO(Eold_loc_visiblenew_loc_visibleNT~ ! E fNT gNT ! NT NT < ! E< CNT CNT C ! EC EENT <hNT <&NT C ! EC EENT <iNT hOMN < IN \^!<  leaves the area.N iOMN < IN \^!<  enters the area.N **<***2+X$$$5,MO actorO %waslitN5n  N5q "-N5r "N5s %You% switch%es% on !< N5v  EHN5x , lighting the area.\bN5y  N5z N5| .N5} , $ $ 2MO actorN!I   D  ! 0N!P I don't see that here.N!Q !N!Z  N![ N!\ PMO otherRoomNh $%You% can't reach that from here. Ni MOvN p "BMO actorN9u <BD>C<N9v <9N9x <BN9y <DN9z "BN9{ N9| E MOmeActorN [MOavdpiN < #N < N CMO objNG  Dropped. NG &NG FG2MO objN <FFN MO actorO"tmplistthisobjitotN <FN N N dN @N HN <FFN N N I \n\t  JMN <IK oMO verbosityOlcuritotN N <JN <N <KN <N N N \N @N N LN N N N <IN <4N %You% see%s%  here. N N  \nN <N N N N @N GN C *N <IN MN N N N jN \nN EMN @" E@ N! Z N# <N% N' >>!N(  N* N+ 'N. <N/ <IN0 N1 MN@ <NA ]MO verbosityND <NE <NF <NH <NI NMNQ <OMNR <PMNS <QMNT <RMNU <SMNV <TMNW <UMNX <VMNY <WMNZ <XMN[ <YMN\ <1MNb %You% can't go that way. !-7+MO actorN!8 3MO actorNE; <  3NE< There's nothing in !< . cNE= <! 8NE> There's nothing else in !< . NE@ <<.NEA GMO actorND <  D<! NE )NF 4cMO actorN\I <  D<! N\J )4N\L <<.N\M .5+}MO actorN F%You%'ll have to be more specific about how %you% want%s% to search !<. N .MOactorlistOfounddestitotN </:N N N )N N !N N  N @N N N <0N  N %You% find%s% N N N N @,N N , nN  E  N  and 9N  E  N , and N @&N N N <0(N , which %you% take%s%. N ! N ! E N !N N /0/8555Y~}*MO actorNV-PNW*MO actorNOZ-PNO[MOactorioN^<|QN`%You% can't lock !<  when !< open. NbNc<~ 1Ne Locked. Nf"rNgBNi\^! !n't fit the lock. NjMOactorioNm<~ 3No Unlocked. Np!rNqBNs\^! !n't fit the lock. Nt0  2EMO actorN9d %You% can't have < . N9e 4MOactorioNh <Ni EMO actorNl %You% can't drop < . Nm 4MOactorioN p <N q RMOactorioNCt %You% can't put <  anywhere. NCu RMOactorioNx %You% can't put <  anywhere. Ny EMO actorN| %You% can't move < . N}  QMOactoriobjN> %You% can't throw !< .N> 1LIII)MOremcurtotiNt <ZNu "Nw >[Nx Ny Nz cN| @N} E N~ "N N N !N MO#actorvdobjprepioN" <E \=N" %You% can't see a thing. N" *N" N" )N" HMN <N )N In the dark.N _MO verbosityN <N ) N It's pitch black. N TMN <N )&N N !N N yMOvN <D \N "7N It's pitch black.\nN !N N 2.#MOavipN, E - E + >N\^!< too far away.N*NN"7MOavdpN<#3,[MO objNu\^!  falls from your grasp. Nu&?MO actorNzu>J" E >J  E> > E >  E >" NzuVal pauses and stares at you. "You... might be in the wrong form for that," he finally says as he eyes you up and down in the frilly dress. \b"),Nzu>K" E >K  E> > E >  E ><" Nzu"Lo behold the errant knight, in shining armour bright!" he says with a laugh. "I see you have well and truly gotten into the spirit of the quest. \b"<)4Nzu> > NzuC)FMO actorNu> > Nu)45/MO actorN <N 6hMO actorNN That was delicious! NN >7<87NN !<&NN 8MN >95PPPPujMO actorN<r2N\^!< locked. NN)uN{cMO actorN!<r7N#\^!< already locked! N$N%}MO actorN(<|AN*%You%'ll have to close <  first. N+.N. Locked. N/"rN0N1WMO actorN4<r*N5\^!< not locked! N6CMO actorN9 Unlocked. N:!rN;_MOactorioN7><r.N7?\^!< already locked. N7@MOactorioNC<r-ND\^!< not locked! TNE<~! BNF(%You% %do%n't need anything to unlock !<.NG6   .NpgMNk<|Nl<qNm<rE<sRNo"<tNp (Opening !< )\nNq<qNr^Nu%You%'ll have to open !<  first. NvNw!NxNyuMO actorN |<|/N }\^!< already open. 6N ~<r&N \^!< locked. N tgMOsettingN|N<v! E<v| N<vtNwgMOsettingN"rN"<v! E<vr N"<vwN"xAMO actorN Opened. N"<tNy[MO actorN<|.N\^!< already closed. NzAMO actorN7 Closed. N7!<tN7{MO actorN~<r1N~\^!< already locked! N~<|2N~\^!< can't be locked. JN~<|:N~%You%'ll have to close !< first. N~}kMO actorNj<~! 1Nj Locked. Nj"<wNjNj-PNjWMO actorN<r*N\^!< not locked! NmMO actorN8<~! 3N8 Unlocked. N8!<wN8N8-PN8?MOactorioN<r1N\^!< already locked. N<|2N\^!< can't be locked. N<~! DN&%You% %do%n't need anything to lock !<. JN<|:N%You%'ll have to close !< first. NMOactorioN<~ 1N Locked. N"<wN?N\^! !<n't fit the lock. NMOactorioN<r-N\^!< not locked! UN<~! CN(%You% %do%n't need anything to unlock !<. NMOactorioNQ<~ 3NQ Unlocked. NQ!<wNQ?NQ\^! !<n't fit the lock. NQMN<|'N\^!< open. qN<r4N\^!< closed and locked. &N\^!< closed. NNMO actorN 5MO actorN There is no answer. MO actorN 3MO actorN: <gN: 7  WMN<|MN<|MN <  <}N<|-N open. N)N@N closed. NX"N)NN|ujMO actorN <|>N  <  !<} already open! N N xMO actorN}<>N} Opening <  reveals . N}N} Opened. N}"|N}ymMO actorN<|@N <  !<} already closed! NNzAMO actorN Closed. N!|NeMO actorN<|8N <  !<} closed. NN_MO actorN9<|E X"&N9\^!< closed. N9+&MO actorN<8<49<&MO actorNv<6(MO actorNEv!<y&MO actorNs v<(MO actorN!v!<uu That was refreshing!:0MO actorNujMO actorN=uTraipsing about with < . might bring a wee bit too much attention...;45mbMN<CN(Taking off <  first)\nN!NN8MO actorN<mN)N=MOactorioN<mN)N=MOactorioN<mN)N=MOactorioNE<mNE)NE =MOactorioN<mN) N=MOactorioN<mN)N8MO actorN<mN)N&7MO objNL!NL)&NLpMO actorN<E <:N%You're% already wearing < ! NNnMO actorN<  zN (First taking !< )\nN MI  N *N<   N*NNOkay, %you're% now wearing < . N"NnMO actorN<D <6N%You're% not wearing < . NN oMO actorNc$ < oNc&%You% could drop !< +, but %your% hands are too full to carry !<. Nc(QNc,#Okay, %you're% no longer wearing < . Nc-!Nc.Nc/NMO actorNg2<Ng3<Ng5)Ng6NMO actorN9<N:<oN<)N=o<"MN"!<","MN"!<" "MN"!<"MOactorio>MOactorioN"Tap, tap, tap, tap..." MO actorN+MO actorNO<4NOSave failed. NO!NO+NO Saved. NO"NONO9MO actorN<N+NMO actorN!2MO actorNE<&NE9MO actorN}<N}+N}MO actorNQMO actorN<NWriting script file. N9MO actorN7 <N7 +N7 MO actorNv?MO actorN Okay, "<".N=**F*F*'JhMO actorNs>5" 5Ns&That would require a physical body. Ns)KKKMO actorNsYou tread carefully on the !< . hMO actorNs>5" 5Ns&That would require a physical body. Ns)wMO actorNFtYou belch hot air at !< 6. In another form this might be far more dangerous. PhMO actorNt>5" 5Nt&That would require a physical body. Nt)QQqMO actorN1t You give !< < a rousing slap for its impudence. How dare it defy you?! hMO actorN t>5" 5N t&That would require a physical body. Nt)oMO actorNt<" Nt<o6Nt\^!<  has no clothes to take. eMO actorNt>5" 2Nt#That would reveal your presence. Nt)MO actorNtYou gently shake !< K but it seems that much more than that is required to awaken it to life. eMO actorNt>5" 2N t#That would reveal your presence. N"t)`MO actorN$tAThat's not for sale. Simply take it, if you desire it so much. gMO actorNU&t>5" 4NU't%That would require a physical body.NU(t)LMO actorN*t You give !<  a resounding knock. MOactorioN-t9 E  rN.t! Y is not really appropriate for digging. You could probably dig just as well without it.MO actorN0t>5" N1tWhile it would be quite amusing to see the reactions of the tavern denizens if a disembodied voice began cursing them out, that would destroy your deception that the tavern is outside of fey influence. N2t)MO actorN4tHThe day around you darkens as you pull down abominable hexes, cursing !< + and its kin to the ninth generation. If !<  even has kin. gMO actorN6t>5" 4N7t%That would require a physical body.N8t)QMO actorN :tYou casually lift !<  over your head. dMO actorNW 5" 1NW =t"That would reveal your presence.NW >t)HdMO actorN At>5" 1N Bt"That would reveal your presence.N Ct)GGKMO actorN+ EtYou call out a greeting to !< . MO actorN| Gt>5" N| HtyAlas, as amusing as it would be to moan frightenly at the tavern occupants that would reveal your trick for what it is.N| It)GMO actorN= KtYou moan dreadfully at !< . gMO actorN Mt>5" 4N Nt%That would require a physical body.N Ot)AMO actorN Qt\^!<  is not braided! MO actorN> Ut>5" 5N> Vt&That would require a physical body. _N> Xt<" E<" E<" D<*N> YtThat isn't holding anything!fMO actorN [tYou empty the contents of !<  onto the ground. > ,MOactorioNi ^t>5" 5Ni _t&That would require a physical body. Ni at<" E<" E<" D<8Ni bt\^!<  isn't holding anything!bNi ct" E " E " 5Ni dt\^!  can't hold anything!qMOactorioNftYou empty the contents of !<  into the ! . MO actorNgtoMOactordobjN6itYou empty the contents of !  into !< . WMOactorioNlt You defend !<  against ! .WMOactorioNnt You defend !<  against ! .MO actorNeotYMOactordobjNqt You defend !  against !< .+MOactorioNwt>5" 4Nxt%That would require a physical body.Nyt<" E<" E<" D<8Nzt\^!<  isn't holding anything!bN{t" E " E " 5N|t\^!  can't hold anything!qMOactorioN~tYou empty the contents of !<  into the ! . MO actorNtoMOactordobjNtYou empty the contents of !  into !< . MOactorioN)t>5" 4N)t%That would require a physical body.IN)tYou carefully exchange !<  with ! . < &E  <&)MOactorioNtFI!%MO actorNtFEE!,MOactordobjNJtFUM!DMO actorN|tNothing will fit in !< . ^MOactorioNt>5" 4Nt%That would require a physical body.Nt! Nt<  ;Nt <  is already inside  ! Nt ^Nt7It would take quite a bit of bending of space to put <  inside itself. 2Nt <Nt<ZMOactorioN*t<& You put !<  into ! . UMOactorioNt>5" 4Nt%That would require a physical body.Nt! Nt<  7Nt <  is already on  ! Nt YNt7It would take quite a bit of bending of space to put <  on itself.2Nt <Nt<ZMOactorioNt<& You put !<  into ! . (gMO actorNEt>5" 4NEt%That would require a physical body.NEt)))MO actorNt>5" 4Nt%That would require a physical body.1Nt!<@ !< . You do a little jig around 8Gracefully you go through a few paces of a waltz with You prance and strut about Wildly you jitterbug around You do the dance of joy with  Seductively, you dance around MO actorNt>5" NtVAs amusing as watching the chaos ensue after a disembodied voice started serenading !< `, that would destroy your careful deception about the tavern being free of all fey influence.  NtoMO actorN%tYou !<@ to !< %. It remains unmoved by your song. sing a little ditty lilt out a love songcroon a soft lullabye chant an ancient lament !warble out a high pitched tune %sing about a bird in a gilded cage 9MO actorNLt>5" 4NLt%That would require a physical body.NLt>  D >  D > m D > c D> > D> > D> >  D> > D> >! NLt)DNLt8There is no body of water suitable for drowning here. MO actorNt>5" 4Nt%That would require a physical body.&Nt>  yNt You toss !< L down into the gaping mouth of the well, probably never to be seen again. <&Nt> m E<D" VNt You toss !< ) into the peaceful waters of the lake. <&&Nt> m E<D" VNt You toss !< ) into the peaceful waters of the lake. <&Nt You dunk !<  under the waters, holding it submerged for several moments. Then you shrug and wander off to find something more productive to do. > <&>MOactorioN t>5" 4N t%That would require a physical body.N t>  D >  D > m D > c D> > D> > D> >  D> > D> >! N t)DN t8There is no body of water suitable for drowning here. )MOactorioNT!tFI!MO actorN!t>  D >  D > m D > c D> > D> > D> >  D> > D> >! N!t)DN!u8There is no body of water suitable for drowning here. MOactordobjN|"u N|"u You toss ! L down into the gaping mouth of the well, probably never to be seen again. &N|"u> m E<D" \N|" u You toss ! ) into the peaceful waters of the lake. &pN|" u> m E<D" \N|" u You toss ! ) into the peaceful waters of the lake. &N|"u D D D  D! N|"u You dunk !  under the waters of !< u, holding it submerged for several moments. Then you shrug and wander off to find something more productive to do. > <&]MO actorN%u>5" N%uVAs amusing as it would be to see the chaos caused by a disembodied voice talking to !<V that would ruin your great deception about the tavern being free of fey influence. rN%u>" ^N%uR"KAK KAK KAW!" you loudly say. Alas, bird beaks were not made for human speech. 1MOactordobjNv&uMOactorioN&u>5" N&uVAs amusing as it would be to see the chaos caused by a disembodied voice talking to !<V that would ruin your great deception about the tavern being free of fey influence. N&u>" aN&uR"KAK KAK KAW!" you loudly say. Alas, bird beaks were not made for human speech. hN& u\You struggle to put your thoughts into words and finally decide its not worth the effort. _MO actorN~("ua1MOactordobjN($u^MO actorN((u>5" 4N()u%That would require a physical body.0N(*u$There's no obvious way to do that.MOactoriobjNh),u>5" 4Nh)-u%That would require a physical body.0Nh)/u$There's no obvious way to do that.MO actorN)1u>5" 4N)2u%That would require a physical body.0N)4u$There's no obvious way to do that.>.4FSTBllxxc88 LL0  ddB  TTPP*  < W \\^  00  HHCUXX @@!HH">#Y$t%,, &>'00I(<< )"*tt#+X$,M$$-Xx$.33$/X0sZ1]2]4t_5, ce6$e7f8f9g:h;i<j=  zk?` n@nApqC\'sDJsEwFHHxG|0OzHiizIDDJYK<:OLMXNOPd"Q$"RHGSXlTXUXVWXYzZV[U\dc:]D;^,"*"_85#`S%adv%b5%cH%dr'e$(f|A(gX^(h`{(i(jd"(l|(m|(n` )od!?)pd!g)qA)r|)s)t*uH.*vK1wV1x36y=P6z6{|7||;7}|X7~du7u7C8LX9L99|:(8:$;x;|;X<|/<|L<=i<` <=<S=r>X?J.??|;@X[N|xNN(NOOPPSQmQnQ|R|S?9S?S>S> TCOTCTCTC-U|wU|U|U UXUXVX-VXJVXgVXVXVXVXVXVXW2W OWtWWYZZd][(N]X;_.aL addj0epef` fh%fd"gd$1gh%\gd#gd#gd$gXh$hhni  r|<)vlvz.z}@@hh/dd ŠXuTT00J$u<<הTTޕg9U&I0F0mm<t2;HIMPT  VT"`=f=T=j[F[B@||X%p.T+X=3Z3JEJ7qqg33 \**. *)X !!{  x5Ƥ ˨`TfT+@$XA4 ()HH*\V1u1^5K)K\c O-d!P d"ru# v$fy%l*Xz&h~'~(\փ)9*\+X,\-y.R#/x5|0Q1\2^234P[56Ws7Ѭ8P9r:};Q<=V>?Q@$AdB@:Ca>Dd$EHFIHG&&(H SRlOID QJXKF&LbsM@@ܵN#O`ԶP`QR`S`(TMU`#V`HWmX`EY`jZH[|z\`]`C^eh_X`RaLb(cPdl+e`f\8gh"i<jkol\  'mH  JnWo8 p= r. sxtv8u g v#w'xY(y\+zd#9.{c0| P 2}n?~ W &AK8dLL cNTsPl,SVl\t4_YLcdcegp/i,lym|:m0ot3rHvG@y({L{OΆ$GwMT ӐC>.esߖKp\¢el,Q\  X@+*,N j L [` k Z g< )> +le,-,z/<l114>6U89<T>0ABnJEFiI0K=N0O,R4T8eW8c\__ascgirknoHr@`t;wxL{ |}P-p/HT؃lqe݈ w$S83C/Ny\Λ8 P/H<%e߲LKjXiɵH9XEHdGfL 8HI1 Sfl*$ |9|:3h%tPhj  v  o4    5C  F  @  u <   ($ H& f) M+ O- F00 M}2 Y4 x617 on9 s;  T^> !xA "X6D #@@F $l)F %k J &H~M '\P )0V *Y +\ ,@na -p/rc .\d /@g 00i 1Lk 2Lm 3o 4,q 5Ls 6L{u 7 Ww 8;y 9]{ :d ; <@i = m > S ? @8ݔ A(ە BlǗ C$ə Dn} EK FCD G H4 I J(} KHl Ld#{ M  Nxr O? P?7 Q} R' S| TT U0 V W X= Y Z [, \,~ ],n ^_ _8@ `$< a$% bL  c di e f8 gx0 h i j ko^ l mj nd#@! odj" p4# q$ rx* s(5+ t,$, ul,. vL I/ w@Z4 xt3^7 yD9 zL < {? |B }E ~F LK 8nM kO `rd t4d e Xl x7t 87w `Dy @>iy `z z `| | `~  `ހ |y ` TT ` ( `߈ 44 `? d `- `R `w ` ` ` ` `0 `U uz m j  @ ' 4 ֛ >C>ѧ < xx p0_ x8b Qd g bh D5k >n `t `>t `ct `t `t `t `t `u `Au p.fu 0y } <' )' h$W l#  6 y t4 Ξ kv h W  T v n+   L   u tD  l) H , |  m r u t2 xQ OX I   4 8N xJ eS  @   W / ` H p-   e ,a t2T  V' x6  PI" 1`' e*  a - l8 <: ? B 5FF T\ c  q zd 0q w /^z p/}  ʁ  H  o_o    X  ` ` ` ID X  S: D   {  P    0# x8  x5V !l) "<$ #( $|:L, %w. &Q 2 'Wc4 (`7 )m9 *$Y= +D? ,_B -s`E .$H /DJ 0 L 1YWO 2Q 34jT 4~eX 5PY 6PZ 7d#\ 8\ 9p/.] :d_ ;A` <a =a >Xsc ?d @8Df Ah Bj C rn D@Bq E0Gt Fcy G{ H` ^~ I J,K KP= LT  ! M 9 N O˶ P Q Sh' TA U$ Vt Wx X` YM* Z=~ [ \] ]{ ^`z _ `p aZ b@@] c dP^ et4tfgaahp.ij_kf l0~ mr nopDq rtmLu@!v\'w=*x,y|,.z /{X  :|DD}Z~8p\ l^n[ DBL  `$`I`nDc^~L p PBDL  "@#$$`%`%`%%v&\H,L -.p/I/X  M3$j<T?DAd#4Id$^I` Id#Id#Ih%Jd$0J` [Jd"J` Jd#Jd"Jh%%Kd!QKd$yKh'Kh(Kd#Lh%+Ld#WLh%Lh'Ld#Ld#M` /Md"VMd#Md$Md$MTMXNX7NTN8PDQT  \( % ` s nk{puyj@\h&͢|;xt4GD11CLLU6v6zK Ix822;XPxW`^^p.z z  ~ bb ˘ =~M¨yA24z s*(@%%W ,,Kpp~ tqRQD 9 y! ? (" * 1#8 0;$D% F&l,I'L(P>=iO)d$g*X+$,l,ٜ-t2 .<E/L F0W2x53JK4S56\7(89tl:|;d<=>k?H@H AL /Bl)@C4pDjEF$aGJH IJ KL M ]N#OS}$Pg$Q|9E%RG%SX+T+U^^-Vt3NW|:XPɒY|;Z [H\-S-^s^_D` a0b c]xd0f0eDI6f/7g8h=ip-BjCk ^Llk"YmJan|;aoH'bp|<vbqd!br}cs|:edtRdudv=exoeyo_fzx8f{hg|i}C.j~xjkkd#lbl|<mCYm<mh'oXox8o.pq$qPtvz W{aApb]١H=|;Y|5˩a|9CWSMQO|:p00ɯ|9HY|9?(@nAK|;O|;|:ӶOjId$ 8þqX,p/I|:|9\|;|;:A|x8|:|9D|p-tPh(d#$IE)|<u O I|:8y4@A8(^MX|: x(KXz|<X X e`X$z (r]T!"q#Fw) +p0.y0S_2k3p-+9_:t<P@BX++3DAo""-C h-%- T#"2 p-+ _!D&&")d$+ODVQ^bD&eheHnghIj?$kjlt3Em(nmt<6vu7zXzXz Xz!X {"\3\3'{#))$T%&'|,|,) X 2F*<*O+X$O, P-Z.\/85;`0wb1LIe2`h3Ii4Xl5PP8m6 p7{8<~9:;4<Ȇ=**><INH&]^7"#()3*+,v-_.:/50.*/102=4)5*6+7.8797:-;5<8=.?@.A1CD>EWFDGHI.J2K.L;MNO6PQOR5*S_TUV/W5X5Y5Z/[5\5]^<_`_abcPdefQghijl_mnopq_rs_t_uvnwx_y_z{|}_~_}st_mz^___O_________`__`_)H#.#JmD))5).L)).)){...))) ) D . #. #J)1#54bM././...5..... .!.".#.$.%.&.'.(.).*.+.,.-.../.0.1.2.3.4.5.6.7.8.9.:.;J<J=.>.?.@./A.B.C.D.E.FGHIJLMKLM#LFMM2N.ONPNQJRQSQT.UTVTW.XWYTZ.[.\[][^5M_.`Ja.b5Mc@6dJeJfJgJhJi.jJkJl)m)nlJolJplJrl.s5Mt5u)v.:wuJxuJyl.zuJ{uJ|*.}.~/.E... 5M 5M.)..<..JJJJJJ5M.EE..<M<MM<M<M<<.J;.JJJJJ.4M).*.*..*.*.......M. 5M. 5M. 5M. 5M. 5M. 5M.5M.<M6M. <M.:L:M"5ML:M"5ML:M"5ML:M"5ML:M"5ML:M"5MJJJJ\JJ/.E... 5M 5M./________________________JJE...E.... .# .# . . ..JJJJJ........... <LM <LM !<LM "<LM#2 $<M %<LM&<M '<LM )<LM *<LM +<LM#,. -5.. /<M 0LM 1LM 2LM 3LM 4LM 5LM 6LM 7LM 8LM9.\:J;J<J=J>./?E.@JAJBJC. D5ME.F5MG. H5MI.J.K.\ELKLMMK5MN5MO.\P.\Q.\R.S.T.U.V.W.XJ;YJZ.[.\.].^._.`. a<6MbAcAdA e<6M f<6M g<6M h<6M i<6MjmJkmJlmJmmJnmJomJpmJqm./rmE.smJtmJumJvmJwm.:xm:My:Mz:M{:M|m. }<M~mJ#mJmJ./mHM))mJJmmJmmmJmmJmmJmmmJmmmJ#mmmJmmmJmmJmmmmmmmJ.E.M*.DLD..5M..mmmmmmm...<M...M.5M5M55M5M5M5M5M5M.5M.5M.......5MM.5M5........5M..<M<M<M<M<M<M<M<WM<M<M.5M.5M.5M..5MM5M;5MM ./ E.8:.A..\<. . . D E. ./E.bcLL J J J J J J J J . J J J  .! M" J# . $<M% . &<M' . (<M) . *<M+ . ,<M- . .<M/.0.1J2J3J4J\5J6J7J8J95M:".;".<J=<M>J?J@JA.B.C.D.E.\<FWM#G.H.ZI[MbJH5K.LHMMHMNHMOHPHMQH;M#S.T.U.VLMWLXLM#YMZ.[LM\.]\.^.#_Mb`MaMb2cK.dK.ed.fK.gK.hK.iX.jX.MkX.l.mMn.:o"Mp.qM#rMt0Mu.:vLMwLMx.yJz\.:#{z*.|A}."#~J{.\J#JJJJJJM./v*....*..LM. 6<M.......A.5M.:. 5M.:.".."<M#.../.bbbb.b.b.dc.cJcJcJcJcJcJcJcJcJcccc.c.c.c.c..dM4M|.|.)..<Mb<M5MD#2#5LM5M####LMLMLM.MLMLM.#M<MDM._4bL5JbMF V b<M L L LL222bMD#D LbMEDL2L!L"L#L$%L&L'&L(D)L*L+L,LW-L.5/5052FL3FL4FLW5FL6L7F5879F5:<M;<M<M=M>M?M@MADMBDWMCDWMDWEHLFHLGHLWHHLIGLJGLKGLL D#MDN_O_P_Q_R_S_T_U2V_W_X_Y_Z_[_\_^___`_a_b_c_d_e_f_g_h_i_j_k_l_m_n_o_p_q_r_s_t_u_vNx_y_z_{_|_}_~__```__`xy_`_____________________________________`___________________________________2#############b#b#b#b#b##b##b##5#b#b#b.bMbM5bMbbMM bM bM bM 5bWMWbM#bb5Mbbb5Mb5Mb5MbMb55 5!5"#"$#%$&%'&)E*2+5,2-7.5/Y021)2.3,4556.N7W849<:0;5<='>.4FMTSTR1'Qpyouqyourryou'resyoumtyou'veusveswhavexdoyarezmePREINIT?'REQy'M~CMPD37ontoontointointoin between inbetweendownindownindownondownonuponuponoutofoutofoffofoffofiwidei_wideinventwidei_wide inventorywidei_wideitalli_tallinventtalli_tall inventorytalli_tall breathefire breathfiretalktotalktosay godspeed saygodspeedsayxyzzy sayxyzzysay bonvoyagesaybonvoyagesay aurevoir sayaurevoirsayadieu sayadieusay goodbye saygoodbyesay farewell sayfarewellsaynosaynosayyessayyessayasaysayprayer sayprayeryourname yournamemynamemynamedrop clothes dropclotheslullto lulltosleepputtosleep puttosleepputtoputtounwearall unwearallstripall stripalltakeoff takeoffcastoff castoffpeeloff peeloff takeoffall takeoffall castoffall castoffall peeloffall peeloffalldoffall doffallshedall shedall unbuttonall unbuttonallremoveall removeallflapyour flapyour flapyourwingsflapyourwingsflapwings flapwingstakeoff takeoff takeoff clothestakeoffclothesgetnaked getnakedexposeself exposeselfbreathfire breathfirebelchfire belchfireexcuseme excusemesendoff sendoffbonvoyage bonvoyageaurevoir aurevoirleavetaking leavetakingleave takingsleavetakingstakemytakemytakemyleave takemyleavetakeyour takeyour takeyourleavetakeyourleavecastacastleadastray leadstraycastspell castspellcast glamour castglamourtanhide tanhidedoleout doleouthandover handoverdealout dealoutletgoletgoloopdeloopdeloopdeloop loopdeloopbideyour bideyour bideyourtimebideyourtimepeckout peckout peckouteyes peckouteyesceaseto ceaseto ceasetobe ceasetobenottonottonottobe nottobedroptoknees droptokneesdroptodroptodroptohands droptohands droptohandsanddroptohandsanddroptohandsandkneesdroptohandsandkneesfallinfallinfallinlove fallinlovehavesexual havesexual havesexual relationshavesexualrelationsbegyour begyour begyourpardonbegyourpardonlighton lighton lightonfire lightonfireinbackinbackinbackof inbackofontopontopontopof ontopofsetdown setdownmakelove makelovehavesex havesexkillself killselfhave intercoursehaveintercoursefrenchkiss frenchkissmakeout makeoutrunamok runamokrunamuck runamucktakeataketakenap takenapinoninoninsideof insideofoutofoutofopensesame opensesameabracaabracaabracadabra abracadabrapumpwings pumpwingsinsideof insideof outsideof outsideofallthealltheinvwide invwideinvtall invtallpeelopen peelopendownonto downontodowninto downintotakeataketakewhiff takewhiffbegpardon begpardonexcuse yourselfexcuseyourselfoveratoveratcrawlaway crawlawayintointochangedragonchangedragonchangeto changeto shapeshifttoshapeshiftto shapeshiftintoshapeshiftinto transformto transformto transformintotransformintochangeinto changeinto changeintodragonchangeintodragon changetodragonchangetodragoncdragon cdragon transformdragontransformdragontransformintodragontransformintodragon shapeshiftdragonshapeshiftdragonshapeshiftintodragonshapeshiftintodragonchangeraven changeraven changeintoravenchangeintoraven changetoravenchangetoravencravencraven transformraventransformraventransformintoraventransformintoraven shapeshiftravenshapeshiftravenshapeshiftintoravenshapeshiftintoravenchangehuman changehuman changeintohumanchangeintohuman changetohumanchangetohumanchumanchuman transformhumantransformhumantransformintohumantransformintohuman shapeshifthumanshapeshifthumanshapeshiftintohumanshapeshiftintohumanSPECWORD7fOof,and.thenAallA everythingBbothXbutXexceptNonePonesIitIthereTthemMhimRherYanyYeitherVOC3benchbench~againagainmagicmagicamblepeachpeachpeachrabidbraidbraidfacescageskneadimagechainchaincleanmcleanchildagreetoagreewithagreeGchaseafterGchasecliffcliff/fieldcrackcrackcrackcrackcrackcrackcrackcrackcrack crackcrackcrackcrackUplacedowninUplacedownonUplaceinsideUplaceintoUplaceonUplaceindglideflametflameheads,headsbreakbreakbreakbreakUplaceplaceplacedeathdeathMfilchpiece-chimeoceanoceanwoceanmacauscaldclimbdownclimboutclearoutclimbtoclimbintoclimbinclimbup@cidernicheclearKclearclear%clear$clear_chairchairdebugdebugclimbsclimbflailadieutoadieuboardcream;creamscalescalescale=sedgebroad3edges/edgespedgesbirchbirchbirchbirchbirchbirchbirchbirchbirchYdriedVdriedUdriedLdrieddriedTdriedtabletablebriefbriefcranegeesedreamdreamdreamawakeflickheave;beanslhasaMfetchchokebitch2cloak)cloak*cloakcloakcloakcloakcloak=heathheathflare2flarefleasmblockupmarchonmarchblockradorecharmcharm charmankle|ankle'regalregallargelargelargelargelargelargelargelarge)largeIlargelarge largelargelargelarge/large.large shake galesspacespacemince2linedditchditchgditchditchlatchZlatchElatch flagsflagsbasinbasinsidhemagesmageseclamprangeleaveqclingtoabovechinkchinkchinkchinkchinkchinkchinkchinkchinkchinkchinkchinkchinkchinkchink9spadebspadespade0knife_knifegknifeLknifeblazechanttoMhoardUaffixoneaffixwhack|drainchuck`chanthandsJlaceybasesbasesbasesflashof green ribbonscleftcleftcleftcleftcleftcleft4flashXflashflashflashoakenoakenoakenoakenoakenoakenoakenscenekneelcaterucrankawarddelay~smack[creepto[creepforceapartforceopen8grape}traceofudabeastZbeast:beast{beastcroakatcroaksnackonsnackehitchtradefortreadontreadbdelvesliceflingopatchvtradebuildXblinkNbloodtbloodsbloodooffof slideamuckslidedowncrashwhaleuponwhaleonclaughatclaugh`carol#heelsalongcarvecarvecarvevshapeshapeafancycoralcoralcoralcoralcoralcoralcoralzeightgreenapples6greengreen greenggreen=green/green$green#greengreengreengreengreengreengreengreengreengreengreengreengreengreengreengreengreengreen|greenhgreen^greenFgreen=green<green5greengreen.greengreengreengreengreengreen{greenwgreenrgreenSdraftRdraftdraftdraftGdraftAdraftdraftdraft;draftdraftdraftdraftQdraft{perchinsideof{perchinside{perchontopof{perchontop{perchupon{perchin{perchonriflebringMbringalongfight[sneakaround[sneakto[sneakWpinchafterlandslands1landsfaintfaintfaintfaintfaintfaintDfaintfaintappleappleappleappleappleappleapple@apple8appleappleappleappleappleappleappleappleappleshardshardoshardMshardFshard^shard]perch\perch{perch[perch@shelf?shelfofferofferfliesquafffeastonfeastguardagainstguardbesetclasp_crudeLreedsgiantgiantacornacornmetalmetalMmetalmetalhmetalgmetalasheenthickthickKthick2thickthickthickthickthickthickIthick>thick=thickfloodnamesnamesarisegorgespeakuraisepeaksbirdsZbirdspalerpearlpearl earth earthearthearthheart$staffstaffBplainCplainAplainHplain3plain/plain.plainplainIplain`plainplainmplainplainplainplainplainhellohelloGtracklaynast.hyenakiseigravereefsreefsreefsreefsreefsboughboughWboughuwheelwheelberthpleathunchmcloseupmcloseofffloatinsniffdallyawaitscramwakenknockdownblastvoicedfloattodfloatBplate2linenslickslickslickstackspeckpetalpetalpetalpetalknockatknockatknockonknockonknockknockmclosecloseclosegougegouge quake quakefaeryscuffyieldtoyieldgroanatgroangripetogripegreet+watchshineVgloatoverVgloatatVgloatBchips=mixedchestHchest chest.jewel-jewel,jewel+jewel*jewel)jewel(jewel'jewel&jewel%jewel$jewel#jewelsnailhairslimbslimbslimbsWlimbscloudcloud?cloud cloudcloudtcloudAcloudcloudcloudweaveprobebroillightupdrinkinpitchcboundunbarbucksapartshellshellshellshellshellshellshellshellshellshellshellshellshellshellshellshellshellweedsweedsweedsweedspaperthree'three&threelightlightzlightwlightvlightjlight%light$lightdrinkdrinkdodosfirescrawlMsnareMstealcrawlupcrawlucrawld crawlsouthwestcrawlsw crawlsoutheastcrawlse crawlnorthwestcrawlnw crawlnortheastcrawlnecrawlwestcrawlwcrawlsouthcrawlscrawleastcrawlecrawlnorthcrawlnsleepwithcrawlinsidecrawlin crawlaway fromatango$wheatpoochbelowhumanlhumanhumanfrill:chunkchunkslate slatedrift driftdriftsheetfrondfrondfrondfrondfrondfrondsandsHsandsHsandsDsandsDsands>sandsbloom+bloom$bloombloomGstalestalesmall[smallMsmallsmallsmallsmallsmallsmallsmallsmall~smallzsmallsmallsmallcsmallsleepsleepsleepduckslunchsnarfspenddrawlXpreenVsmileoveratVsmileatVsmiledoggyclawsteethteethteethteethplaitplaitSthing-skein+skein)skein'skein%skein#skeinskeincoilscoilscoilscoils5coils5coilsclothbclothglassglassglass\glassRglassQglassPglassOglass9glassMglassKglassIglassFglassaglassstandupstandupstandstandstandonfairywhinetowhinemunchonmunchgletgoofspearslashthirdsolidurobesMbrassholesholesholesgills'tigertigerTaboutaaboutaboutherongrantwrecksmashfoamylocksof hairlocksnotchnotchnotchspikeinnersailstrailtrailtrailGtrailtrail6trailvhills3hillshillszhillsravenravenkraven)raven,raven*raven(raven_stiffstiffscoregoosespankwithspankgropeendowMgraspsling`yodelVsneeratVsneerhsteelgsteelfsteeldsteelKsteelupilesSpilesHheavyheavyknobs`scentsmell`smellalampshawksticksqueenenemygshuckoffdshiftenterthruenterthroughenterpausepunchthinkaboutthinkofthinkleverapartleveropen[houndhoundtalonsharpright7glintglintestick$stickstick<under;underunderanruimcoverupmcoverscrubJsmokewholesaintfluesspinevsatin[stalk.stalkMpluckpluck&plucksizedplantplantplantplantplantplantplantsandysandysandysandyfieryfieryvfierymotifcolorcolorskiesskies>skiesskiessskies@skiesskiesskiesskiespskiesapairsmazessnarlatsnarlfocusthumbthroughthumbthroughMseizemdousestallotreateplughdorbitIapronEapronwhelp!tighttightfluteflutevknoll grass=grass/grass.grass.grass-grass,grass,grass+grass*grass*grass)grass(grass(grass'grass&grass&grass%grass$grass$grass#grassgrassgrassgrass}grass}grass|grass>grass/grass/grass.grassygrassrgrasstilesdovescroontoflirttasteMcarrysparkstateorenewrinse`croon[slinkaround[slinkthrough[slinkto[slinkJdressFdressJdressKarmorUarmor steepsteep3steepcrestshoreqshore=shoreclump/clumphorsehorsehorseawickswhitewhiteIwhiteGwhiteEwhite?white3whitewhiteJwhitewhitewhite whitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhiteDwhiteCwhitewhite7whitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhitewhite-white+white)white'white,white*white(white&whitemiteswomanintermsnuffoutjauntoncurseatcursesnuffsmitejemmyopenFotherloosescalesdripsdintsstagsstagsstagsZstagsKshoesHshoesshoesshoes<>rocksrocksloose"looselooselooselooselooselooselunarfloorfloorCfloorfloorfloorfloorfloorfloormoosearsonkinorpriseapartpriseopenAstein3tunic3tunic+tunic!tunic tunictuniceplumeBplume*plumeRgrovestash stashstavewaterwaterwaterwaterwaterwaterwaterwater~waterNwaterDwaterCwaterBwater7waterwaterwaterwaterwaterwaterZtreesxtreeswtreesltreesjtreesRtreestreestreestreestreesntreeswallswallswallswallsTwalls!walls wallstersetersetouchtouch(#piquebrushagainsttrampontrampscrewbrushdhovertodhoverfequipdrunksingsjointsweep-sweepsweepPhouseOhousehouseNhouseuntiedshoveroughupcrushblitzpannoylionswaftsbluntveins starkwhite ribbonsstarkstarkstarkwindswindsSwindsRwinds windswindswindswindsGwindsAwindswindswinds;windswindswindswindsQwindsFrough,rough+roughroughroughroughsoughtosoughatsoughuwhirlpounduponpoundonpoundpharryVsmirkoveratVsmirkatVsmirkjimmyopen4pants,pants pantspantsrisesrisesmilkymilkygullswringcloutuhoistuboost`trill-bulky5boots-boots#bootsbootsbootstoughLtwine3sculpbumpsazureazureazureZroyal,royaliroyal\royalfbowlsswampswampriverriveruswingMswipewingsfirststillstillstillstillGstillstillstillsweetsweetsweetsweetNdropstdropssdrops[roundFroundroundround/roundround.roundroundbrownFbrown;brown@brown5brown4brown.brown+brown*brown&brownbrownbrown brownbrownbrownIbrownQbrownbrownbrownbrownbrownbrownbrownbrownbrownbrownbrown8brownbrownbrownrbrownbrownbrownissueroast;gravymousemouseporessoundsplaysplaysoggysoggy0curls0curlscrowncrowncrowncrownstonestonestonestonestonestonestonestone stonestonestonestonestonestonestonestonestonestonestonestonestonestonestonestonestonestoneistone5stone4stoneswarm hedge-wizardtemptunpinestraperivetcrossthroughcrossontocrossincrossintoskulkoffprune[skulkaround[skulkto[skulkproudproud3shirt+shirt!shirt shirtshirtUpartspointdrowndrownfruit8fruitfruit!puffytpuffyApuffychild'smultigrowlatgrowltoastswillbeddownbed)pansypansymothsmothsshinyqshinyshinyshinynorthnorthnorthznorth6north2northnorthmnorthYnorthnorthnorthnorthnorthnorthnorthswansbeefaereplyscourcvaultovercvaultNplushJplushuppersplit"splitsplitsplitsplitsplitwhorlwhorlwhorlwhorl%roses%roses rosesmoonswoodswoodsmoistmoistaunlitYdirtyVdirtyUdirtycdirtyTdirtyexistwoundrcourtonursewhoopatwhoopJskirtFskirt"skirtmouthmouthesillystarsZstarsbumpybumpy4loops4loopsoutofpoutofjabjabdpresspresswaspscrowscrowscrows{squatinsideof{squatinside{squatontopof{squatontop{squatupon{squaton{squatscoutlaarouse~thumptoothtoothtoothsmily*tuliptuliptopaztwigstwigsWtwigstwigshuskshuskshusks|emptyonto|emptyinto|emptyoutslitsasword`sword_sword^sword face-sizedknotsnewlynewlysprayemptyempty|emptyempty1emptyxemptygspoon]woven\wovenWwoven[wovenisteps7steps6stepsburstintoburstinfeeontopvents_short=shortsixth towertowermournuswirlMnabpupsettstoolstrawdiedieupivotmdamtarryawaltz?ale\strip/stripyoungyoung youngyoungFbigHbigutwirltwirlstorkbobstraymountdustsistudsfvisorsouthsouthsouthysouth3southsouthjsouth<southsouthsouthsouthsouthshoutat^shoutatshout^shoutgthrowoutgthrowawayprowlbdigaroundbdigthroughbdigintoutterthrowonGcapGcaphcapmage'smage'spolypHtrunktrunktrunktrunktrunktrunktrunktrunkthrowtthrowbdigindiginbdigdig stormstormbarpadHmaid'sGmaid'sFmaid'sEmaid'skittyuvestsfanfan gold-brownslurppea]peaDwispseel}tufts:beast'szarc4arcarcmushygustsgustsSgustsRgusts gustsgustsgustsgustsGgustsAgustsgustsgusts;gustsgustsgustsgustsQgusts{roostinsideof{roostinside{roostontopof{roostontop{roostupon{rooston{roostin{roost~batHoddtorsolumpyrootsroots3keg2kegbogspurnmjamlegitdoedoecatlegsadsadsadgapgapgapgapgapfurryfurrymurkystudysnoutspotsspotsJivoryaivoryivoryseaseaseaseaseaseaseaseaNsea/sea#sea"seaseaseaseaseaseaseaseaseafar~farjfar;farajig4hemspitzpdogdogdoggiant'sdim#dim"dim god godeateat|liedowninliedownin|liedownonliedownon|liedownliedown|lieinliein|lieonlieon|lieliehencawatcawfatbudbudbudbudbudbudoakoakLoakoakoakoakoakoakoakoakredBred;red=red2redredredredvredred redzredvred4red3red*red)red!redredredredredredredredredredredered]redOredFred1redredredredredredredzred`redooffutwisttwist7twisttwisttummymanmanFmanFman'layna's&layna's%layna's$layna'slayna's#layna's"layna's!layna'slayna'selkelkwispywispy rknee-lengthman-manSairRairairairGairDairAairairair;airairairairQairlapuplapseethroughzseelobmuttsGhatwhatstonydip;piepuppybugbugLbug'daydaywebwebayesorrynapoldold6old2oldFoldFold)old*oldoldoldKherJherIherHherGherFherEher$herher#her"her!herherbitpanpanmpanwortswortswortsold9stout$stoutestout,askvaskNaskfayjoggetontogetongetintogetingetoffofgetoffgetoutofgetoutmarramarmpiggetupgetupMgetgetcooatcoonodoff~bopLthethethethethefdonQdonstrutetieEtie*tiemustyGmustyonexoneraponrappworryval val valval ccoat-of-armsvaleyeIeyeeyeeyeeyesobatsobqhug'lady'sfoofoo6his5his4his3his2his)his-his,his+his*hishis hishis his hishishis .jewel-toned -jewel-toned ,jewel-toned +jewel-toned *jewel-toned )jewel-toned (jewel-toned 'jewel-toned &jewel-toned %jewel-toned $jewel-toned #jewel-tonedfeyfeyLfeyfeyfeyfeyfeyfey0oilcoilaoil9nubnubhextappattapontapatmawmaw -wild-hair +wild-hair )wild-hair 'wild-hair %wild-hair #wild-hairlipPinnOinnGinninnNinnhit}hitUlaydowninUlaydownonUlayonUlaydownUlaysodpirk grey-brownmud maze-likeemuMnipepinofixchopoverchopratratforUrusty gray-greennayMlugaroundfuzzyfuzzytoehtoepawpawpetrubagainstrubboxAmugmug<mug=mugcowIkey _stiff-backed stiff-backednewnewpaytopaypayforwarwithwar`humcurflyuflyupflydflydownflysw flysouthwestflyse flysoutheastflynw flynorthwestflyne flynortheastflywflywestflysflysouthflyeflyeastflynflynorthflytoflythroughflythruflyinflyoutdflyatflydflyctinruesipgsetasideUsetdowninUsetdownonUsetintoUsetonUsetinUsetdowncutdowncutsetfreemoplion'slion'slion'sUsetPsetsetinvpitpitpitpit pittipsayzsaycryatcrytocrycryout tri-coloredXpooWpoonorpopin6coot's0coot's/coot's.coot's)coot's-coot's,coot's+coot's*coot's loose-soileddryki-nortugontug{sitinsideof{sitinside{sitontopof{sitontopbuysexwetbwet1rye0rye{sitdownonsitdownon{sitdowninsitdownin{sitdownsitdown{sitsit{sitinsitin{sitonsitonyesPwayOwayywaywaywayNwayyip=lowlowpvextoppotpot/pot.pot>rumowncicadacicadasaccedetoaccederunaboutrunaroundrunrunoffrunawayrwoopup round-mouthed'lily-of-the-valleylily-of-the-valleysunsunrsun@sun/sun sunsunvsunusunBsunsunsunsunskysky>sky/skyskyssky@skyskyskyskypsky multi-coloredsuponsupdefacebabbleaboutbabble =low-growingoutpoutUputdowninUputdownonUputontoUputinsideUputintoUputinmputoutUputputgputdownputdownfputonQputontow gabracadabratwopryopenpryyrut bladderworttoyMtoytoygabbleaboutgabbleyouHyouxyzzyxyzzyxyzzy blackbird blackbirds blackbirdsdamage thandcarvedBcascadesBcascadebackfirechamberaadelegatejaggedjaggedjaggedjaggedMjaggedleachedbacklessbacklessIdelicatetdelicatedelicatedelicatedelicatedecimateccackleatccacklec nchandelier&dahlias&dahliasdahlias&dahliadahlia belchfireat belchfireclamberdownclamberuplakebed declicatedddbreachbreachbirdcallgabandonafflictbadgerpbadger deliberatebenchesbencheseeye1eene=eeeeepalacedefendagainstdefendjabberaboutjabberlchangeintohuman lchangetohuman lchangehumankchangeintoraven kchangetoraven kchangeravenjchangeintodragonjchangetodragon jchangedragonichangelabradorbackofubodices/lidded.liddedchickensclobberbraidedchickencchicken barnaclesbackdrop~ggimbibeinbackof wacrobaticslacerateqdandle'haircapgracefulgracefulcaraboucarabouypacked fireballsfireballconceal linbackof%bracelet4breeches,breeches breechesbreechesqcrackedwebbedgildedHgilded gildedbarkedbarkedbarkedbarkedtableaudetachdetachii  sandcastles  sandcastle  sandcastle sandcastle leadastrayglancethruglancethroughzglanceaboutzglancearoundglanceovermeanderpaddleinqembrace~changingraggedraggedraggedfleckedfleckedpebblepebblepebblepebblepebblepebblepebblepebblepebblepebblepebblespebblespebblespebblespebblespebblespebblespebblespebblespebblespebblespebbles~pebbles backgroundbehindydeactivpeacockspeacockmalice flagellate breakfastgobbleupgobbledowngobblebdredgedeclareqcoddleqcradle headpiecepbaublespbauble$bladesbladesbladesscarabsfaerieblubberatblubbertoblubbernibbleonnibblelbackoflbelow\doffallhandle9handlescaledeleganthiddenhiddenBbubbleBbubblesbubblesscarabzscarabLscarablbehindlbehindlbeneathlbeneathlunderlunderlthrulthrulthroughlthroughzlaroundlaroundzllrlonlonrlinlin+latlat congealedenchantparadepaggitateenhance7etched hairedhairedfeatherfeatherfeathersfeathersfeathersbridgezbridgeneedles feathered feathered feathered needle-likeneedlecreamedblanketfeatheryfeatherybirchesbirchesflickerszbeholdascend`descant'maiden's&maiden's%maiden's$maiden'smaiden's#maiden's"maiden's!maiden'smaiden'smaidennecklace necklacecaninescanineflarededdiesufolded`foldedfilament zflickering XflickeringflickerEflickerXflickerbranchesbranchesWbranchesbranchesbranchesbranchesbranchesbranchesbranchesbranchesbranchesbranchesbranchesbranchbranchWbranchbranchbranchbranchbranchbranchbranchbranchbranchbranchnn2nnmnnnnnnforbeardeclinedisableliberatepbedevilcgiggleatcgiggle3beaten"beatencloaked cloakedcloakeddoggiesdoggiemiddleridgedfhingedhingedgleamingyellow ribbons +bluebells +bluebells bluebellhyacinths+bluebellbluebellkdanglingdanglinggleamingIgleaminggleaminggleamingbeneathbeneathacceptbrandishhearkenlambastelambastjcdragon`katanacoiledcharcoalcharcoalcrackled yhardpackedlocaleeagles cardinalscardinal rainfallcricketscricketbeetles begpardonof begpardoninhaledawdleescapeqcuddle\shedallafleetafleetZchecks flamboyantgarden vreflected VreflectedreflectvreflectVreflectUreflectTreflectbeetlezbeetleLbeetle reflection reflection vreflection Vreflection Ureflection Treflection Jreflection 4reflective reflectiveqqi_widei_widexi_wide pheasantspheasantbeckontobeckonbemoan administergamboldescendupondescendon Mcapricorn/handhold chihuahuacirclet abejeweled ^collectionanimalsJanimals circlesof ribbonscirclecirclecirclefragmentfragmentMfragment^fragment ^fragmentsbluejaysbluejayfalconsfalcon bluebirdsbluebird conflagrationforebearfromcompactrereadrereadbludgeonbombardrambleaboutrambleuncagehoodedcloakgriffenagainstbeforelichen-covered  avalanche vavalanchejleatherleggings5leather-leatherleather leatherkleatherjleatherileatherXleathercleatherQleatherlichenlichenlichen=lichenseagrassseagrass4flashesflashes!middlingmiddlingfragrantfragrantfragrantfragranticellarssys3ssjs<sssssrabbitmagics keilantraabstainfromabstainnegate fascinatetakenapvacatecudgelmangleqcanoodlemeditateovermeditatetcreatectackle[denteddrenchedmembranefinned Nblooddrops tblooddrops sblooddrops Nblooddrop tblooddrop sblooddropceilingceilingceilingceilingTceilingBceilingAceilingbeaverpanarchedelerian ceasetobe xinbackofimagineevacuatescreechatscreech8bunches9carved8carved7carved/carved"dividedval2gerbilsgerbilshaped elaborate>darken>darkensLfragilefragilesandfish hangingbrown ribbons patches landscapecrescenthanginghangingperfectperfectperfect perfectperfectperfectperfectperfectzperfectvperfect)perfectperfect perfectlyred apples perfectly perfectly perfectly ]perfectly perfectly )perfectly perfectlydarkness%darkness#darkness$darkness"darknessuuui_talli_tallyi_talleattachattach deluge children'schildrenwakandahuddle breathefireat breathefire breathfireat breathfireMabscondwithMabscond incineratebreathon frenchkissbreathinbreathbreatheinbreathe disfigureravage rfallinlove rfallinlovewithcleanse+necklineval3 incoherentzarchway udiscardedgdiscardudiscarduleggings[bucklergapinggaping gaping gelatinous halfshell halfshell halfshelldeepestdeepestdeepestdeepestdapplesSdapplesVdappleUdappleTdappleSdapplehandfulshandfulsDhandfulsDhandfuls%handfuls%handfulshandfulhandfulhandfulhandfulDhandful%handful.greenerygreeneryemeraldfalling elongated elongated aelongated1alcohol0alcoholsearchsearch*buckleeconnectconnect flamingoesflamingoraccooncondenseexchangeforshamble perambulateinflamekindleexhaleonexhalecatnapawaken annihilatevreplacevexchangecogitateovercogitateKwickedglazedreindeerreindeercockerlapdoghairdoplateauwdashingvdashingflamingfaintestfaintestfaintestfaintestflashingcrackscrackscrackscracksheavenheaven>heavenheavensheaven@heavenheavenheavenheavenpheavenheavensheavens>heavensheavenssheavens@heavensheavensheavensheavenspheavenswww7wwlw:wwwwwflameshatred acquiesceto acquiescetanhideenticebeguilefondleransackxbelowxbeneath xunderneathxbackofxbehindunlacerampage eavesdropon eavesdrop hibernatebexcavatescrambledownmassacrescrambleupqenfoldrememberunchain!peasantsatchelval5colliesatchet stalactite stalactite stalactites stalactitesbreaks excavation excavation excavationshadesthreadsthreadsdiamondsZdiamondsdiamondswthicketecreeping ifireflies \fireflies hfireflies ^fireflies gfireflies [fireflies ffireflies _fireflies efireflies efireflies ]fireflies afireflies afireflies `fireflies Zfireflies Xfireflies{fireflyifirefly\fireflyhfirefly^fireflygfirefly[fireflyffirefly_fireflyefirefly]fireflyafirefly`fireflyZfireflyXfirefly =lakeshores qlakeshore =lakeshorediamonddiamonddiamondbarrelflecksDkitchenCkitchenattack}attack+xx parapetparapetmallardsmallardforehead  cloudburst  galewindsabjurerefrainfromrefrainy bellyacheto bellyacheseduceexhibitdeliverprancemakelovewithmakelovetomakelovescamperdaydreamharkenshieldagainstchatteraboutchatterlaunder Bearthenware Aearthenware-indeterminable,indeterminablesheepdogguinea neckfrillpinnacleJchemiseshield[shieldZshieldsupiecespieces pearlescent sanddollardarker seashellsberriesseashellseashellseashellseashellseashellseashellseashellseashellseashellseashelltseashellfblinkingblue firefliesfblinkingXblinking-chimes boundaries 6boundaries 1boundaries :boundaries boundariesboundary6boundary1boundarypboundaryoboundary:boundaryboundarybuildingbuildingdebrisoceansoceanswoceans@golden?goldengolden&golden&golden%golden!goldengoldengoldengoldenagolden`goldenDgolden%goldenCgolden$golden concavity concavitynamingbondingbonding antagonist antagonismdisagreewithfarewelltofarewellhammerondealoutitakeoff blasphemehammerdemolishomaintaincchuckleatcchuckle \takeoffall\getnakedbernardgermanobsidiankeeningkeeningkeeningkeeningalltheallthealcovesalcove beautifulggreavesggreave ingrainedteenierseaweedsseaweedsseaweedsseaweedsseaweedsseaweedseaweedseaweedseaweedseaweedseaweedseaweedseaweedseaweedseaweedseaweedseaweedseaweedseaweed barrenbarrenbarren~barrendesigndesignsdarkest_chairschairszzdimpledimple dragonflies dragonfly dragonlingoldmandragonsbespellsayadieutodonaterelighthaveintercoursewithreawakereawakenbutcherlaunch oreconditionscreamatscream \peeloffallBreddishwatchdogfingerfingerflawlessgashes pknickknacks ~glimmering /glimmering %gatheringglimmertangledtangledtangledtangledburiedfingersfingersfingers darkgroundqfringesfringesfringesfringeslaceworklaceworklaceworklaceworklaceworkscalesscalesscalesscalesscalesscalesscalesscales~islandrainbowrainbow~rainbowrainbowrainbowErainbownrainbowrainbowsrainbowsErainbowsnrainbowspockmarkpetaledpetaledpetaledpetaledpetaledpetaledtangletangle parchment Lparchment parchmentslenderslenderslender slenderslenderBslenderslenderslenderslenderslenderslenderstable|stabledragondragonjdragondragondragon+dragon/cauldron.cauldronetablestablestablesremain castle castlecastlecastlecranesdreamsdreamsmarriagecomplaintocomplainbanquetmassagecanvashavesexualrelationshavesexualrelationswithhavesexwithhavesex bideyourtimebuffetbattlerecitereleaselchumanYticklecbounceremainsLremainsKkeeper'sJkeeper'sIkeeper'sGkeeperresidentinsideofinside stalagmite stalagmite stalagmites stalagmitessecondhtoecapcrevicecrevicecrevicecaughtglobesglobesglobesglobesxbonsaiwbonsai +hyacinths +hyacinths hyacinths+hyacinth,hyacinthhyacinthorangeorangeorange8orange(orange'orangeorange4orangeorange'orangeorange8ribbon8ribbonribbon7ribbon7ribbonribbon6ribbon6ribbonribbon5ribbon5ribbonribbon4ribbon4ribbonribbon3ribbonribbon2ribbon2ribbonribbon1ribbon1ribbonribbon0ribbonribbonribbonLribbons8ribbonsribbons7ribbonsribbons6ribbonsribbons5ribbonsribbons4ribbonsribbons3ribbons3ribbonsribbons2ribbonsribbons1ribbonsribbons0ribbons0ribbonsribbonsribbonsthatchthatchmineralchalkychalkywkingdomswkingdom vegetation vegetation vegetation vegetation =vegetation vegetation vegetation |vegetation rvegetation vegetable vegetable :vegetable dvegetable :vegetables ;vegetables dvegetablesDhearth5hearthChearth4hearthlocationbetweenbelovedrejectwarbletodisplay|reclineon|reclinein|reclineconferMobtainrekindlecanter fantasizeassailfreshenfblorblecsnickeratcsniggercsnicker`warble )shapeless -shapeless"riding4ordinary ordinarygriffonshepherdcollaredbreezesbreezes breezesbreezesetherealcentralpregnantsodden fantasticalkmeadows<meadowsflares2flares2flareskmeadow<meadowmeadowocraggySairflowRairflowairflowairflowGairflowAairflowairflowairflow;airflowairflowairflowairflowQairflowbreezebreezeSbreezeRbreeze breezebreezebreezebreezebreezebreezeGbreezeAbreezebreezebreeze;breezebreezebreezebreezeQbreezepuddle abhorrencegrudgejugglescrapeatscrapeserenade castglamourbewitchswaggerhesitatercherishpplagueocorrect`vocalizepooches  landslide vlandslideZhideousborders1bordersborders embroidered scallopedscallopridgesridgespebblyrimmedanemoneanemoneanemoneanemoneanemoneanemoneborder1borderborderpborderoborderdraperydraperysmallestbucket'frames&frames nightengales nightengale wildfireswildfireattractsendoffrevealfrolic gallivantgallop pdiscompose pdiscomfitkcraven FgentlemanFanothergazellesgazellesgazellegazellecatnipgentlegentleplaiteduclothesdhelmetVhelmetcaverncaverncaverncaverncaverncaverncaverncaverncaverncaverncaverncaverncavern3cavern 0spreading'spreadcurledthicklymetallicmetallicmetallic9metallicmetallicmetallicmetallicfloatingorange ribbonsfloating 'daylilies daylilies'daylilydaylily jumblewvillageswvillagebonfiresbonfireoldcootmarriedscreenscratchatscratchdisarmgreetingrenderhandoverunclampunbindbarterforignitedepart imprecateambushrromancevbarterbrightencguffaw \castoffallconsider<brandy slashedspanielchinkschinkschinkschinks gscratchesVspikedsoiledbrimmingbrightly flattened underbelly iridescent iridescent iridescent iridescent iridescent/verdantqverdantXmessagesXmessage)pansies)pansiespansiesYleavesVleavesUleavesleavesleavesleavesleavesleavesleavesleavesleavesleavesleavesleavesleavesTleavesdinner0dinnerLdinner <brandywine 1brandywine 0brandywinebrightbrightbrightbrightbrightbright%bright$brightscenery disconnect disconnect greetings greetings sassafras sassafrasseagullsseagull lovebirdslovebirdcratercraterladybugsladybugblazesprincessprinceprincevillainloathingunbraidsuicidelamentoverlament leavetakingsfrom leavetakingfrom leavetakings leavetakingcaressefastenereattacheharnesswander fornicatewith fornicatelinger~repeatproclaimseeming seemingseemingmantlenotches}tracings(snatchesbeyond2liningliningcreamycreamycreamycreamy WlatticeworkEremnantsclefts|nearbywcities `lingeringbrokenbrokenbrokenbrokenbrokenbrokenbroken^brokenMsnatch(snatchjsnatch;snatchcentercentercenter~centercenter  drawbridge drawbridgerubberinfernohimselfsniffleatgrieveoversnifflegrieveexcite spellbindenthrallgodspeedto{straddletenderprofferMpilferdisjoinmakeoutwithmakeout apologizetoapologiaapology apologize dillydally~thwackimpairbatter{mumble enunciatepharassuncloak8grapesgeezermumbleshamstershamstermaterialmaterialmaterialmaterialmaterialmaterialmaterial scrapingsscraping colorchangingtriggerpetalledpetalledfishesfishesfishesfishesfishesfishesfishesLfigurezfigure xminiature wminiature1lengths1lengths|length1length'lilies-of-the-valleylilies-of-the-valley'lilies'liliesliliescircularcircularcircularcircularcircularcircularcircular"circular anthers anther speckles speckles treeflower treeflower treeflower treeflower treeflower treeflower treeflowerssinglesinglesingle$singlesinglesingle singlesinglericketybatteredbattered }scorchmarkscorch}scorch 5fireplace 4fireplaceXspeckledIspeckledWspeckledspeckledspeckledIspeckle speckle specklespecklespeckleIsongbirdsongbirdsongbird+examineexamine+inspectinspect rampartrampart rampartsramparts  precipitation centipedes centipedeapplaudatapplaudforapplaud wloopdeloopconsigndispenseMretainpurchaseretreatqclutchorebuildorepairfblurble dflapwings\disrobe:unidentifiable:steamingsteaming antelopes antelopesantelopeantelope engravings engravings engravingsengraveengraveengraveengraveengraveengraveengraveengraveengraveengravedengravedengravedengravedengravedengravedshimmerycarvingscarvingscarvings}carvings zshimmeringcailettecailettes depression depression depressionshallow/shallow carnivorous}carving{carvingzcarvingycarvingshimmershimmershimmershimmershimmernshimmer9deeply~distant5distant4distant3distantdistantdistantPmundaneOmundaneNmundane woodchuckskilletscrouchgoodbyetogoodbyeUdepositdowninUdepositdownonUdepositinUdepositonUdepositintocopulatecopulatewith takewhiffof slaughterpbotherlshapeshifttohumanlshapeshiftintohumanlshapeshifthumankshapeshifttoravenkshapeshiftintoravenkshapeshiftravenjshapeshifttodragonjshapeshiftintodragonjshapeshiftdragon ishapeshift \dropclothes*ruffle sleevesskilletskilletmskilletFwashbowltrenchtrenchtrenchantennae9shapesvshapesshapesgarnishtunicatecoloniescoloniescoloniescoloniesambrosiaambrosiapluckedplucked&plucked&pluckedpluckedsurfacesurfacesurfacesurfacesurfacesurfacesurfacegrainsgrainsgrainsgrains4stained.stainedRstainedQstainedPstainedOstained9stainedcreatureNcreatureAcreature scattering scattering scattering scattering scattering scattering scattering tscattering Zscattering scattering "cornflower  cornflower "cornflowers "cornflowers  cornflowerscoloredcoloredcoloredcolored/coloredcoloredcoloredcoloredcoloredScoloredRcoloredQcoloredPcoloredOcolored9coloredFcoloredEcoloredcolored pillarsof blossomspillarspillarsludgeUdepositdepositXdoodooWdoodooBraftersAraftersBrafterArafter regionregionshinglescondorscondorgopher  earthquakeknightreaverlinkinglinkingrancordisguiseentomballureMacquireMthieve intercoursedispatchfractureqembosomooverhaul `harmonizebellowatbellowIstarchedGstarchedEstarched 6triangles#bootletsdrunkardpedestal\pedestalrecessrecessrecessdubloonprickly misshapenaquaticcrumblydrawingsdrawing trailingblue ribbons/grasses.grasses-grasses,grasses+grasses*grasses)grasses(grasses'grasses&grasses%grasses$grasses#grassesgrassesgrasses}grasses|grasses/grasses$rainrim rainrim$rainrims$rainrims rainrimsfsapphire_sapphiresapphiretrailingtrailingapplesshingledshingleshingle crumblingZcolorfulcolorfulcolorfulcolorful|doorlessshardsshardsFshardsEshards^shards-painting+painting)painting,painting*painting(painting 'paintings &paintingsmimosamimosaconsenttoconsentdeplorecompress sayfarewelllto sayfarewell advertisegforsakeMpocketuntack consarnitoremedyholleratholler caterwaulat caterwaulshriekat contemplateover contemplateunclasp)burlap,pocketsantlersantlersmaltesemumbling pocketfulclaspsplumageshriekshriek shriekinginsectudressesrparasolWarmoredsecretsecretGsecretEmyriadCdropletsCdroplet,tendrils,tendril horrible layerings lightning lightning^severalseveral gtremblingturquoise fireflies gtremblingtipped tipped tippedacornsacorns$walkingwalking{shadowedwshadowednshadowyalanternsalantern#grayness"graynessshadowsshadowsshadowsshadowsshadows shadowsshadows#shadows"shadowsGshadowshadow shadow#shadow"shadow  earthshaking  earthshake millipedes millipedespidersspidereternity nightmares nightmare animosity peckouteyesof peckouteyesextractcontract captivate saygodspeedtorumblewelcomewrenchgdesertlavishesecureflounce lightonfire procrastinateunboardrescueorelieveunlatch !crisscrossmyname pookiebuttspideryrumbrellaicuirassOheartspalelypalelyarterialwentireplains8plains/plainsplainsmplainsglintingglintingglintingglintingglintingglintingglintingEglinting*armfuls*armful@shelves?shelveslongerlongerpenguinspenguinferret cyclone tornado thunderstormthunderwarlockswarlockentrancewheezeatwheezeMplunderecoupleshuffleslumber tellvalname tellvalmynametellvalyourname tellvalxyzzyZsubdueponderaboutponderoverponderunsealunfoldunbucklemongrelsmongrelcovering Fscullery's?liquid0liquid7tintedtinteddrippingschoolsschoolsschoolboughsboughsWboughs'funnelfunnelpasselamethystweepingweepingweepingweepingweepingweepingweepingweepingdepthsdepthsdepthsdepthsdepthsdepthssculleryFsculleryDscullerydsculleryCscullery waterfallflyingunplaitdismiss repudiategrumbleatgrumbletogrumble mesmerizerummageMsnitchcombustsmoochsiestashatterassault Bunadorned unadorned lithesome lithesomecommoncoppercoppercoppershiningpalestsnarlingsnarlingwtumblevtumbleornatevornatehauntinghauntingWjointeddaintyrdaintyLdaintytitanichermitstarfishstarfishplatespastels9curvedYcurved`curvedcurvedopeningopeningopeningopeningbulbouspastelpastelpastelpastelpastelpastelvfloats glittering glittering glittering aglittering Wintricate Eshatteredwindingpurple ribbons upheavals upheavalupheaval petalspetalspetalspetalspetalspetalspetalsliving~livinglivingspecksspeckswindingwindingywindingjwinding;winding/kettle.kettlearound inbetweentoucanstoucanoriolesoriolerefuseconcurwithconcurthrashwhimperatwhimper enraptureflaunt salutations salutationingest{loungeinsideof{loungeinside{loungeontopof{loungeontop{loungein{loungeupon{loungeon{loungecrippleoprepare oreconstruct straightenup hopensesamecpouncecpounceonmelodymelodyUweaponsjewels puckeringpollen greeny-blackcanopygossamerbruisebruisebruisebruisebruisebruisebruisebruisebruisebruisedbruisedbruisedbruisedbruisedbruisedbruisedbruisedcloudsclouds?clouds/cloudscloudstcloudsAcloudscloudscloudsZsimpleEsimple1bottle0bottle1bottles0bottles>greyness#greyness"greynesspittedpitted menulinks takemyleavedivulge relinquishunclipunlashstride begyourpardonretirediscussqnestlepdistressorevamporeformorenovateodoctor dflapyourwingssquealatsquealLhulkinghulking retrieverwhiskers WgauntletsWgauntletwhirledlimpetshellsshellsshellsshellsshellsshells indistinct colorlessnslightspiralsspiralsspiralsspiralsspiralsspiralsspiralsspiralsspiralsspirals8spirals8spiralsspiralspiralspiralspiralspiralspiralspiralspiralspiral8spiral !moonflower !moonflowers !moonflowers  moonflowers1whiskey0whiskey1drinks0drinkssinkholesinkholehumans goodspeed saybonvoyageto unharnessmutilatecchortleruminateoverruminateinvokeFhomespunpricksrodentrodentlookingliltingBstreamsstreamstreamBstream underneath <underneath ;underneath3sculpeddrifts pepperingpeppered`rippledrippled lorekosi's lorekosi's lorekosistrandstrandsspongespongespongespongespongespongespongespongeflatlyfrillspepperpepperpepperpepperpepperspongesspongesspongesspongesspongesspongesspongesspongesspongesspongesspongesfrondsfrondsfrondsfrondsfronds?fluffy?fluffyAfluffy wavingred ribbonswaving+solitarybloomsbloomsbloomsblooms+blooms+blooms$blooms$blooms bloomsbloomsbloomsdetritusDdoorwayCdoorway>tassle=tassle %gloriously $gloriouslywoodenHwoodenCwooden9wooden8wooden7wooden/wooden.woodenFwoodenHwooden woodenwoodenBwooden wooden7woodengwoodenfwoodenewooden'wooden@wooden!wooden_woodenwoodenwoodenwoodenAwooden?wooden8wooden6wooden&wooden woodenwoodenwoodenwoodenwoodenunlockOunlock sparkling sparklingpearly  hurricaneexpireintrigue takeyourleaveimpartpresentuntanglereverieexcusemeexcuseyourselfexcuseprotectinjuregullet slavering slaveringslaver ~fountain'sSthingsplayingOplayingNstuffedJstuffed~fountainBfountainslippersfanwortsfanwortfanwortslipperslipperdryingroundedroundedroundedBroundedroundedroundedvcrimson*crimson)crimson!crimsonecrimson]crimson sweepingblack ribbonssweepingsweeping'valleyvalleyimmature hummingbirds hummingbird woodpeckersburningsorcerysorcerer sorcerersobscure interlaceassenttoassentscrunch castspellon castspell|reposeupon|reposetransferiremoveexecute assassinate counterstrikeinvtallinvtallltransformintohumanltransformtohumanltransformhumanktransformintoravenktransformtoravenktransformravenjtransformintodragonjtransformtodragonjtransformdragon itransform \removeall &travelingtravel4travel&traveldead greyhoundartfully %interlocking interlocking  rockslide vrockslide irregular  irregular irregulardazzling sandsucker7furthermfurther Winterlaced Smulticolored woodpecker Awoodpeckercolumnscolumnscolumnscolumnscolumnscolumncolumncolumncolumncolumnytravel'stravel's smattering smattering smattering Xdroppings WdroppingsXdroppingWdropping counter8counterlittlelittlelittle littlelittlelittleIlittleelittle_littlelittlelittlelittlelittlelittlelittlelittlexlittlewlittle-littlelittlelittlelittleherons starlingsstarling groundhog currentravensravensravensenshroudarouse distribute contribute mextinguishlistenin onlistentolisten~wallopmurder communicatepdisquietpolish,talktovtalkto stranger's  stranger's stranger's  stranger's  stranger's stranger's stranger'sgryphen wolfhoundkittenground8qstrangefryingfryingmfryingQjournal ground7q)expanseground6qKpointedpointedpolishedVpolishedpolishedfacefacefaceface seastonescurrencyirisesdrowneddrowneddrownedstranger strangerstrangerstrangerflowingflowingflowingflowing}flowingflowingrground5q?ground4q6trails6trailsground3q>floweredfloweredfloweredground2q8flowersZflowersflowersflowersflowersflowers8flowerVflowerQflowerflowerflowerflowerflowerflowerflowerflowerflowergroundqndowninurotaterotategroundgroundCgroundground groundTgroundground/ground groundgroundgroundgroundqgroundVgroundUgroundTground>groundgroundground~groundygroundrgroundgroundgroundgroundmarmot scorpionsscorpion tavernkeeper tavernmaidfadeaway sayaprayerGescortsaunteronsaunterpummel{whisperto{whisperanswer qmollycoddleqsnuggleunscrewuncoverKtavernkeeper'sJtavernkeeper'sItavernkeeper's@cloudy snugglebums Hsnugglebumsrattlingglowingglowingglowing something somethingYscytheWglovesunicornunicornunicornunicornZunicorncavitycavitycavitynorthernletting driftwoodencrust encrusted encrustedLbronzepatternspatternspatternspatternspatternspatternspatternspatternspatternspatternpatternpattern}patternpatternrollingrollingrolling>rolling.rollingrollingcluster clustercluster underripeCtavern'sAtavern'stavern's unicorn's zunicorn'sYlayersVlayersUlayerslayersTlayersPtavernOtaverntavernJtavernItavernGtavernEtavernHtaverntaverntaverntaverntaverntaverntavernNtaverntavernYcageVcageUcageZcageTcagecageEcagecage nothing northeast 2northeast northeast pnortheast northeast northeastmyselfHmyselfmyself  rainstormwizardskissingwizardrywizardrywizardwizardsnivelatsnivelflourish{settleinsideof{settleinside{settleontopof{settleontop{settleupon{settlein{settlezobserveunravelunfasten promenaderevivedestroyinvwideinvwide orejuvenateconjure;brownish%squareshoundstalonsoverathowlingstaring tarnished ]preserved9shovelbshovelshovelvacuumsunevenunevenwhorledwhorledwhorledHfistfulHfistfulsHfistfuls'bouquets'bouquetsbouquet'bouquet'bouquetjuvenilebackbackshrivelshrivelshrivelshrivelshrivelshrivel shriveled shriveled shriveled shriveled shriveled shriveled shriveledsquareZsquareEsquarerestartrestartverboseverbosesprucesprucefortressfuzzballgroovegroovebeeftobeefaurevoirtoaurevoir saygoodbyeto saygoodbyereviewbrowseswallowgdisposeofbrowseoverbrowseoverbrowsethroughbrowsethrough Mappropriateiunweardpropelrunamokwithdrawstrikeassertspruceup ajitterbugsquallatsquall \unwearallZsoothe:chunkyIstains*stainsphosphorescencephosphorescent pinpricksthroatzportalJfrillyEcolors.stalks substance substance substance substanceplantsplantsplantsplantsplantsplants-tongues-tongueheadheadheadheadheadheadheadheadheadheadhead,headblossomblossomblossomblossomblossomblossomblossomsblossomsblossomsblossomsblossomsquarter quarterstaff@sunlightsunlightusunlightBsunlight%sunlight$sunlightyswitchoffvswitchnswitchmuskratsquinchscourgeprayerunveilgjettisonGfollowaftertraipsebakepflusterppesterpharrowburnish\stripallcspringovercspring thongspuppiessterilesterileupwardsbeakbeaktoothedvknollslonelylonelyskylight skylight knotholesknotholemassiveunripe,violet+violet\violethjumpingjade firefliesgentlyforest5forestforestforestforestforestforest{forestnforestGfollowfollowforlorn ostrichesostrich atmospherehorses treasuresmarryingsubmittosubmitcomplywithfeedexposeperuseperusethroughperusethroughprovidebestowMconveyunhookdrowseoffdrowsebideqmolestdflutter \exposeselfchurtleoverchurtleuncloseunboltktassetsQtatteredtreasureStreasureHtreasure<treasure treasure impromptu  impromptu "thousandscolonycrests{jadezjadeyjadehjade^jadeElitter/shoresshoresqshores=shoresclumpsclumpsclumpsclumps/clumps translucent translucent translucent Ktranslucent translucent translucent translucent wmountainswmountainomountainunscriptunscript inventory inventoryshroudgrousetogrousesquash sayaurevoirtodevourtransmitUinsertintoUinsertinunwindptorment oresuscitate[tiptoeto[tiptoeVbeamatVbeam contortingsilvered silvery-gray silvery-grayhollowszhollows xunderwearPdiceJplushies&squarishsquarishhollowhollowhollowhollowhollow<hollow;hollowhollowhollow underwater underwater underwater underwater underwater distortion distortion distortion distortionbottombottombottombottombottom JdistortedFsliversFsliver 3stretches 3stretches3stretchBedgeedge}edge6edge1edge/edgeedgepedge:edgeedgemottledmottledmottledmottledmottledmottledpmottledsilverysilverysilveryhsilverysilversilversilver%silversilversilversilversilversilversilversilversilversilverhsilvergsilverfsilverdsilverKsilverVsilver-silver silver silvergsilverhdownondownonscriptscriptscriptconsumeconsumeplatupi platupuseswallowwallowpotholepotholeleadleadenmitynottobeUsetdownonUsetdowninunstickheedopposeunfetterKclunky5calflordlylordly butterballutunicsWarmouredXarmourKarmourUarmour*plumes butterflies "butterflies crystallineswollenwaterswaterswaterswaterswaterswaters "butterfly !butterfly ybutterfly Tbutterfly Obutterfly honeysuckles honeysuckles honeysuckle honeysucklegrowinggrowinggrowing Ncrystalized tcrystalized scrystalizedcrystalqcrystalocrystal\crystalNcrystalcrystalcrystaltcrystalscrystal7upstairs6upstairs sprinkle downpourstreetrenouncegexpungefurnishcoitusshimmydownprattleaboutprattleshimmyupcane9cane/canecurvingcurvingwrithing striations striationsjointsVreversedUreversedTreversedVreverseUreverseTreverse Isprinkling  sprinklingstriatedwrinkledwrinkledwrinkledwrinkledwrinkledoverripeoverripeoverripeoverripeVrustedrusted:potatoesdpotatoes:potato>potatodpotatosettingparrotsparrotplovers showermaia droptokneesdroptohandsandknees horsewhipstrokebangonbangleafoverleafoverleafthroughleafthrough Mtransportrunamuckptroubleploverploverdanedane outsideofcurvessoutherncrab Ktransparent,purple+purplepurplepurplepurplepurplepurpleipurple\purpleFpurple3purplepurplepurplepurplepurpleleafleafleafleafleafleafleafleafleafleafleafleafleafgutensilgutensilsoutsideoutsidekoutside<outside:windows9windows>window:window=window9windowpositionversion southeast southeast southeast tremor galegrassy interweave constrict investigate wsomersaultpacegryphoncapevcape^varying/areamusselXtwinkletwiningnarrownarrowtroughtroughthrough9smoothlyplatypuslocustslocust territoryhidebehindhideunderhidebareexplore scrutinizeMbearuncouplehideinbalkresistoheal vsubstituterictususmoothedOcard splinterytoweringtowering splintered9smoothsmoothvsmoothsmoothsmoothmagemagemagemage mage magemage magemage%sunshine$sunshineFsplinter-splintersplintersplinter Fsplinters splinters splintersMprocureMpurloinmstopperracepdisturbbwhistletobwhistleatbwhistlefoutfitHmaidmirrorsmirrormirrormirrormirrormirrored promontoryhandhandvsculpted.base~baseqball"wayward!waywardhorizonhorizonhorizonhalfhalfhalfhalf {countryside zcountryside ycountryside xcountrysideunplugunplugroostersroostersquawkatsquawkcalltoreadoverfeelMgrabfleecontusebeat ptyrannize Zlulltosleepcall 3yellowing )voluminoustousledyellowedIwroughtZcrownsfissurefissurefissure yellow-greenwaterystonesstonesstonesvstonesstonesstonesstonesrottenrottenrottenapples1liquor0liquoryellow;yellow6yellowyellow!yellowyellowyellowyellowyellowyellowyellowyellowyellowayellow`yellowOyellow2yellowyellowyellowyellowyellowyellow menustylereadreadread2buttonsKbuttonsKbuttonswarmsprotesttoprotestsqueeze bonvoyageto bonvoyageMpossessunstrapfendoffoimproveunwrap&strapsoutletsoutletoutletoutletushirtsZcalmcalm hornworts hornwortshornworthornworthornwortpointspointspointslakelakelakelakelakelakelakelakelakelakelake/lakelakelakelakelakelakelake=lake strongstrongsquishysquishysquishysquishysquishyuntidyPwayhouseOwayhouseGwayhouseNwayhouse :shuttered 9shuttered:shutters9shutters>shutter:shutter=shutter9shutterbuzzardsbuzzard mosquitoesmosquitosayyes stimulatehyperventilateathyperventilatehaildragurevolveMhangon toMhangontocharfrenzysnoozeidle pulverizebashrdatemake?beeryournamemicemicethornshangzarch4arch3archarcharchwillowswillowswillowswillowswillowwillowwillowwillowwillowwillowwillowwillowwillowwillowwillowdeep)deepdeepdeepdeepdeepSheapheap^pottery drizzlebees surrenderto surrenderscuttlemobstructinsultlamerfallforpurifysummonMpack&packontopofnostrilscavecavecavecavecavecavecavecavecavecavecavecavecavecavesplits moonwortsmoonwortmoonwortspotted multitude multitudewhorlswhorlswhorlswhorls'bellbell fallfallhardhard-hardyhard land landlandland1land/land{landzlandxland0supperLsupperrestorerestoreidoffdoffgildlifelifeclapatclapforclapnourishbarkatdineondinestrollonstrollsprintdashheardamnwolvesdeerdeerdeerdeeruskirtshigh.high-high,high+high*high)high(high'high&high%high$high#high stoneworts stonewort stonewortlowlyinglowlyinglowlyinglowlyingtwistedxtwistedwtwistedbarkbarkbarkbarkbarkbarkbarkbark]reed\reed[reedreedreed swoopingswoopingprovokeguzzleentrusthikeonhikewadeinwade{mutterto*necknamenamenamenamerackrack muttering{muttermuttermoisturemaneburrowburrowbburrowburrow quilwortsquilwortquilwortglossyglossyglossyglossyglossyglossy*tulips*tulipstulips]bird\birdXbirdbirdIbirdbirdMbird[birdZbirdWbirdbirdbirdEbirdbirdbirdhate hypnotizeloafkickfreepperturb dpumpwings \unbuttonallcleapoffcleapovercleap&sackzephyrzephyr^swordsfineDfineBsprays*sunset(sunset'sunsetreefreefreefreefreef mnorthwardpalepalepalepale+palepalepalepale palepalepalepalepalepalepalepalepale palepalepalepalepalepalepaleDpaleCpalepalepalepalepalepalepalepaleppale%sunray$sunray%sunrays$sunrays9darkdarkKdark2dark.dark"darkdarkdarkdarkdarkdarkdarkdarkdarkdarkdarkdarkdarkdarkdarkydark=dark0darkdarkdarkdarkdarkdarkdarkdarkdarkdarkdarkdarkdarkdarkdarkdarkdarkdark~darkldarkWdarkIdarkHdarkGdarkdarkdarkndark%dark#darkdark$dark"darkdark northwest 8northwest northwest onorthwest :northwest northwest northwest northwest northwestiunbuttonunbuttonbondpeckatpeckcramlickrakelendetack pronouncedflap?foamgryphynkeenkeenkeenkeenkeengashgashgashgash|barnturkeysturkeybiteonbiteatbite{rideon{ridedoleoutishedGpursueafterGpursuecomethrucomethroughcomeintocomeinbquarry~cuffpstressomendBchipenailnailswirlsswirlshairhairhairhairlimblimbWlimbIfeetfeetfeetfeetstatusscanthroughpeekthrupeekthroughscanMkeepsealrpeekinsideofrpeekinrpeekinto rpeekinside ofrpeekinsiderpeekpostponedarn;sidebuckbuckfurrowfurrowfurrowtwirlsconeweedweedweedweedweedweedweedweedweedweedweedweedweedstripsMtaketakeitakeofftakeoff turretturret turretsturretsdodostorkssquirrelsquirrelawaybawlatbawlcarpipeelofffireupharkclubpeelopenpeeleddyVhelmboatoystergoldgoldgoldgold goldgoldHgoldgoldgoldzgoldagold`goldFgoldsandsandsandsandsandsandsandsandHsandHsandGsandDsandDsandCsand>sandXcrapWcrap kcourtyard <courtyardroad#roadyroadroadyroadjroad;roadfire5fire4firefireduckoreaclawatchugchewMholdon toMholdmfillinmatewithmateholdonuheft`beltout:meat;meat~belt belteyedclawclawyourselfHyourselfmuzzlemuzzleccoatcoatflatflatflatcflatflatflatflattfrostycoilcoilcoilucoilcoil5coilMpickuppickupitchlashflogeclipamokdivethrudivethroughdivediveindiveintowakeupwakeharm{murmurto{murmurqnuzzlepearpear8pearroberobeiprettypurple fireflies blueblueblueblue"blueblue blueZblueLblue>blue.blue-bluebluebluebluebluebluebluebluebluebluebluebluebluetbluesbluefblue_blueQbluePblueFblue@blue0blueblue'blueblueblueblue prettyprettyHprettyprettyapretty)prettyprettyprettyprettyholeholeholeholeholeholeholeholeholeholeholeholeholeholeholehole holehole holeholeholeholeholerhole?holeholeholeholedfoodDhazeBhazeAhaze>cord=cordcoincoincoincoincoincoinmashhuffathufffuckhuffonbminescarkingOkinghugelustrouslustrouslustrouslustrous/uprooted&uprootedhillhillvhill3hillhillhillIwidewidelocklockKlocklocksendoffhaulloanMhaularoundMcartaroundMcartMpalm pussyfootstabchoptangtangtangninetailtailtail=peatendsknobfishfishfishfishfishfishfishfishfishfishselfHselfself rainrainupileJpilepilealamp3kegs2kegs southwest 5southwest ksouthwest :southwest southwest southwest southwesthawktickgiveupmoanatmoan castglamour overgaspatgaspsightosighatsighicastoffscatdratcastdoesdoeslegsearsgapswfeltQbookbookUbookPbook}markgivegivewflipflippinepineseasseasmaskkillselfjerkhoofitcooktalkaboutrdoteuponrdoteon,talkvtalkfawnfawntearIteartearflueflueflueflueflueflueflueflueflueflue,pair pairpairWpairPpairkelpkelpkelpkelpkelptalktokill}killmolepathgnawongnawatgnaw{seatsupplygoredrubslamwailatmilk4hemsdogswailwailLkitemazemaze~isletalltalltalltalltalltalltalltallztall3tall.tall-tall,tall+tall*tall)tall(tall'tall&tall%tall$tall#talltalltallttallcoolcoolcoolbcool gods godseasteastyeast1easteastneast=easteasteasteastxeasteasteasttilehensdovedrawsurveyturnoverlinklinkelinkraveatravewardagainstwarddflew7pipe.pipegirlbodybodybodyOlonelone7twists7twistsbudsbudsbudsbudsbudsbudsbudsoaksoaksmitekirisurvivewalkwalkonroamplodwalktowalkthroughwalkthruwalkintowalkinwalkoffwalkoutmaululiftocure ZputtosleepbullstagstagstagstagdripdintdintdintdintdintdintKshoeHshoeshoevasevaserockrockrock rockrockrockvrockrock rockzrock4rockrockrockrockrockrocksavesavepokepokefwearIwearQweargiltlivelivedenynurturesellejoinlopebgrubin~sock~slapptortureVgrinover atVgrinatVgrinring%ripewildwild eviltubefinsfinsfinsfins gturquoise [turquoise Pturquoise Fturquoise turquoise turquoise turquoisetreetreetreeLtreetreetreetreetreetreetreetreetreextreewtreettreeltreejtreeRtreeQtreePtreeOtree9treetreetreetreetreetreetreetreetreetreetreetreetreentree)tree,tree*tree(treewallwallwallTwallwall!wall walllonglonglonglong$longlonglonglonglong longlong8longlong moatmoatpondpondbugslordweepatsingtowileboltehookpuffonpuff`singchowwebsof honeysuckleweepweepweepweepweepsign0dulldulldulldulldullpdull,tellvtellvultureruptureruptureuwindupdozeoffdozerazesnapMgrip9grip'hers&hers#hersawaylionlionlionlionlion~everbushpinkpinkpinkpinkpinkoval+spanIspanubitsZbitsUbitsEbits"corn cornpanspanslpanshpansgforkwindwindSwindRwind winduwindwindwindwindwindwindwindGwindAwindwindwind;windwindwindwindQwindhewnhewnopenopen:open9openwaveatwavetowavepantatpantriseupyankgloseapsoKfullwashFwashriseriserisevrise3rise/risearmscarmsarms<wine=wine`winethinthinKthinthinthinathindirtdirtdirtdirtydirtjdirt;dirtJgray2gray,gray!graygraygraygraygraygraygraygraygraygraygraygraygraygraypgrayogray%gray#gray$gray"graygullroarroaratskimskimthroughskimthroughskimoverskimoverblowthrublowthroughblowonblow5boot-boot#bootbootbootinonlastCbowl8bowlFbowlbowlwellDdoorCdoorjfromlilttolookoverlookbackoflookbelow lookunderneathUdropdowninUdropdownonUdropontoUdropuntoUdroponUdropintoUdropinnoseaboutnosenoserlookinsiderlookintodropdownrantatrantwipeoutpeltwipedwingtodsoartodsoar`liltcootdwingwingmanyriftriftrifttomeblurairyairysitelookbehindlookbehindlookbeneathlookbeneathlookunderlookunderlookthrulookthrulookthroughlookthroughwaitwaitzlookaroundlookaroundzlooklookrlookonlookonrlookinlookingdropdropNdroptdropsdropdrop+lookatlookatvoleplayaboutplayaroundplaywithplaygdumpporethroughporethroughporeoverporeovertrekloverloveporeporeporeporeporehunk=hunkeyeseyeseyeseyeseyeseyes0curlroofXpoohWpoohundoundoyellat^yellatyell^yellpartfrompassdmovecskiplintsongwiresoilsoilsoilburn}burnhornhornhornzhornDwarmCwarmJgrey2grey,grey!greygreygreygreygrey>greygreygreygreygreyogrey#grey"greymovesw movesouthwestmovese movesoutheastmovenw movenorthwestmovene movenortheastmovewmovewestmoveemoveeastmovesmovesouthmovenmovenorthwhipluregulpdowngulpwolfdowngjunkmplugupeyokefootitsayxyzzywolfwolfironironiron ironironIironiironKironlipsmessfootfootmothmothXshitshitWshitdowndowndown downdowndowndowndownqdown>downdowndown~downidowndowndownqplugswanrentrentjinxburpatburpurollslaystemstemstem roserose rose%rose rosemoonmoon!moon moonwcityHwoodCwood9wood8wood7wood/wood.woodtwoodHwoodwoodwoodwoodwoodemusswiguspinkisskissexit_howlatyelpatyelpmullovermuseaboutmuseovermuse"wraprats_howlhowlbrow0poolhump loop4loopstarstarstar'starstar'lilylilynintowaspcrowatcrowcrowcrowzview~slughurlvswappawsKtoestoestoestwigtwigWtwigtwigtwigtwigtwigtwigtwigtwigtwighuskhuskhuskpraytoprayMtotesteponrovestepjumpthroughjumpthrujumpinstepoutcjumpontocjumpuponcjumpon7trim#trimcowsslitslitslitknotlushpurepurepurepurepurepurepuresoftsoftsoftsoftsoftsoftsoftsoftsoftsoftsoftsoftsoftsoftsofthazyBhazyAhazyoverPwithcjumpoffPjumpoffcjumpoverPjumpovercjumpPjumpemooravowventatventventventventventventDmist0oilyPsnugOsnugNsnugroomroompullpullMlootrompriotrestbustruin[lurkaround[lurkin[lurk8plumlumplumplumplumplumplumplumpXpoopWpoopyawnatyawn~swat[huntswimonswiminswimswimtodust4dust*dust#dustdusttipstipstipstipshontoontopushsw pushsouthwestpushse pushsoutheastpushnw pushnorthwestpushne pushnortheastpushwpushwestpushepusheastpushspushsouthpushnpushnorthdpushpushfussshowoffstayyawpshowshowburyrush6vestruby=mossmossmosshuponupontypetypehurt:stewaabDwisptuft}tuftgustgustSgustRgust gustgustgustgustGgustAgustgustgust;gustgustgustgustQgustthruquitquitwestwestwest7westwestlwest:westwestwestwestwesttreymshutoffroot-tinytongues of silvertinytinytinytinytinytinytinytinytinytinytinytiny-tinymshutshutKsuitmstopup#wornhuntoRspunQspunPspunOspun9spunpotspotslpotshpotsbe:soupwavypupswtownturndownturnontossdownUtossintrotturnintossttossyturnoffuturnturnturnmutt_yowlat_yowlwirywortwortwortonyxonyxonyxiftoysJtoysyouryouryouryouryouryouryouryouryour{yourzyourwyourananhihimeHmemedoinnenene2nenepnenenekiatofgothrugothroughgointogoingooutman's9man's8man's7man's5man's4man's3man's2man'sgoupgoupgodowngodown gosouthwest gosouthwestgoswgosw gosoutheast gosoutheastgosegose gonorthwest gonorthwestgonwgonw gonortheast gonortheastgonegonegowestgowestgonorthgonorthgosouthgosouthgoeastgoeastininninseseyseseseno9val'sval's val'sval's val's val'sval'sval'sitval'shonontobe?toupupupupup>upupupsup@upupupuppupupupnwnw8nwnwonw:nwnwnwnwnwmymymymymymymymymymyst,ttvttswsw5swksw:swswswswMcachecaked$blade.blade+laced!laced lacedJlacedMedgedalgaealgaealgaealgaealgaealgaealgaealgaealgaedanceonadanceforadancewithadanceblackfeathershedgehedgehedge'callacallablack7black+black#black!blackblackblackblackblackblackblackblackblackblackblackblackblackblackblackwblackkblackjblackiblackXblackYblack0blackblackblackblackblackblackblackblackblackblackblackblackblackblackblackblackRblackIblackHblackGblack6blackblackblackblack{blackwblackrblack>blackhblack/black-black+black)black'black=black.black,black*black(black&blackeaglebelchatbelch+checkbared'peacepeace beadsof moisturebeadsSYMTAB\saycarcdrlength randomizerandsubstrcvtstrcvtnum upper lower caps find getargdatatype setdaemonsetfuse setversionnotifyunnotifyyornremfuse remdaemonincturnquitsaverestorelogginginputsetitaskfilesetscore firstobj!nextobj"isclass#restart $debugTrace%undo&defined'proptype(outhide)runfuses *rundaemons+gettime,getfuse -intersect.inputkey/objwords0addword1delword2getwords3nocaps4skipturn 5clearscreen6firstsc7verbinfo8fopen9fclose:fwrite;fread<fseek=fseekeof>ftell ?outcapture @systemInfo AmorePrompt BparserSetMe CparserGetMeDreSearch EreGetGroup Finputevent GtimeDelayHsetOutputFilter IexecCommand JparserGetObj KparseNounListLparserTokenizeMparserGetTokTypesNparserDictLookupOparserResolveObjectsPparserReplaceCommandQexitobj RinputdialogSresourceExistsT__reserved_func_10U__reserved_func_11V__reserved_func_12W__reserved_func_13X__reserved_func_14Y__reserved_func_15Z__reserved_func_16[__reserved_func_17\__reserved_func_18]__reserved_func_19 not Cif Delse Ewhile Jbreak Kcontinue Qexit Rabort Band Aor Ffunction Greturn Hlocal Iobject Mnil Ntrue Opass Saskdo Taskio XioSynonym YdoSynonym Zexternal [formatstring WcompoundWord specialWords Pclass ]for \do switch case default goto replace modify ^new _deleteself inherited argcountverbnoun adjective prepositionarticlepluraldoAction ioActionsdesc thedesc  ioDefault  doDefault locationvalue roomAction actorActioncontents prepDefaultverActorvalidDovalidIo lookAround roomCheck statusLine locationOK isVisible cantReachisHimisHeraction  validDoList !validIoList#dobjGen"iobjGen$nilPrep%rejectMultiDobj&moveInto 'construct(destruct )validActor*preferredActor +isEquivalent,adesc -multisdesc/anyvalue 0newNumbered2parseUnknownDobj3parseUnknownIobj 4dobjCheck 5iobjCheck 6verbAction 7disambigDobj 8disambigIobj 9prefixdesc:isThem dgp_pictureegp_name fgp_defverb ggp_active hgp_hotlistigp_icon jgp_defverb2 kgp_defpreplgp_hotid mgp_overlayngp_hotxogp_hotypfmtYouqfmtYourrfmtYouresfmtYoumtfmtYouveufmtSvfmtEswfmtHavexfmtDoyfmtArezfmtMe checkDoor checkReachitemcntisIndistinguishablesayPrefixCountlistcont  nestlistcont  listcontcont  turncount  addweight addbulkincscore darkTravel scoreRank terminate goToSleep initSearch reachableList initRestart inputline_rand {restartingglobal|isopen}isdescnumObjstrObj ~isCarryingisIn reachableiswornislampislitisListed listcontgencontentsVisibleopenable pluraldesc issurface showcontcont isqsurface isqcontainerlistfixedcontcontisfixed  scoreStatus !scoreFormat turnsofarscoreweightbulk "hiddenItem searchLoc searchContunderLoc underCont behindLoc behindCont floatingList #floatingItem $visibleList%numbered_cleanup &mainRestore 'switchPlayer(numberedObjectclean_upnewNumberedPlural num_is_valid)room *nestedroom statusPrep outOfPrep statusRootdispBeginSdesc dispEndSdesc nrmLkAroundroomDrop isdroploccanReachContents +inspectVerb,askVerb-tellVerb cantReachRoom .fixeditem/surface 0chairitemischair enterRoomnoexit verDoBoard verDoSitondoBoarddoSitontravelTo verDoLieondoLieon1beditemisbed2thingverGrabGrab itnomdesc itobjdescitisdescdoesdescisntdesc itselfdescthatdescldescreaddesccontentsReachable verDoSave verDoRestore verDoScriptverDoSay verDoPush verDoAttachTo verIoAttachTo verDoDetachverDoDetachFromverIoDetachFrom verDoWear verDoTake verifyRemoveisactor 4movableActor isopenable isReachabledoTake maxweightmaxbulk verDoDropdoDrop verDoUnwear verIoPutIncircularMessage verDoPutIndoPutIn verIoPutOn verDoPutOndoPutOn verIoTakeOut ioTakeOut doTakeOut verDoTakeOut verIoTakeOff ioTakeOff doTakeOff verDoTakeOff verIoPlugIn verDoPlugInverIoUnplugFromverDoUnplugFrom verDoLookinthrudesc verDoLookthruverDoLookunder verDoInspect doInspect verDoReadverDoLookbehind verDoTurn verDoTurnWith verDoTurnTo verIoTurnTo verDoTurnon verDoTurnoff verDoScrewverDoScrewWithverIoScrewWith verDoUnscrewverDoUnscrewWithverIoUnscrewWith verIoAskAbout ioAskAbout doAskAbout verDoAskAboutverIoTellAbout ioTellAbout doTellAboutverDoTellAbout verDoUnboard doUnboard fastenitem leaveRoomverDoAttackWithverIoAttackWithverDoEat verDoDrink verDoGiveTodoGiveTo  verDoPull  verDoThrowAt  doThrowAt  verIoThrowAt  ioThrowAt verDoThrowTo doThrowTo verDoThrowdoThrow verDoShowTodoShowTo verIoShowTo verDoCleanverDoCleanWith doCleanWith verDoMove verDoMoveTo verIoMoveTo verDoMoveWith verIoMoveWith verDoTypeOn verDoTouch verDoPoke  verDoBreak!doBreak "genMoveDir #verDoMoveN $verDoMoveS %verDoMoveE &verDoMoveW 'verDoMoveNE (verDoMoveNW )verDoMoveSE *verDoMoveSW +verDoSearch5item 6lightsource,doTurnon-isActive7hider .searchObj /serialSearch0autoTake 8underHider 1doLookunder 9behindHider 2doLookbehind :searchHider3doSearch4doLookin;readable5doRead<fooditem6doEat 7lastMealTime 8foodvalue9eatTime=dialItem :minsetting ;maxsetting<setting=doTurn?toPrep>doTurnTo @switchItem ?verDoSwitch@doSwitch AdoTurnoffBisseenCverbose DfirstseenEmeIsMovingInto FleaveList GaddLeaveListHleaving IdispParagraphJdispBeginLdesc KdispEndLdescLheredesc MactorDescNnorthOsouthPeastQwestRupSdownTneUnwVseWswXinYoutAdarkroomZlightsOn[lamplist \isDarkVerbCtheFloor]sitloc^ioPutOn_ioPutInDActor Eqcontainer `verDoFollow amyfollowerbaskWordcdisavow dverIoGiveToeioGiveTo fisobstacle gdestination hsayLeaving isayArrivingFfollowerjmyactor kisfollowerldoFollow GfollowVerbHbasicMe Idecoration JdistantItem Kbuttonitem LclothingItem mcheckDropndoWearMtakeVerbodoUnwearNobstacleOdoorwaypisdoorqdoordestrislocked snoAutoOpen tsetIsopen uverDoOpen votherside wsetIslockedxdoOpen yverDoClosezdoClose {verDoLock |islockable}doLock~mykeyPwithPrep verDoUnlockdoUnlock verDoLockWith doLockWithverDoUnlockWith doUnlockWith verDoKnockdoKnock verDoEnterdoEnterverDoGothrough doGothroughQlockableDoorwayRvehicle isvehicle SgetOutVerbToutVerbUputVerbVqsurface Wcontainer iscontainerXtransparentItemYlockable ZkeyedLockable[keyItemverIoUnlockWith ioUnlockWith verIoLockWith ioLockWith \seethruItem doLookthru ]basicNumObjdoTypeOnioTurnTo ^basicStrObj verDoEnterOn doEnterOn verDoEnterIn doEnterInverDoEnterWith doEnterWithsaveGamedoSave restoreGame doRestorestartScriptingdoScriptdoSay_deepverb`darkVerb aaboutPrepbdigVerb verIoDigWith ioDigWith verDoDigWith doDigWithcjumpVerb verDoJumpdoJumpdpushVerbdoPush eattachVerb ioAttachTo doAttachTofwearVerbgdropVerbhonPrep iremoveVerbjfromPrepverIoRemoveFrom ioRemoveFromverDoRemoveFrom doRemoveFromlopenVerb mcloseVerbninPrepooffPreppoutPrep notakeallqplugVerbioPlugIndoPlugIn rlookInVerb sscrewVerb ioScrewWith doScrewWithdoScrew tunscrewVerb ioUnscrewWith doUnscrewWith doUnscrewuturnVerb verIoTurnWith ioTurnWith doTurnWith vswitchVerbwflipVerb verDoFlipdoFlip xturnOnVerb yturnOffVerbzlookVerb{sitVerb|lieVerb }boardVerb ~againVerbwaitVerbiVerbuseInventoryTall iwideVerb itallVerb lookThruVerb breakVerb attackVerb ioAttackWith doAttackWith climbVerb verDoClimbdoClimbeatVerb drinkVerbdoDrinkgiveVerbpullVerbdoPullreadVerb throwVerbatPrep verIoThrowTo ioThrowTo standOnVerb verDoStandon doStandon standVerb outhideStatus helloVerbshowVerbioShowTo cleanVerbverIoCleanWith ioCleanWithdoCleansayVerbyellVerbmoveVerb ioMoveWith doMoveWithioMoveTodoMoveTodoMove fastenVerb verDoFastendoFasten unfastenVerb verDoUnfasten doUnfasten unplugVerb ioUnplugFrom doUnplugFrom verDoUnplugdoUnplug lookUnderVerblookBehindVerbtypeVerb verIoTypeOnioTypeOnlockVerb unlockVerb detachVerb ioDetachFrom doDetachFromdoDetach sleepVerb cantSleep awakeTime sleepTimepokeVerbdoPoke touchVerbdoTouch moveNVerbdoMoveN moveSVerbdoMoveS moveEVerbdoMoveE moveWVerbdoMoveW moveNEVerbdoMoveNE moveNWVerbdoMoveNW moveSEVerbdoMoveSE moveSWVerbdoMoveSW centerVerb verDoCenterdoCenter searchVerb knockVerb travelVerb isTravelVerbeVerb travelDirsVerbnVerbwVerbneVerbnwVerbseVerbswVerbinVerb verIoEnterOn ioEnterOn verIoEnterIn ioEnterInverIoEnterWith ioEnterWithdVerbuVerb gothroughVerbsysverb issysverbquitVerbquitGame verboseVerb verboseMode terseVerb terseMode scoreVerb showScoresaveVerb restoreVerb scriptVerb unscriptVerb stopScripting restartVerb restartGameinitRestartParam versionVerb showVersionversion debugVerb enterDebuggerundoVerbundoMovePrepofPrep betweenPrepoverPrep aroundPrepthruPrepdirPrep underPrep behindPreparticles preparseCmd cmdString cmdWordList preCommandbuildCmdString Stringizer cvtFromSpec stringizecvtFromCompound getActorVocab replaceWith getActorSdescTalkVerb verDoTalkTo doTalkTo conversation commonInitdieinitpardon initRestoreoptimal maxscore  runscript startroompreinitMe commandPromptcommandAfterRead global@231  menulinks  menustylemenuwrapHTML_Interpreter menu_exitSetMenuDefaults menu_styleTalkSub TestQuipsQuipsSayQRespondQSetQuip menulinksVerb menustyleVerb parseErrorparseUnknownVerbaboutBoxclssceneryfireisravenValmeadow underwaterflutegrovepatternispuzzleishuman valsatchelisburned thetavernnamedescLaynafooroom moveFromToburnforesthillsisactiveseashell isburningburn2sutra courtyardoldcootislandisfoughtisoilisbondededgecageend lilyend plains Lorekosi!isnamed "isbeginning#islove counter nothing god $verDoPray%doPraynestedroom@270 theFloor@271weapon&isweapon shadowdog'foodesc (scriptNumfoozit)script *listendesc +smelldescfloor2floor ,verDoSmell-doSmell .doListento /verDoListento0doDig1verDoDigcage2cagenoitem shadowbird2 shadowbird2doFree 3verDoFreetables24isstoodtablesbenches2bencheschairs2  wallsstart!walls"tavernshadows2 #tavernshadows $tavernlight2 %tavernlight &paintings2 'paintings (treepainting2 )treepainting*dragonpainting2+dragonpainting ,manpainting2 -manpainting .cauldron2/cauldron0bottles21bottles2kegs23kegs4hearth25hearth 6tavernsteps3 7tavernsteps8counter29tavernwindows2 :tavernwindows ;tavernroad2<taverncourtyard2 =Windowcord2 >Windowcord?shelves2@shelvesAceiling2Bceiling Cscullery2DsculleryElatch2Foldman Gtavernkeeper Htavernmaid5isshadow 6isattacked 7isattacked2 8isattacked39isfreeIsongbird:foo;isdress2 Jlaceddress<isarmour Ksuitarmour=fooNumLnicedinnerknife Msummonable Ntavernhere Otavernhere2 Ptavernhere3 >verIoBuryIn?ioBuryIn @verIoHideInAioHideIn Qtavernwind Rtavernwind2 Stavernwind3BverDoFlyCdoFlyTleavesUleaves2Vleaves3 WbirddroppingsXbirddroppings2Ybirddroppings3Zlatch[perch\perch2]perch3 ^potteryshardsDislightEverDoSitFdoSitGverDoLieHdoLieIistood JverDoWalkonKdoWalkon LverDoAttack MverDoKickNdoAttackOdoKick PverDoSlapQdoSlap RverDoWhipSdoWhip TverDoPeckUdoPeck VverDoScratch WdoScratch_chairsXMoveInto `winesmellatavernlanterns YverDoBurnZdoBurnbcloth [verDoPinch\doPinch ]verDoWave^doWavecoilcan _verDoLookThru `doLookThru averDoFeedbdoFeeddfarfood efartablesffarbowls gfarutensilshfarpots cverDoBlow dverDoHideedoHide itavernsteps2 jtavernroadktaverncourtyardlbeastmlake nbeastforest obeastmountainpbeastsky rbeastground sblooddrop2 fisequivalent tblooddrop3uroad gisearthquakevredhills wroadfarlands xroademptyland yroadground zroadyourland {roadbeastland hisscorchediispeckedjenterkeyesdesc lispookiebutt|stable }scorchmark~groundmisholygroundqnmylistpebbles2pebblespebblepebble2 wellopeningoverDoFixpdoFixwell bucketchain stonesludge drinkitem wellwaterdebrisskycloudssunqissun courtyardwindwind0thatchrisloosetilestrough sverDoSwimtdoSwim troughwater udrinkdesc applebarrel pileofapples vapplelistwfinddescapple9apple8apple7apple6apple5apple4apple3apple2apple1xistakenyeatdesc bruisedappleshriveledapplewallsigntavernfarroad farforest fartavern farmeadow2 boundary3zisstag{isstag2wet|isherefoostagfountain forestshadow willowtree birchtreetreesweepwillowtreeoaktree }verDoSqueeze ~doSqueeze birchbark willowbarkweepwillowbarkoakbarkwillowbranches2willowbranches willowbranch birchbranches birchbranchweepingbranches weepingbranch oakbranches oakbranch birchleaves birchleaf willowleaves willowleafweepwillowleavesweepwillowleaf oakleavesoakleafacornsacornisOpen verDoShakedoShake lunarmoth fallpetalspetal isplantfood treeflowers blueflowerisflowerweardesc unweardesc issearchedsapphireisjewel searchdesc redflowerruby whiteflowerdiamond yellowflowertopaz greenfloweremerald purplefloweramethystsun2 waterglintredearthfararch2canopysky2ground2ground2qonyx2 turquoise2 turquoiseonyxground3 summonVerbfooVerb curseVerb xyzzyVerb ploverVerb defendVerb listenVerb smellVerbburnVerb growlVerbgaspVerb seduceVerb complainVerbprayVerb groanVerbdieVerbliveVerb squawkVerb surrenderVerbpeckouteyesVerbpeckVerb createVerb thinkVerbfreeVerb boundary1wind1ground3qflowers hyacinthstulipspansieslilies blackdahlias roses rainrims  cornflowers  moonflowers silverspeckles honeysuckleshorizonclouds2sun3 whitetrees blacktreescolumnribbons blackribbons whiteribbons brownribbons orangeribbons yellowribbons purpleribbons greenribbons redribbons blueribbons honeysuckle  silverspeckle !moonflower "cornflower #thinkable verDoThinkdoThink$rainrim%rose &blackdahlia'lily)pansy*tulip+hyacinth ,hyacinthhead -silverbell.grasses1/grass1 0blueribbon 1redribbon 2yellowribbon 3purpleribbon 4orangeribbon 5greenribbon 6blackribbon 7whiteribbon 8brownribbonisbroken 9coloredglass :boundary2 ;grovewind <farmeadow=farlake>ground4?ground4q@sky3Aclouds3Bsun4 Cwhitesands Dwhitesand EcoloredshardFcshard colordesc Gblacksands Hblacksand Idarkglass Jreflection KclearglassisfoundLbeetle Mshardglassisnaked NblooddropverIoThrowThru ioThrowThruObutterflyglass Pbookglass Qflowerglass RgrovetreesSdapplesTbutterflyground Ubookground Vflowerground WboughgroveXmessageYnorth1 Zfireflies[turquoisefireflies\purplefireflies ]redfireflies^greenfireflies _bluefireflies`yellowfireflies ayellowfireflybcave2clakecave dwindchamber eredfirefly fbluefireflygturquoisefirefly hgreenfirefly ipurplefirefly jfarforest2 kfarmeadows3lfargrove mfarplains nfarfountain oboundary4 pfarfeytree2qground5rground5qssky4tclouds4usun5 vsunreflectionwbonsai xbonsaitree yjadebutterfly zjadescarab {jadefirefly|grasses2}grass2 ~farislandfartreelakewind lakewater lakewater1toyboat watersurface2 watersurfacewaterreflection farlakebottomfarlakebottom1farlakeshimmerfarlakeshimmer1 farlakestonesfarlakestones1farfishfarfish1farkelpfarkelp1 farplants farplants1farcoral farcoral1 farshells farshells1farlakesurfacefarlakesurface1surfacewaterdown lakewater3farlakebottom3farlakeshimmer3 farshells3 farcoral3 farplants3farkelp3farlakesurface3farlakestones3farfish3farVal verDoTalktodoTalktoisending verDoTouchDig darkground darkgroundqdarksoildarktreeVal2darkcoatbattleVal3endgame darkroots darkbranches darkleavesdarkleafdarkbark darkfruit lakewater2farlakebottom2farlakeshimmer2farlakesurface2farlakestones2farfish2farkelp2 farplants2 farcoral2 farshells2 vegetationkelpfishtinyfish tinyfishesisdead bettafishessandfish lightningeelisSack seashellsshell1shell2shell3shell4shell5shell6shell7shell8shell9algae handfulalgaewort bouquetworthornwortquilwortfanwort bladderwortmydescmoonwort stonewort seagrassesseagrass bluestone seastonesseastonespongesponges vasesponge tubesponge treesponge normalsponge seasquirttunicate coralreefcoralbubblesseaweeds greenseaweed redseaweed blueseaweed purpleseaweed brownseaweed wireseaweedscallopseaweeddarkgreenseaweed sheetseaweed smallsnailstarfish bluestarfishoyster blackpearlanemone hermitanemone lakeshimmer lakegroundwetsand driftwooddubloon soggybookspade verIoAttackioAttackisCleanisBrokenground6ground6qground7treasure treasureholetreasurerainbowditch  fountainhole treasureholechest Val4 ground7q ground8ground8q cavefloor1 cavefloor2script2script3 script2Num script3NumverDoHugdoHug verDoSmiledoSmile verDoWakedoWake verDoCursedoCurseislisten verDoDrowndoDrown verDoSnarldoSnarl verDoBurydoBury verDoSeducedoSeduce verIoFeedToioFeedTo verDoSquawkdoSquawkverDoSurrender doSurrenderverDoDefendAgainstdoDefendAgainstverIoDefendAgainstioDefendAgainst verDoGrowldoGrowldoBlow verDoBelchdoBelch verDoPlaydoPlay verDoTickledoTickle verDoMatedoMate verDoTorture doTorture verDoSpankdoSpank verDoLovedoLove verDoKissdoKissverDoCoodoCoo whiterobegoldenslippersfarnorthfarlake2 farfeytrunk farfeybark farfeymoss farfeyknot farfeyleaves farfeyboughwind2sky5clouds5sun6  cloudshadows !butterfly "butterflies #greengrasses $greengrass %goldengrasses &goldengrass 'orangegrasses (orangegrass )redgrasses*redgrass +purplegrasses ,purplegrass -bluegrasses .bluegrassisknownend acceptNumacceptendNum cageendNum lilyendNum /edgescenery0edgeoil 1emptyland2emptylandnorth3farhills4fararch 5farforest3 6farnorth27farlake3 8farplains29shovel isworking:treasureroomfound;treasureroomfound2<fartreasureroom=heath>sky6?clouds6@sun7 Afountainwind BfountainwaterCdropletsDmistErainbowsFwashbowl GtreasureairHchestIkey JpileoftoysKironlockverDoCloseWith doCloseWithLkiteMbirdtoyNstuffeddolphin OkingofheartsPdiceisflying isdestroy react1desc react2desc react3desc react4descQjournalisreadSthingsTwalls2Uarmour Vspikedhelmet Wgauntlets XleatherarmourYscytheZshields[buckler\pedestal]pea^swords _shortsword `curvedsword afancysword bcreatable verDoSummondoSummon verDoCREATEdoCREATEcailettesdhelmeplumefvisorggreavesiscleanhtoecapicuirassjleggingsktassetslpots mfryingpanishitisDoom nchandelier ocrystalshardpbaubles qcrystalballrparasolisspheretstool upileofclothesvredcapewblackhat xunderwearyfarroad2 zarchwaynorth{fooarch|trap}carvings ~farfountain2verDoClimbdown doClimbdown rainbowbridge emptyland3 farforest4melodywind3sky7clouds7sun8redrockalcovefoohillsgleaming gianthandreddust unicorntop unicornshorn silverringishotlichenslichenonehole threeholetwoholeallholescleftmirror mirrorshardscave mirrorshardlionhill lionmouth liontooth lionwater liongulletfarkisei farkisei2kisei cavewalls cavecarvings cavefloors cavewinds cavewall1 cavecarving1 cavewind1 verDoExitdoExit cave2north cave2south cave2westthewindflues insectflue rodentfluelionfluestagfluebirdflue dragonfluemanflue equineflue canineflue cavewall2 cavecarving2 cavewind2 pinpricks cavelakewater lakecavedown lakecaveup lakecavesouth lakecaveeastzephyr zephyractortrapair trapmirrors placeholder afterPrep backofPrepitPrep alongPrep ontopPrep ontopofPrep beforePrepupPrepopenPrep onPrep@975 aboutPrep@976downPrep againstPrepforPrep insidePrep insideofPrepunderneathPrep apartPrep beneathPrep outofPrep outsidePrep outsideofPrepinonPrep belowPrepifPrepawayPrep closePrep allthePrep overatPrep articles@995 stagthing2 stagthing verDoCreatedoCreateiswindcatnipverdoEatmousesmouse parchment basicMe@1002 israinbowisdragon verDoGivedoGive verDoHowldoHowl verDoWhistle doWhistle verDoLaughdoLaugh verDoDefenddoDefend verDoSerenade doSerenadesingdesc verDoFeedTodoFeedTo isfooditem verDoBraiddoBraidverDoYes doYes  verDoSkulk doSkulk  verDoChange doChange iswearingverDoBuydoBuy verDoStripdoStripisnaked2 allnakedNumallnakedisnudemyitemmyhair isbraidedhairlock myfeathermyscale verDoUnbraid doUnbraidmylegsmyarmsmybodymyface darkcloak darkboots darkshirt metalclasps darkbreechescircletverDoFoodoFoofatcatishappymilkfoodfishisfoodisdrink isalcohol  verDoCalm!doCalm "verDoBark#doBark $verDoTease%doTeasedrunkard&islisted'doSing (verDoDance)doDance *mumbledesclintmumbles +tracklist,trackpos -iscreated.isdog/isgrove0grovedog1ismeat2ishuge 3issleeping4verDoAsk 5verDoTell6doAsk7doTellfeeVerb8verDoFee9doFeestag:istornvalcloakdeadstaggryphon ;isgryphon<issstag=istree>iskissed ?verdoSummon ValFollower @verdoStripAisconked valbody BgrovedogNumCisrose bluerose DmoveIntoVal  valnecklace Eknockedout valpants valshirtvalboots Fisjournalfoo1foo2foo3unicornGdoHello HverDoHelloIdoYell JverDoYell KdoWhisper LverDoWhisperMdoSigh NverDoSigh OdoFarewell PverDoFarewellQdoGasp RverDoGasp SdoApologizeTverDoApologizeUdoYawn VverDoYawn WdoComplain XverDoComplainYdoClap ZverDoClap[doNo\verDoNoVal5conversationTopics ]verDoAskTo^doAskTo _verIoAskTo `verIoTellToaioAskTobioTellTo cbattleNum dknockedoutNumvalboobynecklace eendgameNum fverdoKiss gisnibbledhissmile iispinchedjlocatonkishugged lisslappedmisreadyndoodyNumoisdoodypislaugh1birdqdoodyvalpinrissack swearFilter tgetcontlist countlistlistlistfoothing tavernActor uverdoPeckvisbird palecloak wverdoSeduce xverdoSerenade yverdoBraid zverdoWave{verdoCoofoo4 laynacloak|islayna !laynashirt "laynaskirt #laynaboots$staff%silverbracelet &travelpack'haircap(oldcoot2 }verdoTickle ~verdoCalm)oldcloak verdoBelch verdoGrowl verdoFarewell verdoBury verdoGasp verdoYawn verdoBark verdoComplain verdoFeed verdoClapverdoYesverdoNo verdoPlay verdoSquawk *cootcloakiscoot +cootshirt ,cootpants -cootboots.cootpipe/cootcane 0cootknifeissharp2mancloak verdoTake3manshirt4manpants5manboots6manvest7manpipe8manfruit9mancaneispaidismoney:stewbowl;meatpie <brandywine=redwine >potatorum?ale @appleciderAmugBplate CwoodenbowlDliquidcontainer Emaidapron FmaiddressGmaidcap Hmaidshoes Ikeeperapron Jkeeperdress Kkeepershoes Lfarfeytree verdoMate verdoThink McapricornverdoHug NaskVerb@1102 verIoAskForioAskFor verDoAskFordoAskForOunlockVerb@1103 PjumpVerb@1104 verIoJumpOnioJumpOn verDoJumpOndoJumpOn verIoJumpOver ioJumpOver verDoJumpOver doJumpOver QwearVerb@1105RendVerb SfactsVerb TaboutVerbUabout1 VsmileVerb WpinchVerb XpreenVerb YtickleVerbZcalmVerb [skulkVerb verDoStalkdoStalk \stripVerb ^yellVerb@1118 verIoYellAtioYellAt verDoYellAtdoYellAt_howlVerb`singVerb adanceVerb bwhistleVerb claughVerbdflyVerb verDoXyzzydoXyzzy eplughVerb fblurbleVerb verDoBlurble doBlurble gabracadabra hopensesame ichangeVerbjchangedragonVerbkchangeravenVerblchangehumanVerbmcleanVerb@1133nswitchVerb@1134verIoSwitchFor ioSwitchForverDoSwitchFor doSwitchForverIoSwitchWith ioSwitchWithverDoSwitchWith doSwitchWithofixVerb verIoFixWith ioFixWith verDoFixWith doFixWith ptortureVerbqhugVerbrloveVerbsclimbVerb@1139tthrowVerb@1140verDoThrowThru doThrowThruuliftVerb verDoLiftdoLift vaskVerb@1142 verIoAskIfioAskIf verDoAskIfdoAskIfxiwideVerb@1144yitallVerb@1145 zsayVerb@1146 verIoSayToioSayTo verDoSayTodoSayTo {whisperVerbverIoWhisperTo ioWhisperToverDoWhisperTo doWhisperTo |emptyVerb verDoEmptydoEmpty verIoEmptyIn ioEmptyIn verDoEmptyIn doEmptyIn verIoEmptyOn ioEmptyOn verDoEmptyOn doEmptyOn}attackVerb@1149~slapVerbwakeVerbexitVerbagainVerb@1153 waitVerb@1154lookInVerb@1155 digVerb@1156sleepVerb@1157iwideVerb@1158itallVerb@1159laaVerbverDoLaadoLaa enterVerb drownVerb verIoDrownIn ioDrownIn verDoDrownIn doDrownIn apologizeVerbswimVerb dreamVerb daydreamVerbrunVerb runamokVerbisamokkissVerbblowVerbsexVerb verIoBurnWith ioBurnWith verDoBurnWith doBurnWithwalkVerbbuyVerb verIoBuyWith ioBuyWith verDoBuyWith doBuyWithinspectVerb@1174followVerb@1175 nVerb@1176 eVerb@1177 sVerb@1178 wVerb@1179 neVerb@1180 nwVerb@1181 seVerb@1182 swVerb@1183 dVerb@1184 uVerb@1185 pushVerb@1186 verIoPushWith ioPushWith verDoPushWith doPushWith verIoPushToioPushTo verDoPushTodoPushToattachVerb@1187detachVerb@1188removeVerb@1189 lockVerb@1190closeVerb@1191 iVerb@1192 putVerb@1193 takeVerb@1194 giveVerb@1195 readVerb@1196 turnVerb@1197 flipVerb@1198lookUnderVerb@1199lookBehindVerb@1200 typeVerb@1201unplugVerb@1202centerVerb@1203searchVerb@1204knockVerb@1205 quitVerb@1206verboseVerb@1207terseVerb@1208 saveVerb@1209restoreVerb@1210debugVerb@1211restartVerb@1212unscriptVerb@1213scriptVerb@1214 undoVerb@1215touchVerb@1216 pokeVerb@1217 dropVerb@1218 lookVerb@1219 sitVerb@1220 lieVerb@1221lookThruVerb@1222 eatVerb@1223drinkVerb@1224 pullVerb@1225 readVerb@1226standVerb@1227helloVerb@1228 showVerb@1229 belchVerbsighVerbbreathfireVerbverDoBreathfire doBreathfire farewellVerbburyVerb verDoBuryIndoBuryIn serenadeVerb squeezeVerbyawnVerbbarkVerbfeedVerb spankVerbclapVerbcryVerbverDoCrydoCry verDoGroandoGroanwhipVerbyesVerbnoVerb crawlVerbplayVerb braidVerb verDoLivedoLive scratchVerbwaveVerb unplaitVerbcooVerbverDoPeckouteyes doPeckouteyeshideVerb verDoHideIndoHideIn juggleVerb verDoJuggledoJuggletalkiethingies beastthink stablethink darktreestuff plainstuff wortstuff treasurestuff potsstuffirontoystuff peapedestalpotspans roadthinklovedreamsmagesfeydeathbondinglifenameshumans rainbowsthinkravendragonocean skiesthinkflamesswarms adjectivesisbug islightningmazeismaze sunthings lightning silverpuddle islighting windstravelto  earthquake rainisrain  sandcastle2pitsispitpit groundhogdesccastleinthesky goldthing goldmoneymoose watersthing silverthing silvermoney copperthing coppermoney treethingtreefooistreedverdoFix sandcastle1verDoCreatableverDoSummonable doCreatable doSummonable verDoBlowondoBlowon  istouchedpondstreamswamp  waterfall!pool "thing@1314  iscreatable  isthinkable  verDoRemove doRemoveverValp #thing@1315 $thing@1316 %thing@1317 &thing@1318 'thing@1319 isclothing doCurseKnockisliquidcontainer dancedesc)movableActor@1321 verdoCreate *item@1322+lightsource@1323 ,room@1324isdress-searchHider@1325 .hider@1326/keyedLockable@13270fixeditem@1328 1darkroom@13292distantItem@1330 3room@1331 4fooditem@1332 5lockable@1333 6doorway@1334 7openable@1335 8fooditem@1336 9drinkitem2:fixeditem@1338;clothingItem@1339<basicStrObj@1340 =thing@1341isHidden isConcealed >Actor@1342SRCʱ ,converseADV.tp 5>Mav%1:Onw$0>Ybnzagain.tOco0Qns6Jfy(4=Xdm!*DPYt:a8a"^m:Nbv 0Ccs#3<E`p'7@`oP`~\adv.t@Os9"%7H{"?Ksk0Dh|,5>N]%+  =':N|%3<Ect0DXj} & : N ` s  3!!;   ; U - A S e x  6 J \ n -G"3Fl+O+:h|$3$B$S$b$$$$$$$ $0$S$k$t$%%&&%&.&H&_&v&&&&&&&&&/&&&&2&?&H&a&n&w&&&&&''*'6'U'n'''''''!("(?(f(((((((( (/(O((((((3CWd{6O^s4Qy00b0y0000-0Y0n00000 0/0@0d0u1W11"P"r"""""""" """2"E"S"j"z""""""""" "0"G"W"i"w"""""""""-"="Q"a"x""""3"J""""""."?"N"a"n"""""""" " ","<"W"h"w""""="""="a""" "A " " "# "l " " " " "? "K "\ " " " " " " " "! "2 "C "P "l "y " " " " " " " "5 "I " " " " " " """*"s""""""'"O"}""""" ""+"8"Y"f"y""""""%"C"Z"""""""""7"c"o""""" "-"a"""m"""""="N"Z"n"""""""("9"b"s"""""" "4"f"r"""""""("9"K"o""""""-"9"J"s""""""-"I"f"o""""""<"q"""""5"Y""""$"H"t""""""A"n""""1"Z"""" "8 "\ " " "!"F!"!"!"(""w"""""""" #"1#"U#"#"#"#"$"%$":$"o$"{$"$"$"$"$"$"=%"I%"%"%"%"%"%"!&"E&"&"&"&"'"M'"v'"'"'"'"'"'"(" ("D("z("("("("(")"*)"F)"[)")")")")")"*";*"P*"|*"*"*"*"*"*"+",+"X+"d+"u+"+"+"+"+","%,"V,"_,",",","-"+-"T-"-"-"-".";."_."."."." /"A/"j/"/"/"50"Y0"0"0"0"1"'1"k1"1"1"1"2"82"a2"2"2"2"2" 3""3"13"H3+B+Y+h+w++++++.(..... ..(.6.?.X.r........ . .9.J.k........&.4.U.c.r808T8h8888909T9h9999-0-T-h------;-G-k---0H0o000000.0W00000)0T0;(;L;Z;q;4(494]4}444=9=L===="=K=t=======6=M=Y=======@(@L@_@@@@@@@@;@K@z@@@@@@A@e@t@,0,Q,s,,,,,,,H,d,t,,,,,,,,2,T,i,{,,,,,',9,L,`,v,,,,,/,>,L,Z,h,y,,,,,,,, ,,#,7,`,i,},,,,,,,,,!,*,3,I,U,c,z,,,,9,W,d,},,,,,,,, ,,%,6,M,k,,,,, , ,= ,[ ,y , , 161F1S1f1z11111111 1H1d111111111!111@1^1u111111111!1.17u%7]r%Pd|)`)p))))) ).)P)u)))))V)x))))));)}))0)^)))))E)n)z))))))).)t)))))0)|)))))))7)E)V)))))) ) )@ FFAF~FFFFF.FZFmFFFFF,F6&2Ugx 0AS\ejIIpIIIIII(I2202W2222K(;;+;T;c;l;;;;;;;;$;0;Y;g;s;;;;;;;;+;7;Y;h;t;;;;;;";L;i;s;;;;;;;;E;N;r;;;;:;I;R;v;;;;;;;6#636F6_6n6666666 6/6?6l6|66666 636D6e6z666666"6F6Z6i66666 66U6y66666666#6G6Y6o6~6666666?6Q666666,6;6G666666<6e6y666666 63 6C 6u 6 6 6 6 6% 6I 6^ RRLRxRRRRRRHRQRuRRRR0R=RTR|RRRR R?RRRRRR"R,R5/!/5/e/q//////+/O/i//W1WRWWWWWWW0WjWvWWWWWWW5WVWW7797]7y7777777777,7_7h7777777#747i7r7777777$7H7e775(585\5h5t5555555D5P5d5s5|555555"5K5[555555>/./:/^/j///////)/5/u//////#[([S[h[[[\(\LXX6XWXXXXXXX8X\XkXXXXXX8XtX]#]S]]]<!<I<q<<:<^<r<<<<<<<<< <0<T<h<<<<<<<"<F<W<a<<<_4_J_______5_K_}____#E[NI-J----P4BUGjz.Rbo{ >Rfx&:CYet4JS:SkSSS4P?Vfx9xJx]y9yJy]H[?d 5bH[^4^a(; (j(k(k(j(o(o(o(o(hT6Ti(j(hAO"3=7_p5[l5CgxD{"/8AWdmvG >bs}H)5>T`i}8GcDQ  5AJVz7Hl}5E4Kn5.C:\Documents and Settings\Dark Queen\Desktop\gilded.t5CT"+7Qiw-GQ]jXk,CQ_l)*[1 J[!2CVp2C#G$ !@L]fx Rc-BUm0H 2Ujz+@eqzLXd8M[->Uq'E(:RhLU(:Qe{09E+s1@Iv,T,T  g(Jz6=&o&&''(-(I(m(U))*M*+1+h+++,2,,,+.. , T , T  *,3W#7W>V8i=3=?> 0"S$G&I(=*=,=.3022?4168829S=7?2AECB-BKs|NW09:HV*8)?gbDZ.M?^s I f z =Qn IXWfunzO v!"""##$$&&&(()I,U,^,- ..{///0002"2334D4444 5=5556749 :;; =L9LL3N-N\N8Lb9]qHlvCnQ0QDQQQQQ0QQQQ QrQQQ=:t<R -   3I:^ TTTSWWWP[[[^^^TxX|Nb% BXH x    v  d`t</e 4X($C W  ?  , @   6\.Rf___s________N_b_n_______u___ _ _ _( _ _____+___ _4_h!!8!!!!!!!=!Q!!!* !I ! ! !!!!E!Y!!!A!U!@@@ @@@@@@@@@1@ @ @ @@@2@@@@.@##5###+##aaaRaaaa%%%h%|%%Y%}%%'>'b''9']'('L'`'))@)));))*)>)++B+++=++,+@+- -.---)---,-///?/S/H/@/d/x//;/_/s/bbbbbmbbb(b``1211111.1R1151111c333|33\33333ccc8cJccc3cWcicc1cU5b55 5/555X5|554575[ddeeffgghh=DBDfDDDbDDD6DJD77$7   [           $ 8     N # M q  2 F  ? c  L i S g  !   $   B a    7     >     ii8i::@:::!:5::::%:::::>>>E>>>E>Y>>BBBBBBB2BnlUllll=lSlllUllIllAll ll/lFlmlllll l l lk lw l l l n?nUnoCoYop=pSprCrYrrrrrIr]rrCss#tt!uu_uuuu?uuuuuEuWuu+u4u u u ud up uy u u u u/ u; uD u u u u u xxyyyyYy}QeS9M7Z n  z     l    3  2wFej~zDXqey^m:g>e* Q    !!!##3%<%&&''4)=)>+G+n.w.1133T55577b9k9::S<\<d=m=^AgA%CyCCBEEEFIGRG|:|N|`||||||p|||S|w||| |1|E|o| | | }}}Z}~~9~~~T~x~~~Q~u~~~7~~~*~R~w~~~~~~ ~ ~ ~, @dx<R'=f>T5K*cn]Ny]h.R? 13W3e=/1UEY9MOmPd I] fDh|9MJncd?S -A&J^3}.Hx4w7[BlMqMal8L3+1E~o1U1EBf"Ep>aG]Z}4g r a      1ct|43> b v  *;V;! 5   < ])&   o RK_\    ;&`  C -~O/ ^$s_^!R^)\mK%IsJOQb+X#uSUy-@n9 .3U4T!EX;_'Vg<, lR 0gMz~>sY'mSB) n$H=I\<`=;RvhOz Ajm4   @dxTxcy)3I*@b&}6z| t sERd=a~ie6b P {   ~ @dx9]Tw;OPka1/S   ` G   )   A    p +   !!!   *  0 d u"w""   D     A R$W${$0$T$  $ }    8  %P%m%%%2% <M&y&&&&M ''''6'Z'v"3)`))O******oY ,,,,W,,,+F+j++,+++++G++---..:..F...///MAR0020o[11C1|h)22?2o0333mp!24 4.4}|+<555ck+666h8I77!7pp0888l-fyhDh|c;;;v;;;2;;>E>>>X>|>>>l>>>>I>t>>>>>>">>>>\>D ?@?d?xB=BhBCCC:CCCCDDDEEEEOEEE.FF^FLFpFGGG.GGGqGHHH'I I-JJ7KKKKK3K\KqL1LnLLLL\LMMMMMRM2MNN#999*9d99h9999999)OMOqPMPqQQR5RIR]RR(RRRRR"RRRR2RRR/RjSJSnT<T`UU=VVWWWXX2YYZ&ZJZZZVZq`````W```aoaaaaaaaaaa]]] ]]^]]]emeeee'eeeee$e____._l___ffff5fef[[[[3[v[[gsgggg;g g0gLgpgg^^^^^P^^^heh|hhh hhhhh#h\\\ \\^\\\ihi|iii iiiii)immmmmmmmm9mOmmmmjjnnoDoZoppqEq7qIqqqqAqqqq=qOqqqqdqqr@rdrxu=uuw$www_xxxyy/ySygyyEzzBzfzzzz<{{C{g{{{{ |||$||0|[|l}}}2~8~~1~~~~*~~<H^?cN7J :   n:^.G EiQu!i7Vz#4|,6ZImA` |i{h9OTx&Af!E+;*NkgMx g@dxQ6$+0Tj$H .z,f"F !0T uLf ],bs(L4HYXjC+@ S#Z<`@dG} 2@Obp|!= N^g MYb+4AMVfG6o96_ .m&DGk%eHlNrd4oC"[!ZP3_6I!EE /f +r1UD?.RDUs 0Tk7eYa'1U-\9^DhrEi8\z'`ludpyBNW(1: X|i=a<.xLp4 BCgB#G:<J3]w'.[-Tx'=aa O2q({$H$Nd0"FO[kt8DM8DM5 A J            #5^ /Sd9KH?)j"B0BGS~jZ`Nt>dU h          5 A J     * 3    S_hH+>c , / C         4 ' ;       %      ?     > 7 K p              t! }! " " # # # $ $ 6% ?% &' 2' @' ' ' E( ( ) ) ) % 9    c   #    @   x      a        ^     %   o   & - Q [     d   U y   N b         ' \    ' V z     3    T ` S  ! +" " " # $ $ % U& M' ' Q( b)3W@0Tq=o;AU =Q EtC_ DV' @dx\?SCW=Qq!G![!!!!I!m!:!!!"J"n"""""""## #w##3###R#c$$*$t%V%z%%%N%%%I%Z&Q&u&'U'y'g''"'u'')':((+()U)y)))Q)))?)P***`+f++++j++H++,=,a,-0-T-|--7---E-V...= @Wq     +aiu~ !) !="##S$\$?'T']'&0;0D0////+/l///000 0D0000050Y!5r   _ n    8 m   ~   i   F  11223[3o3<3 3-333344<5566G)uJ`y   7 b      >   )S @ d }  1=!=m=@=@7@[A<A`AJAAA?AcBAB<BBC@CdCCCC5DuDDDDFDjEEEEEGEkO%9BZ~7`;_GJGnGGG&GGHSH[HHHKKK2KwKKKKK)KKKKKKHK^KKK/KEKoKKJJJ*J|JJtJJJJJ7JCJLJJJJ JJJqJ}JJJJJJ)J2J;JJL+L=LcLLLL$LHLLLLPLLLLL?LQL PPP'PrPNNBNzO,OPOMMMMhMMMM"M%MLMpMMMMMMMMM*M3MM M M M M M6 MB MK M M M M( M4 MG M M MSMjMMMMMLM`MMM~MMMM1MFMhM:MEMMQQQ QQQQQVQQQQ*Q6Q?QjQvQQQQQ~QQQ Q Q Q Q Q Q QG QV Q Q Q Q. Q/QmQNQdFF!FcFFS<SSSsSS]SSTTTJTnTTU:UUUU&UoUUUUFUjUZ2Z*ZAZZZZ[[ [g\\\[]]]h]]VVV$VXVVVVV"^A^^^^ ^?^V^^^^Y^^ ^x^____I_m___I_m```V````Aa@aRa1aaraaa@akaaaaalaaaK"K7K@KKKxKKKK$KWKKc-cQcd+dddd5dddeeeff)f\gMgggg?grgghhhWW$WWYYYXXXX<X`i i0izjjj3kkk:l8lllLlplm%m9mZmm$mon n-noo(o~pBp&p=ppppp8pq'q;qfqqEqYq qDqq tDtVtttt tRtvttttttr=rerrrWr{uuuuuuEuiuuuuuuu8uDuMuuuuuuuuuuu uuxuvvv;vvvvviwwJ'JDJdJJJxx)x}x3xWj &GGMnE W   `   " ( I    2z>zNzbzzzzezzzzzz;z4zXz z.z^zzz:zNz z z }-}Q{%{f{{{L{{{3{{{`{{{{r{{# {G 'K1Gm~7~K~~~Ae/S E 8 J    n   1 C       6 f @dx=>vYvovvvvvvv7vvvvvvvvv2vV%U7K,r1U\%^D[5k*  Sw!`4z#{b&Dq%9j(L[Nr; Dg<`t<?cTx)Ma = t 'S.<; D!^ 6JwOn<cB-     9y  s(HZngr+S  S e   'evk|Cg D<`"F{d< / 0s @T"F"fHlb;bbbmb bbb"b4bbsbbb b b bpcAcc*c'cc!c+c c> cR c Ae@_h\_dWddd`ddd1d{dd8#_Vz,P B&hCg -|z||T|||]|?|b|||||||K|Z|1|[||d|||| | |% | | | | |& |5 |D |S |b |q | | | | | | | | | |||%|4|C|R|a|p|| |||*|_||||||z|Z~Gk6WRv d@<2 q$II 1&(UAe)MDhH,H@HHH$H8HHHH HHHHHm H H H* H H H H H H H H H H' H H H HaHHHHzHHHHH9HrHHHHWHxHHH&H:HyHHHHH5HHHHHHHHH8H\HHHgHHHHHHHHHH2HHHHH_HHHHPHtHHHH@HHHH HF H H H!H"H"H#H#H$HF$H[$H$H$H$H%H<%H%H%H&HB&Hc&H&H&H'H4'H'H'H/(HE(H:)HP)H)H*H*H*H+H+H^+H+H+H,Hb,H,H,H,H7-H[-H-H-H .HD.H.H.H.H /H/H/H/H0H0H0H20HA0HO0H[0Ho0H0H0H0H0H0HN1Hr1H1H1H2H)2H2H2H2Hh3H{3H\4H 5H65H5H5H56HY6H6H6HW7H{7H7H8Hc8H8H8H8H8H9H9H9H:H;:H\:H=H=H=Hs>H>H@HAHJH#KH^KHTHUH>>>l???!@@@@ABb_=sW{2Vkwi}?SXlcw j~Stk  ( : L x  {$]2F8MVPf~~10Br !W!#J#m#$$'0'''((")R)**k,~,-...00003.333"44444444<5I5R5[5d5x55556l66666{7777 88q8z88899::K;X;a;j;<<<===#=,=>>>???S@\@e@AA'A0AAAAACCCCCCCCCCDIDaDDEEEF FFFGGGGGGGGGGGHHHHH5I>IGIIIIIIIJJKKKBNKNTNNNNN OO(OO~PPPPPPJQSQ\QeQnQwQ9RBR SS*SSSSSNTWT`TU U&V/V8VAVVVVVW&W/W8WWWWW>XGXPXYXLYUY[[[\\\A^J^S^\^e^` ```(`1`:````aaaaabb0bg,T7"o{2>Gv )#/8DPYeqz 1 B X i        c   n  Z p / E  q* !4!L!$$R%u%%%g''''x***+++,,--:.N../e///%000@1d1x123,333444566'8K8_89:6:::::<<=1>U>i>W?k??@R@v@@BAVABBCC.DRDE9EMEE*FNFbFF%GIGzGK4K{KKILbLLM3MMM NkNNN)O=OOP5PIPPPPR+RHUgUUUUVgVVVW=XaXuX!Y@Y\:\h\\\]3]]]^'^%_9_```a/aaaPcdcccc:dNdd.eRefeeefffgggghhjjkkElilll/mSm.nRnnno1oPoopDqqqqrIsmssstdtxtuu#vvvv5wIwwwYxmx9b%<|%K  =         # D a w   ? k _        X   t! ! ! &" ;" " " I# \# # 5$ f$ z$ $ $ % %% \% % % #( B( h(  ) F) * A* * *  + + !, E, Y, , - - #. G. [. / / / / 0 0 0 u1 1 1 1 E2 i2 }2 "3 A3 x3 3 3 3 A5 U5 5 5 =6 a6 u6 17 E7 7 7 8 %8 h8 8 8 9 b9  ? ?? S? @ @ @ A ?A cA wA A B B B B B B  C :C ^C rC 8D LD E E E E F F F G )G  I .I I I  K AK K  L QL uL M M )N MN aN N N |O P P P Q R S S S T VT jT T T  U CU V V W W 4X HY \Y Z 'Z KZ aZ [ 5[ \ -\ \ \ x` ` ` a Ta ha a hb }b Lc 5d >d Qf f f )g 7g Gg h h h  i Ei Ni bi i $j j #k k k l l l m Kn _n 0Y N Ey)W,O'_7f   W   @   z   j|o,t!."#($d%&`())+-'-//_223;3Z4c4557799:;;;N<b< =&J8N%]s52Vl a    n  / : [  $ H ^     @ V  C Y Q u    > b     . e?c4( ~       `  "     = a  & G   8 Y    ) M n 7 X   =1Evd~m Y}   Y y       WG [9]q*Cs3I  g}~ z8LxGkXl  ( s!!!"""$;$m$$%%%r%%%O&c&&&-..R.s.//01)112333[5o5667-7o777 88&9O9^9g9p9y99:: :;;'=4===F=O=I>V>_>h>>>>Q?Z?c????Y@b@9ABAKAAAAAB!B*B3BCCCCCC_DhDqDDDDOEXEaEjEMFVF_FhFqFzFF GGGGGGGGGH HHH&HUH^HgHpHI&I/IEJNJ5K>KGKPKKKNNNNNNOOPPQ QQQQQRRRR0S9SBSKSSSSS1XzXXXXXX$Y6YJYwYYYYY!Z%I $ !X!|!!;!!!!!!!!* """"3""""""" ##&#^####Z#~##8#t##6Z$$C$g$$$2$S$%%%%%%%p%%&0&T&&&=&^&&&'''2'V);VzGrABXau<R f      & :   Ae{^rW{H\p4HB`v 6 Z n  !!!!""#&###;$O$$$ %% &.&B&1'R(v((_))*+@+<,`,,,,]---.. ////u1123K5o55.6R6f6/7P789 ;0;T;h;;;;C\CDDDDDDEE$EFFFFFGGHHHJJJJJKKKK;LDLMLVLyNN"R+R4R=RRRRRR SSSSSTTTU UZUcUlUUUUWWWWWWWWXX%Y.Y7Y@YIYRY[YdYmYvYYCZLZUZ^ZZZZ[[k]t]}]]^^_____```bbcceee4f=fgg gggghhhhiiri{ii1n(((L(`((((((A(((V(z('(K(_(((s((2(V(j((( ( ( (K (_ ( (1 ( ( ( (: ( ( ( () ( ( (5(Y(m(((7([((/(S((+(?(((7(K(`(((((g(}((((((j(~(,(B((;((((F((( (!('!({!(!(!("('"(a"("(='(a'(u'(y(((((()()(&+(J+(^+(+(-(-(>.(b.(v.(.(.(/(/(0(0(1(1(2(.2(C2(2(3(63(J3(3(S4(w4(4(4(5(Q5(u5(5(5(6(&6(:6(6( 7(^7(7( 8( 8(8(8(69(Z9(n9(w:(};(;(;(;(5<(Y<(m<(=**S*i***c**$*H*i*** *C+2+V+J+n++E+i++T+t++,g,,,,B,f,,,,,-P-t---,-P-q----)) ) ))))+)u).<.{...=.\.^.}.*....6.../////%/F///0<0N00 0-0?0j000r0000D0e0F)F;FQF|FFFFFF&F8FRFFFFFFFFF+F~FFFCFgFF FF F F F FFFFFFFFFFF8F\FFFFFFFFnFFCFgFFFFFrFFFFFFFFFF%FIFFFFF) FM Fa F1"FE"F$F$F$F%F,%F@%F%F%F&F'F<'Fc(Fy(F)F)F)F}*F+F+F,F;-FO-F.F.F/FQ/F/F/F/FK1F_1F1F 3F3F%3F.3F73F@3F3F3F3Fp4Fy4F4F4F4F4F4F5F$5F-5F5F5F36F<6FE6F6F6F6F6F'7F47F=7FF7F7F7F7F7F49F=9F9F:F:F:F:F:F:F:F:F:F\;Fe;Fn;Fw;F;F;FF\>Fe>Fn>Fw>F>F>F>F>F>F>F>F@F@F>AFGAFPAFYAFAFBFwBFBFBFBFBFBFCFCF CFoCFxCFCFzDFDFDFDFEFEFEF!EFH222}22_222(2<33333t333=3Q444F4j4444F4Z55$5\555555666a66C6g6}6 6 7=7A7U77777 7D7Z778F9999959Y9o99HH+H4H=HFHOHXHaHjHsH|HHHHHHHHHHHHHHHHVHuH&H/H8HAHHHHHHHHaHjHsH|HHH H H H" H+ H4 Ho Hx H H H H H H H H Hc Hl Hu H~ H H H H H H H& H H H H H H HA HJ HS H\ He Hn H H H H H`HHHHH&HRHvHHHHHH7H`HHHHxHHH@HTH1H H4HIHH,HMH@H^HtHH# H7 H H!H!H!H""HF"H"H"H"H"H#H#H#H$H$H&H$&H8&H&H&H 'HD'HX'H7(H2*HV*H*H*H+H+H,H,H,H-H-H0H,0HP0H0H0H0Hg1H{1H2H2H2H3H 4HM5Hq5H5H6H$7HH7H\7H8H8H8H8H8H9H/9HlHw>H>H?HAHAHAHAHAHAH BH#BH5BHOBHBHBHDH-EH%GHbHHHH`JH;LHMHzOH]Q???v?????>??@@@Y@j@@@@@@@>>>>!>S>w>>>3>W===5=F=x====b=<<<<#<U<y<<<P<t2VSw;;;e;v;;;>;b;;:::w::::/:S::k|AAACCBBEE+ErEEEEEEFFF F1FF F4FFGGGGGGG%GGH>HbHvHH<H`HHHHHGGGGeGyGTGxGGG=GGGGGGG G0 GF G G G G G G G G GGeGGGGGGG|GGGGGoGGGGG$G8GGG!GEGGGGGGGaGGGG=GaGGGG{GGG/GSGgGGGJGnGGGcGrG{GGGGGGGGGGGGGGGG GGG&G/G8GAG`GGGGG G G# G, G G G G G GS!G\!Ge!Gn!Gw!G!G!G!G"G "G"Ge"Gn"G"G"G"G"G#G #GP#GY#Gb#G#G#G#G#GZ&IIIIzIIIIIJJJJvJJJJJKKK%KKKKKNKrL%L9L_LLL,LaLuL-LLLkLLLLLL\LeLLLLLLLL:LCLLLUL^LGLLLL+LL L_ L M4MiMM^MMMMMgMMM MMMqMMMKMoMMMMM`MMMM M M M$ M@ Md M M M M0 MD c4cUcccLR(6/>Z{D57T5UUUUUUU*UAU[UvUUUUUU U(U?U_UwUUUUUUUUU UqUzUU%UUUUUUU;1UD1U1U1U5U5U[[ [[0[[![6[J\7\K\\\M\a\\\\@\v\\\_\\\ \|\\\\N\\#\#\?(\p(\*\*\l,\,6J }"P m   g }  . _>_R_____e_{___ _- _ _ _ _ _ _ _ _ _ _t__)_O_w_`4`H`S`w``1`y````B`n``` ` a5aIa|aaaaaab7bKb{bb b%bbbNbb-bnbbbbWb}bb?bbb bB b c?cScc|cc`cIcRchcccc+cd3dGddd5dadd d d' d d dd(d>dld+dLddddd3dadd7dBdcd d dN#do#dx%d%d'd'dE)ds)dl*d*d+d+d,d,d-5Kge5emef7fKf~ffff`g;gOggg~ggTgjgggggth;hOhhhshhJh`hhhhhhi6jBjajjjYjmjHjgkAkqkPkdkkkkkk kkkIkhkkkkkZkpk k k lAlUl{llll4lMll2lllll}q3r45u443{7{c{{{{{|56FKl~445Iyim6i((<((65(hAmL&:<hJnDX=Q83Gz8\1G|H^h%8Li* Fn    C f $=44`L`(Ru4uHu{uu+uWuuuDuZuuuuu<uRuuu!uBuuuuuCuYuuuuw4wHw{www@ww/wo46L5m~O`(Sd(S8o#,nw8tbk(85B+CZi~(7:xCOX(?mz4zHzd(<o255I|5Iy,#ey4Hx:Yu0g8L*@q4Hx7.a7K,r4H{4Hx"SBhb+Q  _ s   8Lc>|?K_44Hxn4H35I"m#6Zz6Zz5I|&:4346Jz 8)OG[97K~y4H{3Gw=ith |   1 4H{bHO4H{Wmh~s7P:PI@T #,}K y   \ p @O!"@OsDG@OuIAJ@Oo /(L(L(L(L(L(L(L(L(L(L(L(L*N<*Nk*N*N*Nx(L*N8(L*Nv(L(L,P*N D*N::c/ k 4?pi$$% &(&T&p&&{''E(s(6)T*j*i#A|  3V7.$R,?bp<bk;(LQ0V  f  R      |$09zX!{!0" q      [ _  B e     K |  Y   ' c x           I ^ g            ( V | %$ X$ ++ N+ ], g              1 N t   L  |     D  0 " s    *     4 m 3 l     Q w E h   ` y e; < M d  k|r%DF2CZy+<SY+ < S r !)!@!l!2"N"_"v""""#=###$&$E$$$$%%%Hl]Lo7b   )  1 w    39@Z~o'KPtnX|: ^     V    * 3 5ZcAJq,yCh.9  *A@cq! " """9##!$(U(L(L/4(U| (Up(L^4bRu*#h);dm9?9Q999*W 4 X   l    2 V   ) M   = a s   {   * N    #    9      T h  8\#(#:#I###N#r###@#T#####`#t####g###c####7#K#~###8#\#p###w## #4 # # #! #7 # # #F #\ # # #_ #u #N #d # # ###V#l#######2#a#####=#a#u##-#A#t####>#b###N#r####;#####\####)#M##*#>#n####2#y####>#b#####f####,#\### #1#####$#W#####(#[#### # # # #!#$!#W!#~!#!#!#"#;"#"#"#"#"#z########Q$#e$#$#$#O%#c%#%#%#$&#8&#h&#&#&#'##'#S'#'#'#'#(#(#(#(#(#)#k)$($<$o$$$$B$i$$$ $$$$-$T$$$$$$.$b$$$$$ $7$l$$o $ $ $ $ $P $ $ $ $ $4 $d $ $ $ $ $ $ $ $ $$6$b$v$e$$$$#$s$$$$/$C$v$$$$$$k$$n%(%%%1%%%?%%%Y%%@%%%N%b%%%6%%%%%%x%%%i%}%% %\ %p % % %U % % % % % % % % %R %f % % % %%f%z%%%!%E%%%%%`%t%%%!%E%%%%%h%%#%7%%%{%%G%n%% &(&L&&&&&V&j&&&b&v&&&D&X&&&2&F&|&&&&|&&&&&T&&&&&e&y&&&5&I&y&&& & & & & &S &g & & & & &C &j & & & &# & & & & & & & &1&&&&&]&q&&&&&&&&&&&&&&&g&{&&&<&P&&'('<'l'''='f'''''' '/ ' ' ' ' ''''|'''''6''U''!'!'!'('('(' *'+'+'+=(=<=o====.=U====@====%=7=K=========d=x===(=E======== =f =z = = = = =: = = =% =L = = = = =M =a = = = =} = = = =/=\==!=L===t====B=w===-=====Q===.=`==== =4=H==== =>===== =A=R====T=h=====.=B==4=[=o==.=======m====S=$ =8 =j = =!=h!=!="=."="="= #=?#=#=#=$=C$="%=6%=%=&=&=&=&='='= (=(=(=(=(=.)=~)=)=)= *=!*=S*44J4444>444$4o44444444444446<6S6b6q66663&3\333z33r333#.b.M..:0:T:c::Z-ZVZjZZZZZ<ZPZZZ:(:LA,ABAA J0J)()LY(Y8YYYYYYO(O\OmOOO(8<(<V<z.Z9(9T99(L7[e/S#G[W /   . R   P t + O   .(.L...*.v...S......I.......2.V... .-.v....P.t...*. . . ..........+.Y..>...!..Q..T#.#.#.,).J).).0.0.0. 2.*2.a2.2.2.3.3L.LBLLLLL$L8LjLLLLL&LXLLLLLLFLrLLLLL*LDLLLLL'L1LDL|LLLLLFLbLL#L~LLL^(^L^`^^^^^^ ^p^^^^^^^r^^^^^^u^^*^^^^^^^[ ^ ^_ ^ ^e ^ ^ ^ ^s ^ ^ ^ ^^^^^w^^*^\^^^^^W^^Y^^\^^^>^b^^^&^:^;^q^^^N^m^^c^^^^3^4^^e^^^^ ^3!^!^!^qz "2>Gh|)=d~'C[p$1`{0Dh|G[m 0J]jy(=N2,2u22222222 2 2,2@2L2]2u22D&DFD~DDDDDD$DDD DHDDDDDDD:(Ly to do that. MO actorNZ4r>5" 5NZ5r&That would require a physical body. =NZ8r"You smile enigmatically over at !< . PMO actorN:r"You smile enigmatically over at !< . [MO actorNM =r>5" 5NM >r&That would require a physical body. @NM @r%Furtively you reach over and pinch !< . \SMO actorN Br%Furtively you reach over and pinch !< . MO actorNF DrnStealthily you stalk your prey, lurking unseen, baiting, waiting for just the perfect moment to pounce upon !< . MO actorN FrnStealthily you stalk your prey, lurking unseen, baiting, waiting for just the perfect moment to pounce upon !< . qMO actorN Jr<  D< ! AN Kr5Such a thing does not yet exist within your lands. vMO actorN MrYou summon forth !<,. which immediately appears at your command. > <&eMO actorN} Sr>5" 2N} Tr#That would reveal your presence. N} Vr)UMO actorN Xr'You howl mournfully at the oblivious !<. VhMO actorNC [r>5" 5NC \r&That would require a physical body. NC ^r)WWMO actorN `r>" /N arYou scratch at !<. LN crYou scratch and claw at !< with your sharp talons. eMO actorNWfr>5" 2NWgr#That would reveal your presence. NWir)JMO actorNkrYou coo affectionately at !<. MO actorNnrPMO actorN6pr1You shouldn't fling your name about like that. eMO actorNsr>5" 2Ntr#That would reveal your presence. Nvr)TMO acSRC2ӱ$EOF